F470454

General Info

Members Datasets Scaffolds Average Seq Length
626 299 626 163

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10392956|Ga0105240_103929563
Length 193
Sequence VVQGILARFIPDRCAASGAPPIAEPQGRPMAGDVSFDVVSDFDEQELRNALDQVRREVGQRFDFKGVTVDLEQSKDELTLVTDDEHRAAAIKDLIESKAVRRNLSLKIFDWGRIEPSGGNKVRQSITLRRGLNDELAKKISKLIREEFPKVKPQIQGDAVRVSGKSRDELQKVIGRLRELEELPVPLQFENYR

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
194 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
218 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 5.91
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 0.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10046962 3300001991 Unclassified 875
2 JGI24749J21850_1020202 3300002076 Bacteria 940
3 Ga0065715_10509233 3300005293 Bacteria 773
4 Ga0065707_10375342 3300005295 Bacteria 884
5 Ga0070658_10241879 3300005327 Bacteria 1530
6 Ga0070676_10111411 3300005328 Bacteria 1704
7 Ga0070676_10685557 3300005328 Unclassified 747
8 Ga0070683_100156938 3300005329 Bacteria 2158
9 Ga0070683_100863814 3300005329 Bacteria 868
10 Ga0070683_100901499 3300005329 Bacteria 848
11 Ga0070690_100014092 3300005330 Bacteria 4740
12 Ga0070670_100089777 3300005331 Bacteria 2642
13 Ga0070670_100311092 3300005331 Bacteria 1379
14 Ga0068869_100030300 3300005334 Bacteria 3796
15 Ga0068869_100576464 3300005334 Unclassified 948
16 Ga0070666_10394560 3300005335 Unclassified 994
17 Ga0070680_100436709 3300005336 Unclassified 1117
18 Ga0070682_100161518 3300005337 Bacteria 1548
19 Ga0070682_100939009 3300005337 Bacteria 714
20 Ga0068868_100491901 3300005338 Unclassified 1073
21 Ga0068868_100548167 3300005338 Unclassified 1019
22 Ga0070660_100066802 3300005339 Bacteria 2801
23 Ga0070660_100325088 3300005339 Bacteria 1264
24 Ga0070689_100003459 3300005340 Bacteria 10503
25 Ga0070691_10003464 3300005341 Bacteria 7099
26 Ga0070687_100000829 3300005343 Bacteria 10321
27 Ga0070687_100460365 3300005343 Bacteria 848
28 Ga0070661_100600595 3300005344 Unclassified 890
29 Ga0070692_10327643 3300005345 Unclassified 944
30 Ga0070692_10383334 3300005345 Bacteria 883
31 Ga0070668_100074006 3300005347 Bacteria 2657
32 Ga0070668_100338209 3300005347 Bacteria 1271
33 Ga0070669_100129992 3300005353 Bacteria 1931
34 Ga0070669_100817082 3300005353 Unclassified 793
35 Ga0070675_100148623 3300005354 Bacteria 2007
36 Ga0070671_100343230 3300005355 Bacteria 1274
37 Ga0070671_100572225 3300005355 Unclassified 975
38 Ga0070674_100006333 3300005356 Bacteria 6896
39 Ga0070673_100002033 3300005364 Bacteria 12206
40 Ga0070688_100002572 3300005365 Bacteria 9189
41 Ga0070688_100597440 3300005365 Bacteria 844
42 Ga0070659_100008430 3300005366 Bacteria 7529
43 Ga0070659_100395402 3300005366 Bacteria 1166
44 Ga0070659_100504916 3300005366 Bacteria 1031
45 Ga0070659_100538060 3300005366 Bacteria 999
46 Ga0070703_10009342 3300005406 Bacteria 2766
47 Ga0070701_10040831 3300005438 Bacteria 2361
48 Ga0070705_100010402 3300005440 Bacteria 4656
49 Ga0070705_100012300 3300005440 Bacteria 4348
50 Ga0070705_100016836 3300005440 Bacteria 3806
51 Ga0070705_100119196 3300005440 Bacteria 1701
52 Ga0070700_100071854 3300005441 Bacteria 2210
53 Ga0070700_100129481 3300005441 Bacteria 1701
54 Ga0070700_100488357 3300005441 Unclassified 945
55 Ga0070694_100006418 3300005444 Bacteria 7134
56 Ga0070694_100068632 3300005444 Unclassified 2437
57 Ga0070694_100124864 3300005444 Bacteria 1851
58 Ga0070694_100166317 3300005444 Bacteria 1622
59 Ga0070694_100325647 3300005444 Unclassified 1184
60 Ga0070694_100452547 3300005444 Bacteria 1014
61 Ga0070694_101191638 3300005444 Bacteria 638
62 Ga0070708_100002789 3300005445 Bacteria 13580
63 Ga0070708_100051497 3300005445 Bacteria 3648
64 Ga0070663_100042986 3300005455 Bacteria 3178
65 Ga0070663_100817833 3300005455 Bacteria 800
66 Ga0070678_100306182 3300005456 Bacteria 1352
67 Ga0070678_101091679 3300005456 Bacteria 736
68 Ga0070662_100231572 3300005457 Bacteria 1478
69 Ga0070681_10348031 3300005458 Bacteria 1392
70 Ga0070681_10454317 3300005458 Bacteria 1193
71 Ga0070681_10512080 3300005458 Bacteria 1113
72 Ga0070681_10651383 3300005458 Unclassified 968
73 Ga0070681_10833048 3300005458 Bacteria 840
74 Ga0068867_100018046 3300005459 Bacteria 5014
75 Ga0070685_10011431 3300005466 Bacteria 4646
76 Ga0070706_100000374 3300005467 Bacteria 53751
77 Ga0070706_100000528 3300005467 Bacteria 44483
78 Ga0070706_100149509 3300005467 Bacteria 2180
79 Ga0070707_100004216 3300005468 Bacteria 13475
80 Ga0070707_100096671 3300005468 Bacteria 2861
81 Ga0070698_100316825 3300005471 Bacteria 1490
82 Ga0070698_100646393 3300005471 Bacteria 999
83 Ga0070699_100014846 3300005518 Bacteria 6697
84 Ga0070699_100046650 3300005518 Bacteria 3749
85 Ga0070699_100436108 3300005518 Bacteria 1187
86 Ga0070699_100462510 3300005518 Unclassified 1151
87 Ga0070699_100674512 3300005518 Unclassified 944
88 Ga0070699_101291291 3300005518 Bacteria 669
89 Ga0070679_100028396 3300005530 Bacteria 5515
90 Ga0070679_100561141 3300005530 Bacteria 1085
91 Ga0070679_100570255 3300005530 Unclassified 1075
92 Ga0070679_101323782 3300005530 Bacteria 666
93 Ga0070684_100278410 3300005535 Unclassified 1532
94 Ga0070684_100463968 3300005535 Bacteria 1171
95 Ga0070697_100005120 3300005536 Bacteria 10068
96 Ga0070697_100020214 3300005536 Bacteria 5264
97 Ga0070697_100062839 3300005536 Bacteria 3031
98 Ga0070697_100218326 3300005536 Bacteria 1625
99 Ga0070697_100399139 3300005536 Bacteria 1193
100 Ga0068853_100140477 3300005539 Bacteria 2168
101 Ga0068853_101231188 3300005539 Bacteria 723
102 Ga0068853_101360863 3300005539 Bacteria 686
103 Ga0068853_101503875 3300005539 Bacteria 652
104 Ga0070695_100016070 3300005545 Bacteria 4525
105 Ga0070695_100044621 3300005545 Bacteria 2823
106 Ga0070695_100176304 3300005545 Bacteria 1511
107 Ga0070695_100236169 3300005545 Bacteria 1324
108 Ga0070695_100554025 3300005545 Bacteria 897
109 Ga0070696_100076132 3300005546 Bacteria 2368
110 Ga0070696_100132572 3300005546 Bacteria 1814
111 Ga0070693_100249941 3300005547 Bacteria 1175
112 Ga0070665_100639374 3300005548 Unclassified 1077
113 Ga0070704_100007204 3300005549 Bacteria 6613
114 Ga0070704_100087709 3300005549 Bacteria 2310
115 Ga0070704_100115718 3300005549 Unclassified 2049
116 Ga0070704_100335892 3300005549 Bacteria 1271
117 Ga0070704_100587702 3300005549 Bacteria 977
118 Ga0068855_100104951 3300005563 Bacteria 3250
119 Ga0068857_100024638 3300005577 Bacteria 5299
120 Ga0070702_100000984 3300005615 Bacteria 11240
121 Ga0068852_100021181 3300005616 Bacteria 5183
122 Ga0068852_100030876 3300005616 Bacteria 4415
123 Ga0068859_100085464 3300005617 Bacteria 3200
124 Ga0068859_100637390 3300005617 Unclassified 1158
125 Ga0068859_100982247 3300005617 Unclassified 927
126 Ga0068864_100033660 3300005618 Bacteria 4357
127 Ga0068864_101152616 3300005618 Bacteria 773
128 Ga0068866_10038039 3300005718 Bacteria 2367
129 Ga0068861_100583356 3300005719 Bacteria 1024
130 Ga0068858_100058133 3300005842 Bacteria 3575
131 Ga0068860_100183995 3300005843 Bacteria 2020
132 Ga0068860_100440293 3300005843 Bacteria 1294
133 Ga0068862_100046135 3300005844 Bacteria 3719
134 Ga0068862_100291867 3300005844 Bacteria 1498
135 Ga0081539_10010782 3300005985 Bacteria 7356
136 Ga0075365_10002896 3300006038 Bacteria 8647
137 Ga0075364_10003417 3300006051 Bacteria 9026
138 Ga0075432_10131836 3300006058 Unclassified 947
139 Ga0070716_100487190 3300006173 Bacteria 907
140 Ga0070716_100526722 3300006173 Unclassified 877
141 Ga0070716_100654739 3300006173 Unclassified 797
142 Ga0097621_100216434 3300006237 Bacteria 1668
143 Ga0097621_100975018 3300006237 Bacteria 792
144 Ga0075428_100769637 3300006844 Bacteria 1024
145 Ga0075431_100214169 3300006847 Bacteria 1967
146 Ga0075431_100229100 3300006847 Bacteria 1894
147 Ga0075431_100947492 3300006847 Bacteria 829
148 Ga0075433_10129634 3300006852 Bacteria 2240
149 Ga0075433_10275738 3300006852 Bacteria 1490
150 Ga0075433_10325324 3300006852 Unclassified 1360
151 Ga0075434_100814863 3300006871 Bacteria 949
152 Ga0075429_100963741 3300006880 Bacteria 746
153 Ga0068865_100012709 3300006881 Bacteria 5305
154 Ga0075436_100369594 3300006914 Bacteria 1036
155 Ga0097620_100085471 3300006931 Bacteria 3200
156 Ga0097620_100637388 3300006931 Unclassified 1158
157 Ga0097620_100981930 3300006931 Unclassified 927
158 Ga0097620_101474530 3300006931 Unclassified 751
159 Ga0075435_100560275 3300007076 Bacteria 990
160 Ga0105251_10230282 3300009011 Bacteria 834
161 Ga0105240_10392956 3300009093 Bacteria 1564
162 Ga0111539_10000282 3300009094 Bacteria 61040
163 Ga0111539_10008872 3300009094 Bacteria 12734
164 Ga0111539_10112699 3300009094 Bacteria 3191
165 Ga0111539_10147186 3300009094 Bacteria 2758
166 Ga0111539_10720575 3300009094 Unclassified 1161
167 Ga0111539_11892564 3300009094 Bacteria 692
168 Ga0105245_10013989 3300009098 Bacteria 6989
169 Ga0105245_10136678 3300009098 Bacteria 2304
170 Ga0105245_10315057 3300009098 Bacteria 1539
171 Ga0105245_10424725 3300009098 Unclassified 1333
172 Ga0114129_10090097 3300009147 Bacteria 4252
173 Ga0114129_10096844 3300009147 Bacteria 4085
174 Ga0114129_10131066 3300009147 Bacteria 3443
175 Ga0114129_10184981 3300009147 Unclassified 2832
176 Ga0114129_10583749 3300009147 Bacteria 1450
177 Ga0114129_10947684 3300009147 Bacteria 1087
178 Ga0105243_10133193 3300009148 Unclassified 2112
179 Ga0105243_10163660 3300009148 Bacteria 1920
180 Ga0105243_10433996 3300009148 Bacteria 1228
181 Ga0105241_10252514 3300009174 Bacteria 1496
182 Ga0105241_11324039 3300009174 Unclassified 687
183 Ga0105242_10440333 3300009176 Bacteria 1226
184 Ga0105248_10382383 3300009177 Bacteria 1585
185 Ga0105248_10921216 3300009177 Unclassified 987
186 Ga0105237_10144150 3300009545 Bacteria 2376
187 Ga0105237_11395431 3300009545 Unclassified 707
188 Ga0105238_10093437 3300009551 Bacteria 2996
189 Ga0105249_10004683 3300009553 Bacteria 11814
190 Ga0105249_10210713 3300009553 Bacteria 1907
191 Ga0105249_10222811 3300009553 Bacteria 1857
192 Ga0105249_10401397 3300009553 Bacteria 1401
193 Ga0105249_11257653 3300009553 Bacteria 811
194 Ga0105249_11363206 3300009553 Unclassified 781
195 Ga0105239_10038180 3300010375 Bacteria 5263
196 Ga0105239_10429901 3300010375 Bacteria 1497
197 Ga0105246_10306592 3300011119 Bacteria 1284
198 Ga0105246_10313786 3300011119 Bacteria 1271
199 Ga0105246_10407201 3300011119 Unclassified 1131
200 Ga0105246_11033385 3300011119 Bacteria 746
201 Ga0157373_10505813 3300013100 Bacteria 873
202 Ga0157374_10630779 3300013296 Unclassified 1083
203 Ga0157378_10069343 3300013297 Bacteria 3163
204 Ga0157378_10461061 3300013297 Bacteria 1263
205 Ga0157378_10625912 3300013297 Bacteria 1090
206 Ga0163162_10355703 3300013306 Bacteria 1597
207 Ga0157375_10317204 3300013308 Unclassified 1723
208 Ga0157375_10689966 3300013308 Bacteria 1175
209 Ga0157375_12022470 3300013308 Unclassified 685
210 Ga0163163_10049588 3300014325 Bacteria 4132
211 Ga0163163_10218725 3300014325 Bacteria 1953
212 Ga0163163_10228807 3300014325 Bacteria 1908
213 Ga0157380_10016559 3300014326 Bacteria 5439
214 Ga0157380_10380583 3300014326 Unclassified 1332
215 Ga0157377_10001089 3300014745 Bacteria 11494
216 Ga0157377_10060360 3300014745 Bacteria 2164
217 Ga0157377_10240500 3300014745 Bacteria 1168
218 Ga0157379_10190614 3300014968 Unclassified 1853
219 Ga0157379_10289179 3300014968 Bacteria 1492
220 Ga0157379_10373201 3300014968 Bacteria 1308
221 Ga0157376_10721007 3300014969 Bacteria 1004
222 Ga0157376_10782660 3300014969 Bacteria 965
223 Ga0163161_10109057 3300017792 Bacteria 2068
224 Ga0163161_10680954 3300017792 Bacteria 855
225 Ga0163161_10681861 3300017792 Bacteria 854
226 Ga0163161_10775744 3300017792 Bacteria 804
227 Ga0206356_11066570 3300020070 Bacteria 4639
228 Ga0206351_10832329 3300020077 Bacteria 2105
229 Ga0206354_10664940 3300020081 Bacteria 2190
230 Ga0224712_10002139 3300022467 Bacteria 4806
231 Ga0207656_10205789 3300025321 Unclassified 952
232 Ga0207642_10286676 3300025899 Unclassified 949
233 Ga0207688_10000452 3300025901 Bacteria 19462
234 Ga0207680_10594878 3300025903 Unclassified 791
235 Ga0207645_10061144 3300025907 Bacteria 2406
236 Ga0207645_10543641 3300025907 Unclassified 788
237 Ga0207643_10427345 3300025908 Unclassified 840
238 Ga0207643_10494022 3300025908 Unclassified 782
239 Ga0207705_10668966 3300025909 Unclassified 807
240 Ga0207684_10000636 3300025910 Bacteria 41641
241 Ga0207684_10008151 3300025910 Bacteria 9335
242 Ga0207684_10009155 3300025910 Bacteria 8763
243 Ga0207684_10041677 3300025910 Bacteria 3891
244 Ga0207684_11154786 3300025910 Bacteria 643
245 Ga0207654_10132183 3300025911 Bacteria 1581
246 Ga0207707_10105470 3300025912 Unclassified 2463
247 Ga0207707_10284397 3300025912 Bacteria 1432
248 Ga0207707_10716608 3300025912 Bacteria 839
249 Ga0207707_10910477 3300025912 Bacteria 727
250 Ga0207695_11120202 3300025913 Bacteria 667
251 Ga0207671_10283364 3300025914 Unclassified 1307
252 Ga0207663_10871990 3300025916 Bacteria 719
253 Ga0207660_10028234 3300025917 Bacteria 3837
254 Ga0207660_11214964 3300025917 Unclassified 613
255 Ga0207662_10001307 3300025918 Bacteria 12000
256 Ga0207657_10015330 3300025919 Bacteria 7429
257 Ga0207657_10213656 3300025919 Bacteria 1547
258 Ga0207652_10025593 3300025921 Bacteria 4908
259 Ga0207646_10005701 3300025922 Bacteria 13059
260 Ga0207646_10005912 3300025922 Bacteria 12771
261 Ga0207681_10056929 3300025923 Bacteria 2669
262 Ga0207681_10756828 3300025923 Unclassified 810
263 Ga0207694_10157765 3300025924 Bacteria 1831
264 Ga0207659_10048570 3300025926 Bacteria 3007
265 Ga0207687_10022727 3300025927 Bacteria 4176
266 Ga0207687_10058726 3300025927 Bacteria 2707
267 Ga0207687_10162136 3300025927 Bacteria 1717
268 Ga0207690_10060829 3300025932 Unclassified 2565
269 Ga0207690_10110902 3300025932 Bacteria 1976
270 Ga0207706_10057655 3300025933 Bacteria 3421
271 Ga0207706_10070012 3300025933 Bacteria 3085
272 Ga0207686_10026237 3300025934 Bacteria 3398
273 Ga0207709_10400062 3300025935 Bacteria 1050
274 Ga0207709_10522548 3300025935 Bacteria 929
275 Ga0207709_10662281 3300025935 Unclassified 832
276 Ga0207670_10085430 3300025936 Bacteria 2217
277 Ga0207669_10037965 3300025937 Bacteria 2769
278 Ga0207669_10776750 3300025937 Unclassified 793
279 Ga0207704_10197482 3300025938 Unclassified 1469
280 Ga0207704_10253151 3300025938 Bacteria 1323
281 Ga0207665_10217740 3300025939 Bacteria 1398
282 Ga0207665_10373067 3300025939 Bacteria 1081
283 Ga0207711_10393305 3300025941 Bacteria 1287
284 Ga0207689_10016068 3300025942 Bacteria 6335
285 Ga0207689_10382258 3300025942 Unclassified 1172
286 Ga0207661_10148433 3300025944 Bacteria 2025
287 Ga0207661_10239512 3300025944 Bacteria 1609
288 Ga0207661_11378328 3300025944 Bacteria 647
289 Ga0207679_10547160 3300025945 Bacteria 1038
290 Ga0207667_10176095 3300025949 Bacteria 2197
291 Ga0207651_10106109 3300025960 Bacteria 2097
292 Ga0207712_10012939 3300025961 Bacteria 5341
293 Ga0207712_10152875 3300025961 Bacteria 1784
294 Ga0207712_10797695 3300025961 Bacteria 830
295 Ga0207668_10039446 3300025972 Bacteria 3179
296 Ga0207640_10100267 3300025981 Bacteria 2029
297 Ga0207677_10087556 3300026023 Unclassified 2255
298 Ga0207677_10420747 3300026023 Unclassified 1138
299 Ga0207703_10129485 3300026035 Bacteria 2177
300 Ga0207678_10036007 3300026067 Bacteria 4308
301 Ga0207678_11076708 3300026067 Bacteria 712
302 Ga0207678_11125456 3300026067 Bacteria 695
303 Ga0207708_10012012 3300026075 Bacteria 6452
304 Ga0207708_10016501 3300026075 Bacteria 5554
305 Ga0207708_10177616 3300026075 Bacteria 1689
306 Ga0207641_10556324 3300026088 Unclassified 1119
307 Ga0207648_10000662 3300026089 Bacteria 38576
308 Ga0207648_10872967 3300026089 Bacteria 839
309 Ga0207676_10161183 3300026095 Bacteria 1943
310 Ga0207676_11224014 3300026095 Bacteria 744
311 Ga0207674_10015884 3300026116 Bacteria 8252
312 Ga0207674_10035517 3300026116 Bacteria 5201
313 Ga0207675_100012080 3300026118 Bacteria 8069
314 Ga0207675_100016431 3300026118 Bacteria 6912
315 Ga0207675_100365359 3300026118 Bacteria 1417
316 Ga0207683_10165482 3300026121 Bacteria 2001
317 Ga0207683_10291027 3300026121 Bacteria 1493
318 Ga0207683_10674046 3300026121 Bacteria 958
319 Ga0207698_10047334 3300026142 Bacteria 3257
320 Ga0207698_10650570 3300026142 Bacteria 1044
321 Ga0209983_1048599 3300027665 Bacteria 926
322 Ga0209983_1072951 3300027665 Unclassified 766
323 Ga0209974_10029984 3300027876 Bacteria 1803
324 Ga0207428_10031535 3300027907 Bacteria 4370
325 Ga0207428_10034264 3300027907 Bacteria 4163
326 Ga0207428_10642744 3300027907 Unclassified 762
327 Ga0207428_10988301 3300027907 Unclassified 592
328 Ga0268266_10149676 3300028379 Bacteria 2103
329 Ga0268265_10640666 3300028380 Bacteria 1020
330 Ga0268265_11313074 3300028380 Bacteria 724
331 Ga0268264_10243981 3300028381 Bacteria 1665
332 Ga0268264_10494354 3300028381 Bacteria 1192
333 Ga0268264_11612935 3300028381 Unclassified 659
334 Ga0265326_10051236 3300028558 Bacteria 1169
335 Ga0265319_1113762 3300028563 Bacteria 845
336 Ga0265334_10070824 3300028573 Bacteria 1299
337 Ga0265318_10163811 3300028577 Bacteria 815
338 Ga0265323_10076808 3300028653 Bacteria 1133
339 Ga0265336_10072605 3300028666 Unclassified 1029
340 Ga0265336_10084863 3300028666 Unclassified 945
341 Ga0265338_10015195 3300028800 Bacteria 8485
342 Ga0265338_10745884 3300028800 Unclassified 673
343 Ga0265324_10029965 3300029957 Bacteria 1912
344 Ga0265332_10082229 3300031238 Bacteria 1366
345 Ga0265320_10004262 3300031240 Bacteria 9398
346 Ga0265325_10058238 3300031241 Bacteria 1969
347 Ga0265329_10012442 3300031242 Bacteria 3058
348 Ga0265339_10013978 3300031249 Bacteria 4854
349 Ga0265331_10045383 3300031250 Bacteria 2121
350 Ga0265316_10052421 3300031344 Unclassified 3201
351 Ga0265316_10099361 3300031344 Bacteria 2213
352 Ga0307408_100030415 3300031548 Bacteria 3750
353 Ga0316575_10083809 3300031665 Bacteria 1287
354 Ga0265314_10112969 3300031711 Bacteria 1723
355 Ga0265342_10043506 3300031712 Bacteria 2710
356 Ga0307413_10134844 3300031824 Bacteria 1696
357 Ga0307413_10406102 3300031824 Unclassified 1069
358 Ga0307413_10769000 3300031824 Bacteria 807
359 Ga0307410_10321943 3300031852 Bacteria 1227
360 Ga0307406_10406795 3300031901 Unclassified 1080
361 Ga0307406_10460933 3300031901 Unclassified 1022
362 Ga0307412_10354516 3300031911 Bacteria 1179
363 Ga0307412_10716355 3300031911 Bacteria 860
364 Ga0307412_11121454 3300031911 Unclassified 701
365 Ga0307409_100019934 3300031995 Bacteria 4556
366 Ga0307409_100054802 3300031995 Bacteria 3074
367 Ga0307409_100092330 3300031995 Bacteria 2484
368 Ga0307416_100006460 3300032002 Bacteria 7342
369 Ga0307416_100322590 3300032002 Bacteria 1547
370 Ga0307416_100523239 3300032002 Bacteria 1255
371 Ga0307416_101860919 3300032002 Unclassified 705
372 Ga0307416_102368506 3300032002 Bacteria 631
373 Ga0307416_103183564 3300032002 Bacteria 549
374 Ga0307414_10497364 3300032004 Unclassified 1078
375 Ga0307411_10234023 3300032005 Unclassified 1434
376 Ga0307415_100040624 3300032126 Bacteria 3083
377 Ga0307415_100042533 3300032126 Bacteria 3024
378 Ga0307415_101851041 3300032126 Unclassified 585
379 Ga0307415_102011585 3300032126 Bacteria 563
380 Ga0316583_10012329 3300032133 Bacteria 3084
381 Ga0373926_0282798 3300035083 Bacteria 646
382 Ga0373936_0143158 3300035113 Bacteria 1033
383 Ga0373939_0010691 3300035114 Bacteria 2302
384 Ga0373941_0066602 3300035115 Bacteria 1186
385 Ga0373945_0056063 3300035116 Bacteria 1461
386 Ga0373954_0008438 3300035118 Unclassified 4520
387 Ga0373946_0350943 3300035171 Bacteria 738
388 Ga0373962_0017216 3300035242 Unclassified 1872
389 Ga0316574_0060258 3300035398 Bacteria 2382
390 Ga0316574_0150782 3300035398 Bacteria 1498
391 Ga0373924_0242837 3300035410 Archaea 797
392 Ga0373931_0219822 3300035691 Unclassified 1143
393 Ga0373935_1249176 3300035692 Bacteria 554
394 Ga0373927_0000014 3300035695 Bacteria 156951
395 Ga0373937_1150248 3300036401 Bacteria 725
396 Ga0316582_0712445 3300036647 Unclassified 689
397 Ga0373925_0521991 3300037068 Bacteria 976
398 Ga0395901_0024236 3300038443 Bacteria 6226
399 Ga0439466_0094162 3300041411 Bacteria 938
400 Ga0451802_1162171 3300041460 Bacteria 513
401 Ga0451807_0831768 3300041486 Unclassified 664
402 Ga0451839_1096332 3300041496 Bacteria 576
403 Ga0451839_1257871 3300041496 Bacteria 848
404 Ga0451843_1176553 3300041509 Bacteria 964
405 Ga0451853_2341168 3300041512 Bacteria 1117
406 Ga0450903_016733 3300042138 Bacteria 1150
407 Ga0450910_003647 3300042147 Bacteria 2052
408 Ga0439446_0101619 3300042156 Bacteria 910
409 Ga0439458_0041328 3300042157 Bacteria 1120
410 Ga0439434_0020185 3300042435 Bacteria 2000
411 Ga0439460_0110536 3300042461 Bacteria 891
412 Ga0450916_049755 3300042530 Bacteria 658
413 Ga0466963_0989970 3300044694 Bacteria 592
414 Ga0453684_0419249 3300044712 Bacteria 1496
415 Ga0466960_0092415 3300044901 Bacteria 1545
416 Ga0451576_0291608 3300045051 Bacteria 1706
417 Ga0466967_1367096 3300045976 Bacteria 705
418 Ga0495629_0247181 3300046459 Bacteria 1228
419 Ga0495641_0065719 3300046461 Bacteria 1633
420 Ga0495628_0679114 3300046516 Bacteria 729
421 Ga0495628_0888906 3300046516 Bacteria 619
422 Ga0495652_0518768 3300046529 Bacteria 824
423 Ga0495652_0989004 3300046529 Bacteria 551
424 Ga0495667_0206015 3300046559 Bacteria 1258
425 Ga0495635_0332941 3300046663 Bacteria 1015
426 Ga0495658_0218813 3300046683 Unclassified 1192
427 Ga0495624_0322833 3300046690 Bacteria 930
428 Ga0495674_0202973 3300047319 Bacteria 1644
429 Ga0495676_0312067 3300047321 Unclassified 1058
430 Ga0496101_0366095 3300048904 Bacteria 1134
431 Ga0496102_0072109 3300048905 Bacteria 3173
432 Ga0496102_0171063 3300048905 Bacteria 2045
433 Ga0496102_0275093 3300048905 Unclassified 1587
434 Ga0496102_0292077 3300048905 Bacteria 1536
435 Ga0496102_0861838 3300048905 Unclassified 828
436 Ga0496103_0004894 3300048906 Bacteria 8084
437 Ga0496104_0009047 3300048907 Bacteria 8855
438 Ga0496104_0061252 3300048907 Bacteria 3567
439 Ga0496104_0262077 3300048907 Bacteria 1641
440 Ga0496105_0079524 3300048908 Bacteria 2707
441 Ga0496105_0171309 3300048908 Bacteria 1779
442 Ga0496106_0262711 3300048909 Unclassified 1381
443 Ga0496107_0117330 3300048910 Bacteria 1960
444 Ga0496107_0385928 3300048910 Bacteria 1042
445 Ga0496108_0019232 3300048911 Bacteria 5606
446 Ga0496108_0079315 3300048911 Bacteria 2779
447 Ga0496108_0097111 3300048911 Bacteria 2510
448 Ga0496109_0017002 3300048912 Bacteria 6367
449 Ga0496109_0018489 3300048912 Bacteria 6122
450 Ga0496109_0054234 3300048912 Bacteria 3657
451 Ga0496109_0108621 3300048912 Bacteria 2578
452 Ga0496109_0654758 3300048912 Unclassified 987
453 Ga0496110_0083658 3300048913 Bacteria 2847
454 Ga0496110_0256613 3300048913 Bacteria 1591
455 Ga0496110_0670808 3300048913 Bacteria 937
456 Ga0496111_0095920 3300048914 Bacteria 2176
457 Ga0496111_0171823 3300048914 Bacteria 1610
458 Ga0496112_0079131 3300048915 Bacteria 3251
459 Ga0496112_0101512 3300048915 Bacteria 2846
460 Ga0496113_0062223 3300048916 Bacteria 2818
461 Ga0496113_0065947 3300048916 Bacteria 2741
462 Ga0496113_0135385 3300048916 Bacteria 1935
463 Ga0496114_0131403 3300048917 Bacteria 2162
464 Ga0496114_0147108 3300048917 Bacteria 2043
465 Ga0501031_0009488 3300049568 Bacteria 6331
466 Ga0501031_0020611 3300049568 Bacteria 4299
467 Ga0501031_0071707 3300049568 Bacteria 2256
468 Ga0501031_0158439 3300049568 Bacteria 1480
469 Ga0501031_0189547 3300049568 Bacteria 1343
470 Ga0501031_0358283 3300049568 Bacteria 944
471 Ga0501032_0252912 3300049569 Bacteria 1143
472 Ga0501033_0051727 3300049570 Bacteria 3045
473 Ga0501036_0005132 3300049572 Bacteria 10581
474 Ga0501036_0446681 3300049572 Bacteria 1077
475 Ga0501036_1267078 3300049572 Bacteria 600
476 Ga0501037_0028128 3300049573 Bacteria 4153
477 Ga0501037_0078142 3300049573 Bacteria 2401
478 Ga0501037_0479361 3300049573 Bacteria 846
479 Ga0501038_0004000 3300049574 Bacteria 13689
480 Ga0501038_0014155 3300049574 Bacteria 7268
481 Ga0501038_0137375 3300049574 Bacteria 2002
482 Ga0501039_0005881 3300049575 Bacteria 9292
483 Ga0501039_0058790 3300049575 Bacteria 2978
484 Ga0501039_0328519 3300049575 Bacteria 1202
485 Ga0501039_0748485 3300049575 Unclassified 763
486 Ga0501040_0010408 3300049576 Bacteria 6081
487 Ga0501040_0046352 3300049576 Bacteria 2967
488 Ga0501040_0053961 3300049576 Bacteria 2755
489 Ga0501040_0164984 3300049576 Bacteria 1567
490 Ga0501040_0318087 3300049576 Bacteria 1113
491 Ga0501041_0009393 3300049577 Bacteria 5766
492 Ga0501041_0019958 3300049577 Bacteria 4005
493 Ga0501041_0028013 3300049577 Bacteria 3397
494 Ga0501042_0051113 3300049578 Bacteria 2948
495 Ga0501042_0368749 3300049578 Bacteria 1039
496 Ga0501042_0394475 3300049578 Unclassified 1002
497 Ga0501042_0433863 3300049578 Bacteria 952
498 Ga0501042_0698495 3300049578 Bacteria 738
499 Ga0501043_0013383 3300049579 Bacteria 6416
500 Ga0501043_0145598 3300049579 Bacteria 1855
501 Ga0501046_0017688 3300049580 Bacteria 5945
502 Ga0501046_0033725 3300049580 Bacteria 4134
503 Ga0501048_0006114 3300049582 Bacteria 9174
504 Ga0501048_0049081 3300049582 Bacteria 3009
505 Ga0501048_0066054 3300049582 Bacteria 2557
506 Ga0501048_0573936 3300049582 Bacteria 809
507 Ga0501048_0686628 3300049582 Bacteria 735
508 Ga0501067_0022093 3300049583 Bacteria 3521
509 Ga0501067_0036428 3300049583 Bacteria 2731
510 Ga0501067_0166275 3300049583 Bacteria 1228
511 Ga0501068_0163099 3300049584 Unclassified 1405
512 Ga0501068_0420009 3300049584 Unclassified 864
513 Ga0501069_0003512 3300049585 Bacteria 8073
514 Ga0501069_0083564 3300049585 Bacteria 1800
515 Ga0501069_0105549 3300049585 Bacteria 1601
516 Ga0501069_0182675 3300049585 Bacteria 1212
517 Ga0501069_0353108 3300049585 Unclassified 867
518 Ga0501069_0360162 3300049585 Bacteria 858
519 Ga0501069_0377606 3300049585 Bacteria 837
520 Ga0501070_0035779 3300049586 Bacteria 4147
521 Ga0501070_0120340 3300049586 Bacteria 2170
522 Ga0501070_0559303 3300049586 Bacteria 915
523 Ga0501071_0000870 3300049587 Bacteria 16286
524 Ga0501071_0025657 3300049587 Bacteria 4130
525 Ga0501071_0062316 3300049587 Bacteria 2702
526 Ga0501071_0135318 3300049587 Bacteria 1833
527 Ga0501071_0350393 3300049587 Bacteria 1124
528 Ga0501071_0711925 3300049587 Bacteria 773
529 Ga0501072_0001387 3300049588 Bacteria 18223
530 Ga0501072_0043147 3300049588 Bacteria 3544
531 Ga0501072_0078047 3300049588 Bacteria 2622
532 Ga0501072_0104654 3300049588 Bacteria 2250
533 Ga0501072_0222517 3300049588 Bacteria 1504
534 Ga0501072_0335590 3300049588 Unclassified 1201
535 Ga0501073_0105467 3300049589 Bacteria 1956
536 Ga0501073_0315394 3300049589 Unclassified 1079
537 Ga0501074_0001365 3300049590 Bacteria 16201
538 Ga0501074_0023832 3300049590 Bacteria 4449
539 Ga0501074_0067445 3300049590 Bacteria 2573
540 Ga0501074_0079410 3300049590 Bacteria 2354
541 Ga0501075_0008045 3300049591 Bacteria 7331
542 Ga0501075_0113293 3300049591 Bacteria 2062
543 Ga0501075_0221071 3300049591 Bacteria 1445
544 Ga0501075_0242029 3300049591 Bacteria 1375
545 Ga0501075_0262735 3300049591 Unclassified 1316
546 Ga0501075_0508110 3300049591 Bacteria 919
547 Ga0501075_0521804 3300049591 Unclassified 906
548 Ga0501075_0522856 3300049591 Bacteria 905
549 Ga0501076_0002459 3300049592 Bacteria 12727
550 Ga0501076_0059326 3300049592 Bacteria 3043
551 Ga0501076_0145387 3300049592 Unclassified 1928
552 Ga0501076_0157175 3300049592 Bacteria 1851
553 Ga0501076_0172073 3300049592 Bacteria 1765
554 Ga0501076_0335519 3300049592 Bacteria 1240
555 Ga0501077_0003242 3300049593 Bacteria 9801
556 Ga0501077_0014521 3300049593 Bacteria 4949
557 Ga0501077_0060899 3300049593 Bacteria 2395
558 Ga0501077_0224965 3300049593 Unclassified 1193
559 Ga0501209_162656 3300049656 Bacteria 676
560 Ga0501079_0009995 3300049741 Bacteria 7202
561 Ga0501079_0053262 3300049741 Bacteria 3121
562 Ga0501079_0058234 3300049741 Bacteria 2981
563 Ga0501079_0094329 3300049741 Bacteria 2319
564 Ga0501079_0245805 3300049741 Bacteria 1398
565 Ga0501080_0032123 3300049742 Bacteria 4894
566 Ga0501080_0124560 3300049742 Bacteria 2387
567 Ga0501080_0196191 3300049742 Bacteria 1854
568 Ga0501081_0005294 3300049743 Bacteria 8318
569 Ga0501081_0220729 3300049743 Bacteria 1378
570 Ga0501081_0259953 3300049743 Bacteria 1268
571 Ga0501081_0449271 3300049743 Bacteria 957
572 Ga0501081_0586219 3300049743 Unclassified 834
573 Ga0501083_0048629 3300049744 Unclassified 2862
574 Ga0501083_0087933 3300049744 Bacteria 2054
575 Ga0501035_0073771 3300049822 Bacteria 3019
576 Ga0501035_0235754 3300049822 Unclassified 1558
577 Ga0501044_0130530 3300049823 Bacteria 2507
578 Ga0501044_0590933 3300049823 Bacteria 1004
579 Ga0501045_0002473 3300049824 Bacteria 12565
580 Ga0501045_0011588 3300049824 Bacteria 6192
581 Ga0501045_0033475 3300049824 Bacteria 3726
582 Ga0501045_0194558 3300049824 Bacteria 1511
583 Ga0501045_0263745 3300049824 Bacteria 1282
584 nmdc:mga0yw44_12985_c1 3300050492 Unclassified 4366
585 nmdc:mga0yw44_675702_c1 3300050492 Unclassified 702
586 nmdc:mga0k408_4293_c1 3300050493 Archaea 7569
587 nmdc:mga05p37_20144_c1 3300050507 Bacteria 8073
588 nmdc:mga05p37_239537_c1 3300050507 Bacteria 2182
589 nmdc:mga05p37_449025_c1 3300050507 Unclassified 1493
590 nmdc:mga05p37_562877_c1 3300050507 Unclassified 1295
591 nmdc:mga05p37_578899_c1 3300050507 Bacteria 1272
592 nmdc:mga09592_1201878_c1 3300050508 Unclassified 626
593 nmdc:mga06r32_1343550_c1 3300050510 Bacteria 658
594 nmdc:mga06r32_912777_c1 3300050510 Bacteria 834
595 nmdc:mga08y16_1482508_c1 3300050511 Unclassified 639
596 nmdc:mga08y16_158637_c1 3300050511 Bacteria 2351
597 nmdc:mga08y16_40112_c1 3300050511 Bacteria 4909
598 nmdc:mga08y16_467134_c1 3300050511 Unclassified 1285
599 nmdc:mga08y16_95719_c1 3300050511 Bacteria 3093
600 nmdc:mga08x19_334086_c1 3300050514 Bacteria 1056
601 nmdc:mga0a205_418650_c1 3300050515 Unclassified 1202
602 nmdc:mga0a205_49481_c1 3300050515 Bacteria 4057
603 Ga0495601_0157190 3300053077 Bacteria 1485
604 Ga0495601_0243545 3300053077 Bacteria 1174
605 Ga0495601_0324679 3300053077 Bacteria 1002
606 Ga0495612_0047168 3300053078 Unclassified 1765
607 Ga0495619_0059363 3300053085 Bacteria 2541
608 Ga0495619_0274633 3300053085 Bacteria 1168
609 Ga0501084_0002117 3300054114 Bacteria 15865
610 Ga0501084_0089499 3300054114 Bacteria 2584
611 Ga0501084_0242430 3300054114 Bacteria 1521
612 Ga0590071_003513 3300059421 Bacteria 3847
613 Ga0501082_0004281 3300060353 Bacteria 12483
614 Ga0501082_0152458 3300060353 Bacteria 2008
615 Ga0501082_0194535 3300060353 Bacteria 1764
616 Ga0501082_0207997 3300060353 Bacteria 1702
617 Ga0501082_0218876 3300060353 Bacteria 1657
618 Ga0501082_0642884 3300060353 Bacteria 928
619 Ga0501082_0824320 3300060353 Unclassified 812
620 Ga0501082_0894375 3300060353 Unclassified 777
621 Ga0530510_0005043 3300061734 Bacteria 9111
622 Ga0530510_0010637 3300061734 Bacteria 6452
623 Ga0530510_0015303 3300061734 Bacteria 5420
624 Ga0530510_0016613 3300061734 Bacteria 5211
625 Ga0530510_0044381 3300061734 Bacteria 3212
626 Ga0530510_0134757 3300061734 Bacteria 1818

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005444 Ga0070694_101191638 Ga0070694_1011916381 159
2 3300005545 Ga0070695_100554025 Ga0070695_1005540252 159
3 3300028563 Ga0265319_1113762 Ga0265319_11137621 159
4 3300005616 Ga0068852_100030876 Ga0068852_1000308762 161
5 3300038443 Ga0395901_0024236 Ga0395901_0024236_4385_4879 161
6 3300045976 Ga0466967_1367096 Ga0466967_1367096_17_508 161
7 3300005366 Ga0070659_100538060 Ga0070659_1005380602 162
8 3300005539 Ga0068853_101503875 Ga0068853_1015038751 162
9 3300006038 Ga0075365_10002896 Ga0075365_100028966 162
10 3300006051 Ga0075364_10003417 Ga0075364_100034172 162
11 3300009011 Ga0105251_10230282 Ga0105251_102302821 162
12 3300036401 Ga0373937_1150248 Ga0373937_1150248_57_548 162
13 3300049568 Ga0501031_0009488 Ga0501031_0009488_1813_2301 162
14 3300049572 Ga0501036_0005132 Ga0501036_0005132_5160_5648 162
15 3300049573 Ga0501037_0028128 Ga0501037_0028128_1445_1933 162
16 3300049574 Ga0501038_0004000 Ga0501038_0004000_3923_4411 162
17 3300049575 Ga0501039_0005881 Ga0501039_0005881_5139_5627 162
18 3300049576 Ga0501040_0010408 Ga0501040_0010408_2444_2932 162
19 3300049577 Ga0501041_0009393 Ga0501041_0009393_5001_5489 162
20 3300049578 Ga0501042_0394475 Ga0501042_0394475_465_953 162
21 3300049579 Ga0501043_0013383 Ga0501043_0013383_3740_4228 162
22 3300049580 Ga0501046_0017688 Ga0501046_0017688_2156_2644 162
23 3300049582 Ga0501048_0006114 Ga0501048_0006114_5409_5897 162
24 3300049584 Ga0501068_0420009 Ga0501068_0420009_64_552 162
25 3300049585 Ga0501069_0083564 Ga0501069_0083564_142_630 162
26 3300049587 Ga0501071_0000870 Ga0501071_0000870_2358_2846 162
27 3300049588 Ga0501072_0001387 Ga0501072_0001387_6820_7308 162
28 3300049589 Ga0501073_0105467 Ga0501073_0105467_1094_1582 162
29 3300049590 Ga0501074_0001365 Ga0501074_0001365_8085_8573 162
30 3300049591 Ga0501075_0008045 Ga0501075_0008045_143_631 162
31 3300049592 Ga0501076_0002459 Ga0501076_0002459_5172_5660 162
32 3300049593 Ga0501077_0003242 Ga0501077_0003242_4646_5134 162
33 3300049741 Ga0501079_0009995 Ga0501079_0009995_1882_2370 162
34 3300049742 Ga0501080_0124560 Ga0501080_0124560_176_664 162
35 3300049743 Ga0501081_0005294 Ga0501081_0005294_272_760 162
36 3300049744 Ga0501083_0048629 Ga0501083_0048629_558_1046 162
37 3300049822 Ga0501035_0235754 Ga0501035_0235754_601_1089 162
38 3300049824 Ga0501045_0002473 Ga0501045_0002473_7833_8321 162
39 3300050492 nmdc:mga0yw44_12985_c1 nmdc:mga0yw44_12985_c1_2537_3034 162
40 3300050493 nmdc:mga0k408_4293_c1 nmdc:mga0k408_4293_c1_389_886 162
41 3300054114 Ga0501084_0002117 Ga0501084_0002117_7873_8361 162
42 3300060353 Ga0501082_0004281 Ga0501082_0004281_4921_5409 162
43 3300061734 Ga0530510_0010637 Ga0530510_0010637_5824_6312 162
44 3300001991 JGI24743J22301_10046962 JGI24743J22301_100469622 163
45 3300002076 JGI24749J21850_1020202 JGI24749J21850_10202022 163
46 3300005293 Ga0065715_10509233 Ga0065715_105092331 163
47 3300005295 Ga0065707_10375342 Ga0065707_103753421 163
48 3300005327 Ga0070658_10241879 Ga0070658_102418792 163
49 3300005328 Ga0070676_10111411 Ga0070676_101114112 163
50 3300005328 Ga0070676_10685557 Ga0070676_106855571 163
51 3300005329 Ga0070683_100156938 Ga0070683_1001569383 163
52 3300005329 Ga0070683_100863814 Ga0070683_1008638141 163
53 3300005329 Ga0070683_100901499 Ga0070683_1009014992 163
54 3300005330 Ga0070690_100014092 Ga0070690_1000140924 163
55 3300005331 Ga0070670_100089777 Ga0070670_1000897772 163
56 3300005331 Ga0070670_100311092 Ga0070670_1003110922 163
57 3300005334 Ga0068869_100030300 Ga0068869_1000303005 163
58 3300005334 Ga0068869_100576464 Ga0068869_1005764642 163
59 3300005335 Ga0070666_10394560 Ga0070666_103945602 163
60 3300005336 Ga0070680_100436709 Ga0070680_1004367092 163
61 3300005337 Ga0070682_100161518 Ga0070682_1001615182 163
62 3300005337 Ga0070682_100939009 Ga0070682_1009390091 163
63 3300005338 Ga0068868_100491901 Ga0068868_1004919012 163
64 3300005338 Ga0068868_100548167 Ga0068868_1005481672 163
65 3300005339 Ga0070660_100066802 Ga0070660_1000668021 163
66 3300005339 Ga0070660_100325088 Ga0070660_1003250882 163
67 3300005340 Ga0070689_100003459 Ga0070689_1000034597 163
68 3300005341 Ga0070691_10003464 Ga0070691_100034644 163
69 3300005343 Ga0070687_100000829 Ga0070687_1000008293 163
70 3300005343 Ga0070687_100460365 Ga0070687_1004603651 163
71 3300005344 Ga0070661_100600595 Ga0070661_1006005952 163
72 3300005345 Ga0070692_10327643 Ga0070692_103276432 163
73 3300005345 Ga0070692_10383334 Ga0070692_103833341 163
74 3300005347 Ga0070668_100074006 Ga0070668_1000740062 163
75 3300005347 Ga0070668_100338209 Ga0070668_1003382092 163
76 3300005353 Ga0070669_100129992 Ga0070669_1001299922 163
77 3300005353 Ga0070669_100817082 Ga0070669_1008170821 163
78 3300005354 Ga0070675_100148623 Ga0070675_1001486233 163
79 3300005355 Ga0070671_100343230 Ga0070671_1003432302 163
80 3300005355 Ga0070671_100572225 Ga0070671_1005722252 163
81 3300005356 Ga0070674_100006333 Ga0070674_1000063335 163
82 3300005364 Ga0070673_100002033 Ga0070673_1000020335 163
83 3300005365 Ga0070688_100002572 Ga0070688_1000025726 163
84 3300005365 Ga0070688_100597440 Ga0070688_1005974401 163
85 3300005366 Ga0070659_100008430 Ga0070659_1000084306 163
86 3300005366 Ga0070659_100395402 Ga0070659_1003954022 163
87 3300005366 Ga0070659_100504916 Ga0070659_1005049162 163
88 3300005406 Ga0070703_10009342 Ga0070703_100093422 163
89 3300005438 Ga0070701_10040831 Ga0070701_100408313 163
90 3300005440 Ga0070705_100010402 Ga0070705_1000104025 163
91 3300005440 Ga0070705_100012300 Ga0070705_1000123002 163
92 3300005440 Ga0070705_100016836 Ga0070705_1000168362 163
93 3300005440 Ga0070705_100119196 Ga0070705_1001191963 163
94 3300005441 Ga0070700_100071854 Ga0070700_1000718543 163
95 3300005441 Ga0070700_100129481 Ga0070700_1001294812 163
96 3300005441 Ga0070700_100488357 Ga0070700_1004883572 163
97 3300005444 Ga0070694_100006418 Ga0070694_1000064185 163
98 3300005444 Ga0070694_100068632 Ga0070694_1000686322 163
99 3300005444 Ga0070694_100124864 Ga0070694_1001248642 163
100 3300005444 Ga0070694_100166317 Ga0070694_1001663172 163
101 3300005444 Ga0070694_100325647 Ga0070694_1003256471 163
102 3300005444 Ga0070694_100452547 Ga0070694_1004525472 163
103 3300005445 Ga0070708_100002789 Ga0070708_1000027899 163
104 3300005445 Ga0070708_100051497 Ga0070708_1000514972 163
105 3300005455 Ga0070663_100042986 Ga0070663_1000429863 163
106 3300005455 Ga0070663_100817833 Ga0070663_1008178331 163
107 3300005456 Ga0070678_100306182 Ga0070678_1003061822 163
108 3300005456 Ga0070678_101091679 Ga0070678_1010916792 163
109 3300005457 Ga0070662_100231572 Ga0070662_1002315723 163
110 3300005458 Ga0070681_10348031 Ga0070681_103480312 163
111 3300005458 Ga0070681_10454317 Ga0070681_104543171 163
112 3300005458 Ga0070681_10512080 Ga0070681_105120801 163
113 3300005458 Ga0070681_10651383 Ga0070681_106513831 163
114 3300005458 Ga0070681_10833048 Ga0070681_108330482 163
115 3300005459 Ga0068867_100018046 Ga0068867_1000180465 163
116 3300005466 Ga0070685_10011431 Ga0070685_100114313 163
117 3300005467 Ga0070706_100000374 Ga0070706_10000037422 163
118 3300005467 Ga0070706_100000528 Ga0070706_10000052844 163
119 3300005467 Ga0070706_100149509 Ga0070706_1001495092 163
120 3300005468 Ga0070707_100004216 Ga0070707_10000421610 163
121 3300005468 Ga0070707_100096671 Ga0070707_1000966712 163
122 3300005471 Ga0070698_100316825 Ga0070698_1003168252 163
123 3300005471 Ga0070698_100646393 Ga0070698_1006463931 163
124 3300005518 Ga0070699_100014846 Ga0070699_1000148461 163
125 3300005518 Ga0070699_100046650 Ga0070699_1000466501 163
126 3300005518 Ga0070699_100436108 Ga0070699_1004361083 163
127 3300005518 Ga0070699_100462510 Ga0070699_1004625101 163
128 3300005518 Ga0070699_100674512 Ga0070699_1006745121 163
129 3300005518 Ga0070699_101291291 Ga0070699_1012912911 163
130 3300005530 Ga0070679_100028396 Ga0070679_1000283962 163
131 3300005530 Ga0070679_100561141 Ga0070679_1005611411 163
132 3300005530 Ga0070679_100570255 Ga0070679_1005702552 163
133 3300005530 Ga0070679_101323782 Ga0070679_1013237821 163
134 3300005535 Ga0070684_100278410 Ga0070684_1002784102 163
135 3300005535 Ga0070684_100463968 Ga0070684_1004639682 163
136 3300005536 Ga0070697_100005120 Ga0070697_1000051209 163
137 3300005536 Ga0070697_100020214 Ga0070697_1000202144 163
138 3300005536 Ga0070697_100062839 Ga0070697_1000628394 163
139 3300005536 Ga0070697_100218326 Ga0070697_1002183262 163
140 3300005536 Ga0070697_100399139 Ga0070697_1003991392 163
141 3300005539 Ga0068853_100140477 Ga0068853_1001404772 163
142 3300005539 Ga0068853_101231188 Ga0068853_1012311881 163
143 3300005539 Ga0068853_101360863 Ga0068853_1013608631 163
144 3300005545 Ga0070695_100016070 Ga0070695_1000160703 163
145 3300005545 Ga0070695_100044621 Ga0070695_1000446213 163
146 3300005545 Ga0070695_100176304 Ga0070695_1001763042 163
147 3300005545 Ga0070695_100236169 Ga0070695_1002361692 163
148 3300005546 Ga0070696_100076132 Ga0070696_1000761322 163
149 3300005546 Ga0070696_100132572 Ga0070696_1001325722 163
150 3300005547 Ga0070693_100249941 Ga0070693_1002499412 163
151 3300005548 Ga0070665_100639374 Ga0070665_1006393742 163
152 3300005549 Ga0070704_100007204 Ga0070704_1000072042 163
153 3300005549 Ga0070704_100087709 Ga0070704_1000877092 163
154 3300005549 Ga0070704_100115718 Ga0070704_1001157182 163
155 3300005549 Ga0070704_100335892 Ga0070704_1003358922 163
156 3300005549 Ga0070704_100587702 Ga0070704_1005877022 163
157 3300005563 Ga0068855_100104951 Ga0068855_1001049511 163
158 3300005577 Ga0068857_100024638 Ga0068857_1000246385 163
159 3300005615 Ga0070702_100000984 Ga0070702_1000009842 163
160 3300005616 Ga0068852_100021181 Ga0068852_1000211815 163
161 3300005617 Ga0068859_100085464 Ga0068859_1000854643 163
162 3300005617 Ga0068859_100637390 Ga0068859_1006373902 163
163 3300005617 Ga0068859_100982247 Ga0068859_1009822472 163
164 3300005618 Ga0068864_100033660 Ga0068864_1000336603 163
165 3300005618 Ga0068864_101152616 Ga0068864_1011526162 163
166 3300005718 Ga0068866_10038039 Ga0068866_100380392 163
167 3300005719 Ga0068861_100583356 Ga0068861_1005833563 163
168 3300005842 Ga0068858_100058133 Ga0068858_1000581333 163
169 3300005843 Ga0068860_100183995 Ga0068860_1001839952 163
170 3300005843 Ga0068860_100440293 Ga0068860_1004402932 163
171 3300005844 Ga0068862_100046135 Ga0068862_1000461354 163
172 3300005844 Ga0068862_100291867 Ga0068862_1002918673 163
173 3300005985 Ga0081539_10010782 Ga0081539_100107823 163
174 3300006058 Ga0075432_10131836 Ga0075432_101318362 163
175 3300006173 Ga0070716_100487190 Ga0070716_1004871902 163
176 3300006173 Ga0070716_100526722 Ga0070716_1005267222 163
177 3300006173 Ga0070716_100654739 Ga0070716_1006547392 163
178 3300006237 Ga0097621_100216434 Ga0097621_1002164341 163
179 3300006237 Ga0097621_100975018 Ga0097621_1009750183 163
180 3300006844 Ga0075428_100769637 Ga0075428_1007696373 163
181 3300006847 Ga0075431_100214169 Ga0075431_1002141692 163
182 3300006847 Ga0075431_100229100 Ga0075431_1002291001 163
183 3300006847 Ga0075431_100947492 Ga0075431_1009474922 163
184 3300006852 Ga0075433_10129634 Ga0075433_101296343 163
185 3300006852 Ga0075433_10275738 Ga0075433_102757383 163
186 3300006852 Ga0075433_10325324 Ga0075433_103253242 163
187 3300006871 Ga0075434_100814863 Ga0075434_1008148632 163
188 3300006880 Ga0075429_100963741 Ga0075429_1009637412 163
189 3300006881 Ga0068865_100012709 Ga0068865_1000127092 163
190 3300006914 Ga0075436_100369594 Ga0075436_1003695942 163
191 3300006931 Ga0097620_100085471 Ga0097620_1000854713 163
192 3300006931 Ga0097620_100637388 Ga0097620_1006373882 163
193 3300006931 Ga0097620_100981930 Ga0097620_1009819302 163
194 3300006931 Ga0097620_101474530 Ga0097620_1014745301 163
195 3300007076 Ga0075435_100560275 Ga0075435_1005602751 163
196 3300009093 Ga0105240_10392956 Ga0105240_103929563 163
197 3300009094 Ga0111539_10000282 Ga0111539_1000028245 163
198 3300009094 Ga0111539_10008872 Ga0111539_100088724 163
199 3300009094 Ga0111539_10112699 Ga0111539_101126993 163
200 3300009094 Ga0111539_10147186 Ga0111539_101471864 163
201 3300009094 Ga0111539_10720575 Ga0111539_107205751 163
202 3300009094 Ga0111539_11892564 Ga0111539_118925641 163
203 3300009098 Ga0105245_10013989 Ga0105245_100139892 163
204 3300009098 Ga0105245_10136678 Ga0105245_101366782 163
205 3300009098 Ga0105245_10315057 Ga0105245_103150572 163
206 3300009098 Ga0105245_10424725 Ga0105245_104247251 163
207 3300009147 Ga0114129_10090097 Ga0114129_100900973 163
208 3300009147 Ga0114129_10096844 Ga0114129_100968442 163
209 3300009147 Ga0114129_10131066 Ga0114129_101310662 163
210 3300009147 Ga0114129_10184981 Ga0114129_101849814 163
211 3300009147 Ga0114129_10583749 Ga0114129_105837493 163
212 3300009147 Ga0114129_10947684 Ga0114129_109476842 163
213 3300009148 Ga0105243_10133193 Ga0105243_101331933 163
214 3300009148 Ga0105243_10163660 Ga0105243_101636603 163
215 3300009148 Ga0105243_10433996 Ga0105243_104339962 163
216 3300009174 Ga0105241_10252514 Ga0105241_102525142 163
217 3300009174 Ga0105241_11324039 Ga0105241_113240391 163
218 3300009176 Ga0105242_10440333 Ga0105242_104403333 163
219 3300009177 Ga0105248_10382383 Ga0105248_103823833 163
220 3300009177 Ga0105248_10921216 Ga0105248_109212162 163
221 3300009545 Ga0105237_10144150 Ga0105237_101441503 163
222 3300009545 Ga0105237_11395431 Ga0105237_113954312 163
223 3300009551 Ga0105238_10093437 Ga0105238_100934373 163
224 3300009553 Ga0105249_10004683 Ga0105249_100046838 163
225 3300009553 Ga0105249_10210713 Ga0105249_102107132 163
226 3300009553 Ga0105249_10222811 Ga0105249_102228112 163
227 3300009553 Ga0105249_10401397 Ga0105249_104013972 163
228 3300009553 Ga0105249_11257653 Ga0105249_112576532 163
229 3300009553 Ga0105249_11363206 Ga0105249_113632062 163
230 3300010375 Ga0105239_10038180 Ga0105239_100381805 163
231 3300010375 Ga0105239_10429901 Ga0105239_104299013 163
232 3300011119 Ga0105246_10306592 Ga0105246_103065922 163
233 3300011119 Ga0105246_10313786 Ga0105246_103137863 163
234 3300011119 Ga0105246_10407201 Ga0105246_104072013 163
235 3300011119 Ga0105246_11033385 Ga0105246_110333851 163
236 3300013100 Ga0157373_10505813 Ga0157373_105058131 163
237 3300013296 Ga0157374_10630779 Ga0157374_106307792 163
238 3300013297 Ga0157378_10069343 Ga0157378_100693432 163
239 3300013297 Ga0157378_10461061 Ga0157378_104610612 163
240 3300013297 Ga0157378_10625912 Ga0157378_106259122 163
241 3300013306 Ga0163162_10355703 Ga0163162_103557033 163
242 3300013308 Ga0157375_10317204 Ga0157375_103172042 163
243 3300013308 Ga0157375_10689966 Ga0157375_106899662 163
244 3300013308 Ga0157375_12022470 Ga0157375_120224701 163
245 3300014325 Ga0163163_10049588 Ga0163163_100495883 163
246 3300014325 Ga0163163_10218725 Ga0163163_102187253 163
247 3300014325 Ga0163163_10228807 Ga0163163_102288072 163
248 3300014326 Ga0157380_10016559 Ga0157380_100165595 163
249 3300014326 Ga0157380_10380583 Ga0157380_103805832 163
250 3300014745 Ga0157377_10001089 Ga0157377_100010893 163
251 3300014745 Ga0157377_10060360 Ga0157377_100603602 163
252 3300014745 Ga0157377_10240500 Ga0157377_102405001 163
253 3300014968 Ga0157379_10190614 Ga0157379_101906143 163
254 3300014968 Ga0157379_10289179 Ga0157379_102891792 163
255 3300014968 Ga0157379_10373201 Ga0157379_103732013 163
256 3300014969 Ga0157376_10721007 Ga0157376_107210073 163
257 3300014969 Ga0157376_10782660 Ga0157376_107826601 163
258 3300017792 Ga0163161_10109057 Ga0163161_101090573 163
259 3300017792 Ga0163161_10680954 Ga0163161_106809543 163
260 3300017792 Ga0163161_10681861 Ga0163161_106818613 163
261 3300017792 Ga0163161_10775744 Ga0163161_107757441 163
262 3300020070 Ga0206356_11066570 Ga0206356_110665701 163
263 3300020077 Ga0206351_10832329 Ga0206351_108323292 163
264 3300020081 Ga0206354_10664940 Ga0206354_106649402 163
265 3300022467 Ga0224712_10002139 Ga0224712_100021392 163
266 3300025321 Ga0207656_10205789 Ga0207656_102057892 163
267 3300025899 Ga0207642_10286676 Ga0207642_102866761 163
268 3300025901 Ga0207688_10000452 Ga0207688_100004527 163
269 3300025903 Ga0207680_10594878 Ga0207680_105948783 163
270 3300025907 Ga0207645_10061144 Ga0207645_100611442 163
271 3300025907 Ga0207645_10543641 Ga0207645_105436412 163
272 3300025908 Ga0207643_10427345 Ga0207643_104273453 163
273 3300025908 Ga0207643_10494022 Ga0207643_104940222 163
274 3300025909 Ga0207705_10668966 Ga0207705_106689661 163
275 3300025910 Ga0207684_10000636 Ga0207684_1000063610 163
276 3300025910 Ga0207684_10008151 Ga0207684_100081515 163
277 3300025910 Ga0207684_10009155 Ga0207684_100091558 163
278 3300025910 Ga0207684_10041677 Ga0207684_100416773 163
279 3300025910 Ga0207684_11154786 Ga0207684_111547861 163
280 3300025911 Ga0207654_10132183 Ga0207654_101321832 163
281 3300025912 Ga0207707_10105470 Ga0207707_101054702 163
282 3300025912 Ga0207707_10284397 Ga0207707_102843972 163
283 3300025912 Ga0207707_10716608 Ga0207707_107166082 163
284 3300025912 Ga0207707_10910477 Ga0207707_109104771 163
285 3300025913 Ga0207695_11120202 Ga0207695_111202021 163
286 3300025914 Ga0207671_10283364 Ga0207671_102833643 163
287 3300025916 Ga0207663_10871990 Ga0207663_108719901 163
288 3300025917 Ga0207660_10028234 Ga0207660_100282342 163
289 3300025917 Ga0207660_11214964 Ga0207660_112149641 163
290 3300025918 Ga0207662_10001307 Ga0207662_1000130710 163
291 3300025919 Ga0207657_10015330 Ga0207657_100153305 163
292 3300025919 Ga0207657_10213656 Ga0207657_102136562 163
293 3300025921 Ga0207652_10025593 Ga0207652_100255932 163
294 3300025922 Ga0207646_10005701 Ga0207646_100057015 163
295 3300025922 Ga0207646_10005912 Ga0207646_100059123 163
296 3300025923 Ga0207681_10056929 Ga0207681_100569292 163
297 3300025923 Ga0207681_10756828 Ga0207681_107568282 163
298 3300025924 Ga0207694_10157765 Ga0207694_101577652 163
299 3300025926 Ga0207659_10048570 Ga0207659_100485703 163
300 3300025927 Ga0207687_10022727 Ga0207687_100227272 163
301 3300025927 Ga0207687_10058726 Ga0207687_100587263 163
302 3300025927 Ga0207687_10162136 Ga0207687_101621363 163
303 3300025932 Ga0207690_10060829 Ga0207690_100608293 163
304 3300025932 Ga0207690_10110902 Ga0207690_101109022 163
305 3300025933 Ga0207706_10057655 Ga0207706_100576555 163
306 3300025933 Ga0207706_10070012 Ga0207706_100700123 163
307 3300025934 Ga0207686_10026237 Ga0207686_100262372 163
308 3300025935 Ga0207709_10400062 Ga0207709_104000621 163
309 3300025935 Ga0207709_10522548 Ga0207709_105225483 163
310 3300025935 Ga0207709_10662281 Ga0207709_106622811 163
311 3300025936 Ga0207670_10085430 Ga0207670_100854302 163
312 3300025937 Ga0207669_10037965 Ga0207669_100379652 163
313 3300025937 Ga0207669_10776750 Ga0207669_107767502 163
314 3300025938 Ga0207704_10197482 Ga0207704_101974823 163
315 3300025938 Ga0207704_10253151 Ga0207704_102531511 163
316 3300025939 Ga0207665_10217740 Ga0207665_102177402 163
317 3300025939 Ga0207665_10373067 Ga0207665_103730672 163
318 3300025941 Ga0207711_10393305 Ga0207711_103933052 163
319 3300025942 Ga0207689_10016068 Ga0207689_100160685 163
320 3300025942 Ga0207689_10382258 Ga0207689_103822583 163
321 3300025944 Ga0207661_10148433 Ga0207661_101484332 163
322 3300025944 Ga0207661_10239512 Ga0207661_102395123 163
323 3300025944 Ga0207661_11378328 Ga0207661_113783281 163
324 3300025945 Ga0207679_10547160 Ga0207679_105471602 163
325 3300025949 Ga0207667_10176095 Ga0207667_101760953 163
326 3300025960 Ga0207651_10106109 Ga0207651_101061093 163
327 3300025961 Ga0207712_10012939 Ga0207712_100129393 163
328 3300025961 Ga0207712_10152875 Ga0207712_101528753 163
329 3300025961 Ga0207712_10797695 Ga0207712_107976951 163
330 3300025972 Ga0207668_10039446 Ga0207668_100394463 163
331 3300025981 Ga0207640_10100267 Ga0207640_101002672 163
332 3300026023 Ga0207677_10087556 Ga0207677_100875562 163
333 3300026023 Ga0207677_10420747 Ga0207677_104207472 163
334 3300026035 Ga0207703_10129485 Ga0207703_101294853 163
335 3300026067 Ga0207678_10036007 Ga0207678_100360074 163
336 3300026067 Ga0207678_11076708 Ga0207678_110767082 163
337 3300026067 Ga0207678_11125456 Ga0207678_111254561 163
338 3300026075 Ga0207708_10012012 Ga0207708_100120126 163
339 3300026075 Ga0207708_10016501 Ga0207708_100165013 163
340 3300026075 Ga0207708_10177616 Ga0207708_101776163 163
341 3300026088 Ga0207641_10556324 Ga0207641_105563241 163
342 3300026089 Ga0207648_10000662 Ga0207648_1000066230 163
343 3300026089 Ga0207648_10872967 Ga0207648_108729673 163
344 3300026095 Ga0207676_10161183 Ga0207676_101611832 163
345 3300026095 Ga0207676_11224014 Ga0207676_112240141 163
346 3300026116 Ga0207674_10015884 Ga0207674_100158842 163
347 3300026116 Ga0207674_10035517 Ga0207674_100355173 163
348 3300026118 Ga0207675_100012080 Ga0207675_1000120806 163
349 3300026118 Ga0207675_100016431 Ga0207675_1000164314 163
350 3300026118 Ga0207675_100365359 Ga0207675_1003653593 163
351 3300026121 Ga0207683_10165482 Ga0207683_101654823 163
352 3300026121 Ga0207683_10291027 Ga0207683_102910273 163
353 3300026121 Ga0207683_10674046 Ga0207683_106740462 163
354 3300026142 Ga0207698_10047334 Ga0207698_100473341 163
355 3300026142 Ga0207698_10650570 Ga0207698_106505702 163
356 3300027665 Ga0209983_1048599 Ga0209983_10485992 163
357 3300027665 Ga0209983_1072951 Ga0209983_10729512 163
358 3300027876 Ga0209974_10029984 Ga0209974_100299842 163
359 3300027907 Ga0207428_10031535 Ga0207428_100315355 163
360 3300027907 Ga0207428_10034264 Ga0207428_100342643 163
361 3300027907 Ga0207428_10642744 Ga0207428_106427441 163
362 3300027907 Ga0207428_10988301 Ga0207428_109883011 163
363 3300028379 Ga0268266_10149676 Ga0268266_101496762 163
364 3300028380 Ga0268265_10640666 Ga0268265_106406661 163
365 3300028380 Ga0268265_11313074 Ga0268265_113130742 163
366 3300028381 Ga0268264_10243981 Ga0268264_102439812 163
367 3300028381 Ga0268264_10494354 Ga0268264_104943541 163
368 3300028381 Ga0268264_11612935 Ga0268264_116129351 163
369 3300028558 Ga0265326_10051236 Ga0265326_100512362 163
370 3300028573 Ga0265334_10070824 Ga0265334_100708242 163
371 3300028577 Ga0265318_10163811 Ga0265318_101638111 163
372 3300028653 Ga0265323_10076808 Ga0265323_100768082 163
373 3300028666 Ga0265336_10072605 Ga0265336_100726051 163
374 3300028666 Ga0265336_10084863 Ga0265336_100848631 163
375 3300028800 Ga0265338_10015195 Ga0265338_100151956 163
376 3300028800 Ga0265338_10745884 Ga0265338_107458841 163
377 3300029957 Ga0265324_10029965 Ga0265324_100299652 163
378 3300031238 Ga0265332_10082229 Ga0265332_100822292 163
379 3300031240 Ga0265320_10004262 Ga0265320_100042625 163
380 3300031241 Ga0265325_10058238 Ga0265325_100582383 163
381 3300031242 Ga0265329_10012442 Ga0265329_100124423 163
382 3300031249 Ga0265339_10013978 Ga0265339_100139784 163
383 3300031250 Ga0265331_10045383 Ga0265331_100453833 163
384 3300031344 Ga0265316_10052421 Ga0265316_100524213 163
385 3300031344 Ga0265316_10099361 Ga0265316_100993611 163
386 3300031548 Ga0307408_100030415 Ga0307408_1000304153 163
387 3300031665 Ga0316575_10083809 Ga0316575_100838092 163
388 3300031711 Ga0265314_10112969 Ga0265314_101129693 163
389 3300031712 Ga0265342_10043506 Ga0265342_100435063 163
390 3300031824 Ga0307413_10134844 Ga0307413_101348443 163
391 3300031824 Ga0307413_10406102 Ga0307413_104061021 163
392 3300031824 Ga0307413_10769000 Ga0307413_107690003 163
393 3300031852 Ga0307410_10321943 Ga0307410_103219433 163
394 3300031901 Ga0307406_10406795 Ga0307406_104067953 163
395 3300031901 Ga0307406_10460933 Ga0307406_104609333 163
396 3300031911 Ga0307412_10354516 Ga0307412_103545162 163
397 3300031911 Ga0307412_10716355 Ga0307412_107163552 163
398 3300031911 Ga0307412_11121454 Ga0307412_111214541 163
399 3300031995 Ga0307409_100019934 Ga0307409_1000199346 163
400 3300031995 Ga0307409_100054802 Ga0307409_1000548023 163
401 3300031995 Ga0307409_100092330 Ga0307409_1000923302 163
402 3300032002 Ga0307416_100006460 Ga0307416_1000064607 163
403 3300032002 Ga0307416_100322590 Ga0307416_1003225903 163
404 3300032002 Ga0307416_100523239 Ga0307416_1005232392 163
405 3300032002 Ga0307416_101860919 Ga0307416_1018609192 163
406 3300032002 Ga0307416_102368506 Ga0307416_1023685061 163
407 3300032002 Ga0307416_103183564 Ga0307416_1031835641 163
408 3300032004 Ga0307414_10497364 Ga0307414_104973642 163
409 3300032005 Ga0307411_10234023 Ga0307411_102340233 163
410 3300032126 Ga0307415_100040624 Ga0307415_1000406242 163
411 3300032126 Ga0307415_100042533 Ga0307415_1000425333 163
412 3300032126 Ga0307415_101851041 Ga0307415_1018510411 163
413 3300032126 Ga0307415_102011585 Ga0307415_1020115851 163
414 3300032133 Ga0316583_10012329 Ga0316583_100123294 163
415 3300035083 Ga0373926_0282798 Ga0373926_0282798_38_532 163
416 3300035113 Ga0373936_0143158 Ga0373936_0143158_291_785 163
417 3300035114 Ga0373939_0010691 Ga0373939_0010691_668_1159 163
418 3300035115 Ga0373941_0066602 Ga0373941_0066602_80_571 163
419 3300035116 Ga0373945_0056063 Ga0373945_0056063_881_1375 163
420 3300035118 Ga0373954_0008438 Ga0373954_0008438_1599_2093 163
421 3300035171 Ga0373946_0350943 Ga0373946_0350943_116_610 163
422 3300035242 Ga0373962_0017216 Ga0373962_0017216_624_1115 163
423 3300035398 Ga0316574_0060258 Ga0316574_0060258_140_631 163
424 3300035398 Ga0316574_0150782 Ga0316574_0150782_609_1100 163
425 3300035410 Ga0373924_0242837 Ga0373924_0242837_101_595 163
426 3300035691 Ga0373931_0219822 Ga0373931_0219822_550_1041 163
427 3300035692 Ga0373935_1249176 Ga0373935_1249176_12_506 163
428 3300035695 Ga0373927_0000014 Ga0373927_0000014_59883_60377 163
429 3300036647 Ga0316582_0712445 Ga0316582_0712445_149_640 163
430 3300037068 Ga0373925_0521991 Ga0373925_0521991_91_585 163
431 3300041411 Ga0439466_0094162 Ga0439466_0094162_77_568 163
432 3300041460 Ga0451802_1162171 Ga0451802_1162171_12_503 163
433 3300041486 Ga0451807_0831768 Ga0451807_0831768_65_556 163
434 3300041496 Ga0451839_1096332 Ga0451839_1096332_68_562 163
435 3300041496 Ga0451839_1257871 Ga0451839_1257871_221_712 163
436 3300041509 Ga0451843_1176553 Ga0451843_1176553_195_686 163
437 3300041512 Ga0451853_2341168 Ga0451853_2341168_464_955 163
438 3300042138 Ga0450903_016733 Ga0450903_016733_130_621 163
439 3300042147 Ga0450910_003647 Ga0450910_003647_1417_1908 163
440 3300042156 Ga0439446_0101619 Ga0439446_0101619_206_697 163
441 3300042157 Ga0439458_0041328 Ga0439458_0041328_334_828 163
442 3300042435 Ga0439434_0020185 Ga0439434_0020185_49_546 163
443 3300042461 Ga0439460_0110536 Ga0439460_0110536_228_722 163
444 3300042530 Ga0450916_049755 Ga0450916_049755_48_539 163
445 3300044694 Ga0466963_0989970 Ga0466963_0989970_47_538 163
446 3300044712 Ga0453684_0419249 Ga0453684_0419249_606_1097 163
447 3300044901 Ga0466960_0092415 Ga0466960_0092415_788_1279 163
448 3300045051 Ga0451576_0291608 Ga0451576_0291608_913_1494 163
449 3300046459 Ga0495629_0247181 Ga0495629_0247181_186_677 163
450 3300046461 Ga0495641_0065719 Ga0495641_0065719_83_574 163
451 3300046516 Ga0495628_0679114 Ga0495628_0679114_147_638 163
452 3300046516 Ga0495628_0888906 Ga0495628_0888906_60_554 163
453 3300046529 Ga0495652_0518768 Ga0495652_0518768_47_538 163
454 3300046529 Ga0495652_0989004 Ga0495652_0989004_13_507 163
455 3300046559 Ga0495667_0206015 Ga0495667_0206015_285_776 163
456 3300046663 Ga0495635_0332941 Ga0495635_0332941_301_792 163
457 3300046683 Ga0495658_0218813 Ga0495658_0218813_316_810 163
458 3300046690 Ga0495624_0322833 Ga0495624_0322833_253_744 163
459 3300047319 Ga0495674_0202973 Ga0495674_0202973_275_766 163
460 3300047321 Ga0495676_0312067 Ga0495676_0312067_124_615 163
461 3300048904 Ga0496101_0366095 Ga0496101_0366095_314_805 163
462 3300048905 Ga0496102_0072109 Ga0496102_0072109_2387_2881 163
463 3300048905 Ga0496102_0171063 Ga0496102_0171063_176_667 163
464 3300048905 Ga0496102_0275093 Ga0496102_0275093_235_726 163
465 3300048905 Ga0496102_0292077 Ga0496102_0292077_894_1385 163
466 3300048905 Ga0496102_0861838 Ga0496102_0861838_290_781 163
467 3300048906 Ga0496103_0004894 Ga0496103_0004894_4108_4599 163
468 3300048907 Ga0496104_0009047 Ga0496104_0009047_6651_7142 163
469 3300048907 Ga0496104_0061252 Ga0496104_0061252_2239_2733 163
470 3300048907 Ga0496104_0262077 Ga0496104_0262077_241_735 163
471 3300048908 Ga0496105_0079524 Ga0496105_0079524_1812_2303 163
472 3300048908 Ga0496105_0171309 Ga0496105_0171309_400_894 163
473 3300048909 Ga0496106_0262711 Ga0496106_0262711_610_1101 163
474 3300048910 Ga0496107_0117330 Ga0496107_0117330_244_735 163
475 3300048910 Ga0496107_0385928 Ga0496107_0385928_16_597 163
476 3300048911 Ga0496108_0019232 Ga0496108_0019232_443_937 163
477 3300048911 Ga0496108_0079315 Ga0496108_0079315_1760_2251 163
478 3300048911 Ga0496108_0097111 Ga0496108_0097111_506_997 163
479 3300048912 Ga0496109_0017002 Ga0496109_0017002_2996_3490 163
480 3300048912 Ga0496109_0018489 Ga0496109_0018489_2221_2712 163
481 3300048912 Ga0496109_0054234 Ga0496109_0054234_2258_2752 163
482 3300048912 Ga0496109_0108621 Ga0496109_0108621_1012_1503 163
483 3300048912 Ga0496109_0654758 Ga0496109_0654758_191_682 163
484 3300048913 Ga0496110_0083658 Ga0496110_0083658_1186_1677 163
485 3300048913 Ga0496110_0256613 Ga0496110_0256613_637_1128 163
486 3300048913 Ga0496110_0670808 Ga0496110_0670808_153_647 163
487 3300048914 Ga0496111_0095920 Ga0496111_0095920_439_930 163
488 3300048914 Ga0496111_0171823 Ga0496111_0171823_181_675 163
489 3300048915 Ga0496112_0079131 Ga0496112_0079131_480_974 163
490 3300048915 Ga0496112_0101512 Ga0496112_0101512_560_1051 163
491 3300048916 Ga0496113_0062223 Ga0496113_0062223_1169_1663 163
492 3300048916 Ga0496113_0065947 Ga0496113_0065947_1862_2353 163
493 3300048916 Ga0496113_0135385 Ga0496113_0135385_1159_1650 163
494 3300048917 Ga0496114_0131403 Ga0496114_0131403_1332_1826 163
495 3300048917 Ga0496114_0147108 Ga0496114_0147108_1231_1722 163
496 3300049568 Ga0501031_0020611 Ga0501031_0020611_457_948 163
497 3300049568 Ga0501031_0071707 Ga0501031_0071707_1598_2089 163
498 3300049568 Ga0501031_0158439 Ga0501031_0158439_715_1206 163
499 3300049568 Ga0501031_0189547 Ga0501031_0189547_279_770 163
500 3300049568 Ga0501031_0358283 Ga0501031_0358283_396_887 163
501 3300049569 Ga0501032_0252912 Ga0501032_0252912_450_941 163
502 3300049570 Ga0501033_0051727 Ga0501033_0051727_2028_2519 163
503 3300049572 Ga0501036_0446681 Ga0501036_0446681_314_805 163
504 3300049572 Ga0501036_1267078 Ga0501036_1267078_98_589 163
505 3300049573 Ga0501037_0078142 Ga0501037_0078142_1765_2256 163
506 3300049573 Ga0501037_0479361 Ga0501037_0479361_327_818 163
507 3300049574 Ga0501038_0014155 Ga0501038_0014155_5103_5594 163
508 3300049574 Ga0501038_0137375 Ga0501038_0137375_538_1029 163
509 3300049575 Ga0501039_0058790 Ga0501039_0058790_1965_2456 163
510 3300049575 Ga0501039_0328519 Ga0501039_0328519_581_1072 163
511 3300049575 Ga0501039_0748485 Ga0501039_0748485_204_695 163
512 3300049576 Ga0501040_0046352 Ga0501040_0046352_247_738 163
513 3300049576 Ga0501040_0053961 Ga0501040_0053961_720_1211 163
514 3300049576 Ga0501040_0164984 Ga0501040_0164984_867_1358 163
515 3300049576 Ga0501040_0318087 Ga0501040_0318087_352_843 163
516 3300049577 Ga0501041_0019958 Ga0501041_0019958_713_1204 163
517 3300049577 Ga0501041_0028013 Ga0501041_0028013_684_1175 163
518 3300049578 Ga0501042_0051113 Ga0501042_0051113_2007_2498 163
519 3300049578 Ga0501042_0368749 Ga0501042_0368749_159_650 163
520 3300049578 Ga0501042_0433863 Ga0501042_0433863_79_570 163
521 3300049578 Ga0501042_0698495 Ga0501042_0698495_211_702 163
522 3300049579 Ga0501043_0145598 Ga0501043_0145598_908_1399 163
523 3300049580 Ga0501046_0033725 Ga0501046_0033725_1032_1523 163
524 3300049582 Ga0501048_0049081 Ga0501048_0049081_1012_1503 163
525 3300049582 Ga0501048_0066054 Ga0501048_0066054_1491_1982 163
526 3300049582 Ga0501048_0573936 Ga0501048_0573936_25_516 163
527 3300049582 Ga0501048_0686628 Ga0501048_0686628_123_620 163
528 3300049583 Ga0501067_0022093 Ga0501067_0022093_2901_3395 163
529 3300049583 Ga0501067_0036428 Ga0501067_0036428_1568_2059 163
530 3300049583 Ga0501067_0166275 Ga0501067_0166275_120_611 163
531 3300049584 Ga0501068_0163099 Ga0501068_0163099_483_974 163
532 3300049585 Ga0501069_0003512 Ga0501069_0003512_6970_7461 163
533 3300049585 Ga0501069_0105549 Ga0501069_0105549_671_1165 163
534 3300049585 Ga0501069_0182675 Ga0501069_0182675_46_537 163
535 3300049585 Ga0501069_0353108 Ga0501069_0353108_305_796 163
536 3300049585 Ga0501069_0360162 Ga0501069_0360162_36_527 163
537 3300049585 Ga0501069_0377606 Ga0501069_0377606_287_778 163
538 3300049586 Ga0501070_0035779 Ga0501070_0035779_601_1092 163
539 3300049586 Ga0501070_0120340 Ga0501070_0120340_146_637 163
540 3300049586 Ga0501070_0559303 Ga0501070_0559303_84_575 163
541 3300049587 Ga0501071_0025657 Ga0501071_0025657_388_879 163
542 3300049587 Ga0501071_0062316 Ga0501071_0062316_1980_2471 163
543 3300049587 Ga0501071_0135318 Ga0501071_0135318_1106_1597 163
544 3300049587 Ga0501071_0350393 Ga0501071_0350393_393_890 163
545 3300049587 Ga0501071_0711925 Ga0501071_0711925_200_691 163
546 3300049588 Ga0501072_0043147 Ga0501072_0043147_2666_3157 163
547 3300049588 Ga0501072_0078047 Ga0501072_0078047_1011_1502 163
548 3300049588 Ga0501072_0104654 Ga0501072_0104654_1539_2030 163
549 3300049588 Ga0501072_0222517 Ga0501072_0222517_817_1308 163
550 3300049588 Ga0501072_0335590 Ga0501072_0335590_272_763 163
551 3300049589 Ga0501073_0315394 Ga0501073_0315394_454_945 163
552 3300049590 Ga0501074_0023832 Ga0501074_0023832_3460_3951 163
553 3300049590 Ga0501074_0067445 Ga0501074_0067445_1342_1833 163
554 3300049590 Ga0501074_0079410 Ga0501074_0079410_1178_1669 163
555 3300049591 Ga0501075_0113293 Ga0501075_0113293_444_935 163
556 3300049591 Ga0501075_0221071 Ga0501075_0221071_757_1248 163
557 3300049591 Ga0501075_0242029 Ga0501075_0242029_44_535 163
558 3300049591 Ga0501075_0262735 Ga0501075_0262735_171_662 163
559 3300049591 Ga0501075_0508110 Ga0501075_0508110_242_733 163
560 3300049591 Ga0501075_0521804 Ga0501075_0521804_221_712 163
561 3300049591 Ga0501075_0522856 Ga0501075_0522856_270_761 163
562 3300049592 Ga0501076_0059326 Ga0501076_0059326_2012_2503 163
563 3300049592 Ga0501076_0145387 Ga0501076_0145387_269_760 163
564 3300049592 Ga0501076_0157175 Ga0501076_0157175_279_770 163
565 3300049592 Ga0501076_0172073 Ga0501076_0172073_1104_1595 163
566 3300049592 Ga0501076_0335519 Ga0501076_0335519_300_791 163
567 3300049593 Ga0501077_0014521 Ga0501077_0014521_1500_1991 163
568 3300049593 Ga0501077_0060899 Ga0501077_0060899_327_818 163
569 3300049593 Ga0501077_0224965 Ga0501077_0224965_500_991 163
570 3300049656 Ga0501209_162656 Ga0501209_162656_104_595 163
571 3300049741 Ga0501079_0053262 Ga0501079_0053262_512_1003 163
572 3300049741 Ga0501079_0058234 Ga0501079_0058234_1780_2271 163
573 3300049741 Ga0501079_0094329 Ga0501079_0094329_1024_1518 163
574 3300049741 Ga0501079_0245805 Ga0501079_0245805_854_1345 163
575 3300049742 Ga0501080_0032123 Ga0501080_0032123_1337_1828 163
576 3300049742 Ga0501080_0196191 Ga0501080_0196191_1255_1746 163
577 3300049743 Ga0501081_0220729 Ga0501081_0220729_450_941 163
578 3300049743 Ga0501081_0259953 Ga0501081_0259953_371_862 163
579 3300049743 Ga0501081_0449271 Ga0501081_0449271_30_521 163
580 3300049743 Ga0501081_0586219 Ga0501081_0586219_37_528 163
581 3300049744 Ga0501083_0087933 Ga0501083_0087933_1270_1761 163
582 3300049822 Ga0501035_0073771 Ga0501035_0073771_404_895 163
583 3300049823 Ga0501044_0130530 Ga0501044_0130530_1128_1619 163
584 3300049823 Ga0501044_0590933 Ga0501044_0590933_363_854 163
585 3300049824 Ga0501045_0011588 Ga0501045_0011588_4597_5088 163
586 3300049824 Ga0501045_0033475 Ga0501045_0033475_1291_1782 163
587 3300049824 Ga0501045_0194558 Ga0501045_0194558_517_1008 163
588 3300049824 Ga0501045_0263745 Ga0501045_0263745_649_1140 163
589 3300050492 nmdc:mga0yw44_675702_c1 nmdc:mga0yw44_675702_c1_70_561 163
590 3300050507 nmdc:mga05p37_20144_c1 nmdc:mga05p37_20144_c1_5586_6077 163
591 3300050507 nmdc:mga05p37_239537_c1 nmdc:mga05p37_239537_c1_981_1472 163
592 3300050507 nmdc:mga05p37_449025_c1 nmdc:mga05p37_449025_c1_426_917 163
593 3300050507 nmdc:mga05p37_562877_c1 nmdc:mga05p37_562877_c1_750_1241 163
594 3300050507 nmdc:mga05p37_578899_c1 nmdc:mga05p37_578899_c1_574_1065 163
595 3300050508 nmdc:mga09592_1201878_c1 nmdc:mga09592_1201878_c1_124_615 163
596 3300050510 nmdc:mga06r32_1343550_c1 nmdc:mga06r32_1343550_c1_103_594 163
597 3300050510 nmdc:mga06r32_912777_c1 nmdc:mga06r32_912777_c1_11_511 163
598 3300050511 nmdc:mga08y16_1482508_c1 nmdc:mga08y16_1482508_c1_104_595 163
599 3300050511 nmdc:mga08y16_158637_c1 nmdc:mga08y16_158637_c1_1438_1929 163
600 3300050511 nmdc:mga08y16_40112_c1 nmdc:mga08y16_40112_c1_1379_1879 163
601 3300050511 nmdc:mga08y16_467134_c1 nmdc:mga08y16_467134_c1_425_916 163
602 3300050511 nmdc:mga08y16_95719_c1 nmdc:mga08y16_95719_c1_57_548 163
603 3300050514 nmdc:mga08x19_334086_c1 nmdc:mga08x19_334086_c1_274_765 163
604 3300050515 nmdc:mga0a205_418650_c1 nmdc:mga0a205_418650_c1_261_752 163
605 3300050515 nmdc:mga0a205_49481_c1 nmdc:mga0a205_49481_c1_735_1229 163
606 3300053077 Ga0495601_0157190 Ga0495601_0157190_560_1054 163
607 3300053077 Ga0495601_0243545 Ga0495601_0243545_187_681 163
608 3300053077 Ga0495601_0324679 Ga0495601_0324679_241_732 163
609 3300053078 Ga0495612_0047168 Ga0495612_0047168_593_1087 163
610 3300053085 Ga0495619_0059363 Ga0495619_0059363_480_974 163
611 3300053085 Ga0495619_0274633 Ga0495619_0274633_127_621 163
612 3300054114 Ga0501084_0089499 Ga0501084_0089499_577_1068 163
613 3300054114 Ga0501084_0242430 Ga0501084_0242430_674_1165 163
614 3300059421 Ga0590071_003513 Ga0590071_003513_2795_3286 163
615 3300060353 Ga0501082_0152458 Ga0501082_0152458_298_789 163
616 3300060353 Ga0501082_0194535 Ga0501082_0194535_574_1068 163
617 3300060353 Ga0501082_0207997 Ga0501082_0207997_537_1028 163
618 3300060353 Ga0501082_0218876 Ga0501082_0218876_560_1051 163
619 3300060353 Ga0501082_0642884 Ga0501082_0642884_284_775 163
620 3300060353 Ga0501082_0824320 Ga0501082_0824320_204_695 163
621 3300060353 Ga0501082_0894375 Ga0501082_0894375_19_510 163
622 3300061734 Ga0530510_0005043 Ga0530510_0005043_8610_9101 163
623 3300061734 Ga0530510_0015303 Ga0530510_0015303_4680_5171 163
624 3300061734 Ga0530510_0016613 Ga0530510_0016613_1360_1851 163
625 3300061734 Ga0530510_0044381 Ga0530510_0044381_463_954 163
626 3300061734 Ga0530510_0134757 Ga0530510_0134757_268_759 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

34

193

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9039 5 163
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8882 5 163
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8737 6 163
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8494 6 163
3u1k-assembly2.cif.gz_B crystal structure of human pnpase 0.7124 110 150
ID Description Score Start End Superfamily
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9463 13 96 3.30.70.990
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9431 102 163 3.30.70.860
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9403 12 101 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9262 12 101 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9164 12 101 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A7Z9SD14-F1-model_v4 DUF520 family protein 0.9902 13 99 GO:0000166
GO:0005829
AF-A0A535HTI7-F1-model_v4 UPF0234 protein E6J14_05950 0.9863 1 163 GO:0000166
GO:0005829
AF-A0A383DX75-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9821 14 99 GO:0000166
GO:0005829
AF-A0A6J4JM05-F1-model_v4 UPF0234 protein Yitk 0.9806 10 79 GO:0000166
GO:0005829
AF-A0A7W0J5U9-F1-model_v4 Nucleotide-binding protein 0.9797 14 100 GO:0000166
GO:0005829

Feature Viewer

pLDDT pTM Quality
90.24 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map