F470454
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 626 | 299 | 626 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10392956|Ga0105240_103929563 |
| Length | 193 |
| Sequence | VVQGILARFIPDRCAASGAPPIAEPQGRPMAGDVSFDVVSDFDEQELRNALDQVRREVGQRFDFKGVTVDLEQSKDELTLVTDDEHRAAAIKDLIESKAVRRNLSLKIFDWGRIEPSGGNKVRQSITLRRGLNDELAKKISKLIREEFPKVKPQIQGDAVRVSGKSRDELQKVIGRLRELEELPVPLQFENYR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 182 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 194 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 197 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 212 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 218 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 219 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 220 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 221 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 222 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 223 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.64 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.8 |
| Nodule | 0 |
| Rhizoplane | 5.91 |
| Rhizosphere | 92.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10046962 | 3300001991 | Unclassified | 875 |
| 2 | JGI24749J21850_1020202 | 3300002076 | Bacteria | 940 |
| 3 | Ga0065715_10509233 | 3300005293 | Bacteria | 773 |
| 4 | Ga0065707_10375342 | 3300005295 | Bacteria | 884 |
| 5 | Ga0070658_10241879 | 3300005327 | Bacteria | 1530 |
| 6 | Ga0070676_10111411 | 3300005328 | Bacteria | 1704 |
| 7 | Ga0070676_10685557 | 3300005328 | Unclassified | 747 |
| 8 | Ga0070683_100156938 | 3300005329 | Bacteria | 2158 |
| 9 | Ga0070683_100863814 | 3300005329 | Bacteria | 868 |
| 10 | Ga0070683_100901499 | 3300005329 | Bacteria | 848 |
| 11 | Ga0070690_100014092 | 3300005330 | Bacteria | 4740 |
| 12 | Ga0070670_100089777 | 3300005331 | Bacteria | 2642 |
| 13 | Ga0070670_100311092 | 3300005331 | Bacteria | 1379 |
| 14 | Ga0068869_100030300 | 3300005334 | Bacteria | 3796 |
| 15 | Ga0068869_100576464 | 3300005334 | Unclassified | 948 |
| 16 | Ga0070666_10394560 | 3300005335 | Unclassified | 994 |
| 17 | Ga0070680_100436709 | 3300005336 | Unclassified | 1117 |
| 18 | Ga0070682_100161518 | 3300005337 | Bacteria | 1548 |
| 19 | Ga0070682_100939009 | 3300005337 | Bacteria | 714 |
| 20 | Ga0068868_100491901 | 3300005338 | Unclassified | 1073 |
| 21 | Ga0068868_100548167 | 3300005338 | Unclassified | 1019 |
| 22 | Ga0070660_100066802 | 3300005339 | Bacteria | 2801 |
| 23 | Ga0070660_100325088 | 3300005339 | Bacteria | 1264 |
| 24 | Ga0070689_100003459 | 3300005340 | Bacteria | 10503 |
| 25 | Ga0070691_10003464 | 3300005341 | Bacteria | 7099 |
| 26 | Ga0070687_100000829 | 3300005343 | Bacteria | 10321 |
| 27 | Ga0070687_100460365 | 3300005343 | Bacteria | 848 |
| 28 | Ga0070661_100600595 | 3300005344 | Unclassified | 890 |
| 29 | Ga0070692_10327643 | 3300005345 | Unclassified | 944 |
| 30 | Ga0070692_10383334 | 3300005345 | Bacteria | 883 |
| 31 | Ga0070668_100074006 | 3300005347 | Bacteria | 2657 |
| 32 | Ga0070668_100338209 | 3300005347 | Bacteria | 1271 |
| 33 | Ga0070669_100129992 | 3300005353 | Bacteria | 1931 |
| 34 | Ga0070669_100817082 | 3300005353 | Unclassified | 793 |
| 35 | Ga0070675_100148623 | 3300005354 | Bacteria | 2007 |
| 36 | Ga0070671_100343230 | 3300005355 | Bacteria | 1274 |
| 37 | Ga0070671_100572225 | 3300005355 | Unclassified | 975 |
| 38 | Ga0070674_100006333 | 3300005356 | Bacteria | 6896 |
| 39 | Ga0070673_100002033 | 3300005364 | Bacteria | 12206 |
| 40 | Ga0070688_100002572 | 3300005365 | Bacteria | 9189 |
| 41 | Ga0070688_100597440 | 3300005365 | Bacteria | 844 |
| 42 | Ga0070659_100008430 | 3300005366 | Bacteria | 7529 |
| 43 | Ga0070659_100395402 | 3300005366 | Bacteria | 1166 |
| 44 | Ga0070659_100504916 | 3300005366 | Bacteria | 1031 |
| 45 | Ga0070659_100538060 | 3300005366 | Bacteria | 999 |
| 46 | Ga0070703_10009342 | 3300005406 | Bacteria | 2766 |
| 47 | Ga0070701_10040831 | 3300005438 | Bacteria | 2361 |
| 48 | Ga0070705_100010402 | 3300005440 | Bacteria | 4656 |
| 49 | Ga0070705_100012300 | 3300005440 | Bacteria | 4348 |
| 50 | Ga0070705_100016836 | 3300005440 | Bacteria | 3806 |
| 51 | Ga0070705_100119196 | 3300005440 | Bacteria | 1701 |
| 52 | Ga0070700_100071854 | 3300005441 | Bacteria | 2210 |
| 53 | Ga0070700_100129481 | 3300005441 | Bacteria | 1701 |
| 54 | Ga0070700_100488357 | 3300005441 | Unclassified | 945 |
| 55 | Ga0070694_100006418 | 3300005444 | Bacteria | 7134 |
| 56 | Ga0070694_100068632 | 3300005444 | Unclassified | 2437 |
| 57 | Ga0070694_100124864 | 3300005444 | Bacteria | 1851 |
| 58 | Ga0070694_100166317 | 3300005444 | Bacteria | 1622 |
| 59 | Ga0070694_100325647 | 3300005444 | Unclassified | 1184 |
| 60 | Ga0070694_100452547 | 3300005444 | Bacteria | 1014 |
| 61 | Ga0070694_101191638 | 3300005444 | Bacteria | 638 |
| 62 | Ga0070708_100002789 | 3300005445 | Bacteria | 13580 |
| 63 | Ga0070708_100051497 | 3300005445 | Bacteria | 3648 |
| 64 | Ga0070663_100042986 | 3300005455 | Bacteria | 3178 |
| 65 | Ga0070663_100817833 | 3300005455 | Bacteria | 800 |
| 66 | Ga0070678_100306182 | 3300005456 | Bacteria | 1352 |
| 67 | Ga0070678_101091679 | 3300005456 | Bacteria | 736 |
| 68 | Ga0070662_100231572 | 3300005457 | Bacteria | 1478 |
| 69 | Ga0070681_10348031 | 3300005458 | Bacteria | 1392 |
| 70 | Ga0070681_10454317 | 3300005458 | Bacteria | 1193 |
| 71 | Ga0070681_10512080 | 3300005458 | Bacteria | 1113 |
| 72 | Ga0070681_10651383 | 3300005458 | Unclassified | 968 |
| 73 | Ga0070681_10833048 | 3300005458 | Bacteria | 840 |
| 74 | Ga0068867_100018046 | 3300005459 | Bacteria | 5014 |
| 75 | Ga0070685_10011431 | 3300005466 | Bacteria | 4646 |
| 76 | Ga0070706_100000374 | 3300005467 | Bacteria | 53751 |
| 77 | Ga0070706_100000528 | 3300005467 | Bacteria | 44483 |
| 78 | Ga0070706_100149509 | 3300005467 | Bacteria | 2180 |
| 79 | Ga0070707_100004216 | 3300005468 | Bacteria | 13475 |
| 80 | Ga0070707_100096671 | 3300005468 | Bacteria | 2861 |
| 81 | Ga0070698_100316825 | 3300005471 | Bacteria | 1490 |
| 82 | Ga0070698_100646393 | 3300005471 | Bacteria | 999 |
| 83 | Ga0070699_100014846 | 3300005518 | Bacteria | 6697 |
| 84 | Ga0070699_100046650 | 3300005518 | Bacteria | 3749 |
| 85 | Ga0070699_100436108 | 3300005518 | Bacteria | 1187 |
| 86 | Ga0070699_100462510 | 3300005518 | Unclassified | 1151 |
| 87 | Ga0070699_100674512 | 3300005518 | Unclassified | 944 |
| 88 | Ga0070699_101291291 | 3300005518 | Bacteria | 669 |
| 89 | Ga0070679_100028396 | 3300005530 | Bacteria | 5515 |
| 90 | Ga0070679_100561141 | 3300005530 | Bacteria | 1085 |
| 91 | Ga0070679_100570255 | 3300005530 | Unclassified | 1075 |
| 92 | Ga0070679_101323782 | 3300005530 | Bacteria | 666 |
| 93 | Ga0070684_100278410 | 3300005535 | Unclassified | 1532 |
| 94 | Ga0070684_100463968 | 3300005535 | Bacteria | 1171 |
| 95 | Ga0070697_100005120 | 3300005536 | Bacteria | 10068 |
| 96 | Ga0070697_100020214 | 3300005536 | Bacteria | 5264 |
| 97 | Ga0070697_100062839 | 3300005536 | Bacteria | 3031 |
| 98 | Ga0070697_100218326 | 3300005536 | Bacteria | 1625 |
| 99 | Ga0070697_100399139 | 3300005536 | Bacteria | 1193 |
| 100 | Ga0068853_100140477 | 3300005539 | Bacteria | 2168 |
| 101 | Ga0068853_101231188 | 3300005539 | Bacteria | 723 |
| 102 | Ga0068853_101360863 | 3300005539 | Bacteria | 686 |
| 103 | Ga0068853_101503875 | 3300005539 | Bacteria | 652 |
| 104 | Ga0070695_100016070 | 3300005545 | Bacteria | 4525 |
| 105 | Ga0070695_100044621 | 3300005545 | Bacteria | 2823 |
| 106 | Ga0070695_100176304 | 3300005545 | Bacteria | 1511 |
| 107 | Ga0070695_100236169 | 3300005545 | Bacteria | 1324 |
| 108 | Ga0070695_100554025 | 3300005545 | Bacteria | 897 |
| 109 | Ga0070696_100076132 | 3300005546 | Bacteria | 2368 |
| 110 | Ga0070696_100132572 | 3300005546 | Bacteria | 1814 |
| 111 | Ga0070693_100249941 | 3300005547 | Bacteria | 1175 |
| 112 | Ga0070665_100639374 | 3300005548 | Unclassified | 1077 |
| 113 | Ga0070704_100007204 | 3300005549 | Bacteria | 6613 |
| 114 | Ga0070704_100087709 | 3300005549 | Bacteria | 2310 |
| 115 | Ga0070704_100115718 | 3300005549 | Unclassified | 2049 |
| 116 | Ga0070704_100335892 | 3300005549 | Bacteria | 1271 |
| 117 | Ga0070704_100587702 | 3300005549 | Bacteria | 977 |
| 118 | Ga0068855_100104951 | 3300005563 | Bacteria | 3250 |
| 119 | Ga0068857_100024638 | 3300005577 | Bacteria | 5299 |
| 120 | Ga0070702_100000984 | 3300005615 | Bacteria | 11240 |
| 121 | Ga0068852_100021181 | 3300005616 | Bacteria | 5183 |
| 122 | Ga0068852_100030876 | 3300005616 | Bacteria | 4415 |
| 123 | Ga0068859_100085464 | 3300005617 | Bacteria | 3200 |
| 124 | Ga0068859_100637390 | 3300005617 | Unclassified | 1158 |
| 125 | Ga0068859_100982247 | 3300005617 | Unclassified | 927 |
| 126 | Ga0068864_100033660 | 3300005618 | Bacteria | 4357 |
| 127 | Ga0068864_101152616 | 3300005618 | Bacteria | 773 |
| 128 | Ga0068866_10038039 | 3300005718 | Bacteria | 2367 |
| 129 | Ga0068861_100583356 | 3300005719 | Bacteria | 1024 |
| 130 | Ga0068858_100058133 | 3300005842 | Bacteria | 3575 |
| 131 | Ga0068860_100183995 | 3300005843 | Bacteria | 2020 |
| 132 | Ga0068860_100440293 | 3300005843 | Bacteria | 1294 |
| 133 | Ga0068862_100046135 | 3300005844 | Bacteria | 3719 |
| 134 | Ga0068862_100291867 | 3300005844 | Bacteria | 1498 |
| 135 | Ga0081539_10010782 | 3300005985 | Bacteria | 7356 |
| 136 | Ga0075365_10002896 | 3300006038 | Bacteria | 8647 |
| 137 | Ga0075364_10003417 | 3300006051 | Bacteria | 9026 |
| 138 | Ga0075432_10131836 | 3300006058 | Unclassified | 947 |
| 139 | Ga0070716_100487190 | 3300006173 | Bacteria | 907 |
| 140 | Ga0070716_100526722 | 3300006173 | Unclassified | 877 |
| 141 | Ga0070716_100654739 | 3300006173 | Unclassified | 797 |
| 142 | Ga0097621_100216434 | 3300006237 | Bacteria | 1668 |
| 143 | Ga0097621_100975018 | 3300006237 | Bacteria | 792 |
| 144 | Ga0075428_100769637 | 3300006844 | Bacteria | 1024 |
| 145 | Ga0075431_100214169 | 3300006847 | Bacteria | 1967 |
| 146 | Ga0075431_100229100 | 3300006847 | Bacteria | 1894 |
| 147 | Ga0075431_100947492 | 3300006847 | Bacteria | 829 |
| 148 | Ga0075433_10129634 | 3300006852 | Bacteria | 2240 |
| 149 | Ga0075433_10275738 | 3300006852 | Bacteria | 1490 |
| 150 | Ga0075433_10325324 | 3300006852 | Unclassified | 1360 |
| 151 | Ga0075434_100814863 | 3300006871 | Bacteria | 949 |
| 152 | Ga0075429_100963741 | 3300006880 | Bacteria | 746 |
| 153 | Ga0068865_100012709 | 3300006881 | Bacteria | 5305 |
| 154 | Ga0075436_100369594 | 3300006914 | Bacteria | 1036 |
| 155 | Ga0097620_100085471 | 3300006931 | Bacteria | 3200 |
| 156 | Ga0097620_100637388 | 3300006931 | Unclassified | 1158 |
| 157 | Ga0097620_100981930 | 3300006931 | Unclassified | 927 |
| 158 | Ga0097620_101474530 | 3300006931 | Unclassified | 751 |
| 159 | Ga0075435_100560275 | 3300007076 | Bacteria | 990 |
| 160 | Ga0105251_10230282 | 3300009011 | Bacteria | 834 |
| 161 | Ga0105240_10392956 | 3300009093 | Bacteria | 1564 |
| 162 | Ga0111539_10000282 | 3300009094 | Bacteria | 61040 |
| 163 | Ga0111539_10008872 | 3300009094 | Bacteria | 12734 |
| 164 | Ga0111539_10112699 | 3300009094 | Bacteria | 3191 |
| 165 | Ga0111539_10147186 | 3300009094 | Bacteria | 2758 |
| 166 | Ga0111539_10720575 | 3300009094 | Unclassified | 1161 |
| 167 | Ga0111539_11892564 | 3300009094 | Bacteria | 692 |
| 168 | Ga0105245_10013989 | 3300009098 | Bacteria | 6989 |
| 169 | Ga0105245_10136678 | 3300009098 | Bacteria | 2304 |
| 170 | Ga0105245_10315057 | 3300009098 | Bacteria | 1539 |
| 171 | Ga0105245_10424725 | 3300009098 | Unclassified | 1333 |
| 172 | Ga0114129_10090097 | 3300009147 | Bacteria | 4252 |
| 173 | Ga0114129_10096844 | 3300009147 | Bacteria | 4085 |
| 174 | Ga0114129_10131066 | 3300009147 | Bacteria | 3443 |
| 175 | Ga0114129_10184981 | 3300009147 | Unclassified | 2832 |
| 176 | Ga0114129_10583749 | 3300009147 | Bacteria | 1450 |
| 177 | Ga0114129_10947684 | 3300009147 | Bacteria | 1087 |
| 178 | Ga0105243_10133193 | 3300009148 | Unclassified | 2112 |
| 179 | Ga0105243_10163660 | 3300009148 | Bacteria | 1920 |
| 180 | Ga0105243_10433996 | 3300009148 | Bacteria | 1228 |
| 181 | Ga0105241_10252514 | 3300009174 | Bacteria | 1496 |
| 182 | Ga0105241_11324039 | 3300009174 | Unclassified | 687 |
| 183 | Ga0105242_10440333 | 3300009176 | Bacteria | 1226 |
| 184 | Ga0105248_10382383 | 3300009177 | Bacteria | 1585 |
| 185 | Ga0105248_10921216 | 3300009177 | Unclassified | 987 |
| 186 | Ga0105237_10144150 | 3300009545 | Bacteria | 2376 |
| 187 | Ga0105237_11395431 | 3300009545 | Unclassified | 707 |
| 188 | Ga0105238_10093437 | 3300009551 | Bacteria | 2996 |
| 189 | Ga0105249_10004683 | 3300009553 | Bacteria | 11814 |
| 190 | Ga0105249_10210713 | 3300009553 | Bacteria | 1907 |
| 191 | Ga0105249_10222811 | 3300009553 | Bacteria | 1857 |
| 192 | Ga0105249_10401397 | 3300009553 | Bacteria | 1401 |
| 193 | Ga0105249_11257653 | 3300009553 | Bacteria | 811 |
| 194 | Ga0105249_11363206 | 3300009553 | Unclassified | 781 |
| 195 | Ga0105239_10038180 | 3300010375 | Bacteria | 5263 |
| 196 | Ga0105239_10429901 | 3300010375 | Bacteria | 1497 |
| 197 | Ga0105246_10306592 | 3300011119 | Bacteria | 1284 |
| 198 | Ga0105246_10313786 | 3300011119 | Bacteria | 1271 |
| 199 | Ga0105246_10407201 | 3300011119 | Unclassified | 1131 |
| 200 | Ga0105246_11033385 | 3300011119 | Bacteria | 746 |
| 201 | Ga0157373_10505813 | 3300013100 | Bacteria | 873 |
| 202 | Ga0157374_10630779 | 3300013296 | Unclassified | 1083 |
| 203 | Ga0157378_10069343 | 3300013297 | Bacteria | 3163 |
| 204 | Ga0157378_10461061 | 3300013297 | Bacteria | 1263 |
| 205 | Ga0157378_10625912 | 3300013297 | Bacteria | 1090 |
| 206 | Ga0163162_10355703 | 3300013306 | Bacteria | 1597 |
| 207 | Ga0157375_10317204 | 3300013308 | Unclassified | 1723 |
| 208 | Ga0157375_10689966 | 3300013308 | Bacteria | 1175 |
| 209 | Ga0157375_12022470 | 3300013308 | Unclassified | 685 |
| 210 | Ga0163163_10049588 | 3300014325 | Bacteria | 4132 |
| 211 | Ga0163163_10218725 | 3300014325 | Bacteria | 1953 |
| 212 | Ga0163163_10228807 | 3300014325 | Bacteria | 1908 |
| 213 | Ga0157380_10016559 | 3300014326 | Bacteria | 5439 |
| 214 | Ga0157380_10380583 | 3300014326 | Unclassified | 1332 |
| 215 | Ga0157377_10001089 | 3300014745 | Bacteria | 11494 |
| 216 | Ga0157377_10060360 | 3300014745 | Bacteria | 2164 |
| 217 | Ga0157377_10240500 | 3300014745 | Bacteria | 1168 |
| 218 | Ga0157379_10190614 | 3300014968 | Unclassified | 1853 |
| 219 | Ga0157379_10289179 | 3300014968 | Bacteria | 1492 |
| 220 | Ga0157379_10373201 | 3300014968 | Bacteria | 1308 |
| 221 | Ga0157376_10721007 | 3300014969 | Bacteria | 1004 |
| 222 | Ga0157376_10782660 | 3300014969 | Bacteria | 965 |
| 223 | Ga0163161_10109057 | 3300017792 | Bacteria | 2068 |
| 224 | Ga0163161_10680954 | 3300017792 | Bacteria | 855 |
| 225 | Ga0163161_10681861 | 3300017792 | Bacteria | 854 |
| 226 | Ga0163161_10775744 | 3300017792 | Bacteria | 804 |
| 227 | Ga0206356_11066570 | 3300020070 | Bacteria | 4639 |
| 228 | Ga0206351_10832329 | 3300020077 | Bacteria | 2105 |
| 229 | Ga0206354_10664940 | 3300020081 | Bacteria | 2190 |
| 230 | Ga0224712_10002139 | 3300022467 | Bacteria | 4806 |
| 231 | Ga0207656_10205789 | 3300025321 | Unclassified | 952 |
| 232 | Ga0207642_10286676 | 3300025899 | Unclassified | 949 |
| 233 | Ga0207688_10000452 | 3300025901 | Bacteria | 19462 |
| 234 | Ga0207680_10594878 | 3300025903 | Unclassified | 791 |
| 235 | Ga0207645_10061144 | 3300025907 | Bacteria | 2406 |
| 236 | Ga0207645_10543641 | 3300025907 | Unclassified | 788 |
| 237 | Ga0207643_10427345 | 3300025908 | Unclassified | 840 |
| 238 | Ga0207643_10494022 | 3300025908 | Unclassified | 782 |
| 239 | Ga0207705_10668966 | 3300025909 | Unclassified | 807 |
| 240 | Ga0207684_10000636 | 3300025910 | Bacteria | 41641 |
| 241 | Ga0207684_10008151 | 3300025910 | Bacteria | 9335 |
| 242 | Ga0207684_10009155 | 3300025910 | Bacteria | 8763 |
| 243 | Ga0207684_10041677 | 3300025910 | Bacteria | 3891 |
| 244 | Ga0207684_11154786 | 3300025910 | Bacteria | 643 |
| 245 | Ga0207654_10132183 | 3300025911 | Bacteria | 1581 |
| 246 | Ga0207707_10105470 | 3300025912 | Unclassified | 2463 |
| 247 | Ga0207707_10284397 | 3300025912 | Bacteria | 1432 |
| 248 | Ga0207707_10716608 | 3300025912 | Bacteria | 839 |
| 249 | Ga0207707_10910477 | 3300025912 | Bacteria | 727 |
| 250 | Ga0207695_11120202 | 3300025913 | Bacteria | 667 |
| 251 | Ga0207671_10283364 | 3300025914 | Unclassified | 1307 |
| 252 | Ga0207663_10871990 | 3300025916 | Bacteria | 719 |
| 253 | Ga0207660_10028234 | 3300025917 | Bacteria | 3837 |
| 254 | Ga0207660_11214964 | 3300025917 | Unclassified | 613 |
| 255 | Ga0207662_10001307 | 3300025918 | Bacteria | 12000 |
| 256 | Ga0207657_10015330 | 3300025919 | Bacteria | 7429 |
| 257 | Ga0207657_10213656 | 3300025919 | Bacteria | 1547 |
| 258 | Ga0207652_10025593 | 3300025921 | Bacteria | 4908 |
| 259 | Ga0207646_10005701 | 3300025922 | Bacteria | 13059 |
| 260 | Ga0207646_10005912 | 3300025922 | Bacteria | 12771 |
| 261 | Ga0207681_10056929 | 3300025923 | Bacteria | 2669 |
| 262 | Ga0207681_10756828 | 3300025923 | Unclassified | 810 |
| 263 | Ga0207694_10157765 | 3300025924 | Bacteria | 1831 |
| 264 | Ga0207659_10048570 | 3300025926 | Bacteria | 3007 |
| 265 | Ga0207687_10022727 | 3300025927 | Bacteria | 4176 |
| 266 | Ga0207687_10058726 | 3300025927 | Bacteria | 2707 |
| 267 | Ga0207687_10162136 | 3300025927 | Bacteria | 1717 |
| 268 | Ga0207690_10060829 | 3300025932 | Unclassified | 2565 |
| 269 | Ga0207690_10110902 | 3300025932 | Bacteria | 1976 |
| 270 | Ga0207706_10057655 | 3300025933 | Bacteria | 3421 |
| 271 | Ga0207706_10070012 | 3300025933 | Bacteria | 3085 |
| 272 | Ga0207686_10026237 | 3300025934 | Bacteria | 3398 |
| 273 | Ga0207709_10400062 | 3300025935 | Bacteria | 1050 |
| 274 | Ga0207709_10522548 | 3300025935 | Bacteria | 929 |
| 275 | Ga0207709_10662281 | 3300025935 | Unclassified | 832 |
| 276 | Ga0207670_10085430 | 3300025936 | Bacteria | 2217 |
| 277 | Ga0207669_10037965 | 3300025937 | Bacteria | 2769 |
| 278 | Ga0207669_10776750 | 3300025937 | Unclassified | 793 |
| 279 | Ga0207704_10197482 | 3300025938 | Unclassified | 1469 |
| 280 | Ga0207704_10253151 | 3300025938 | Bacteria | 1323 |
| 281 | Ga0207665_10217740 | 3300025939 | Bacteria | 1398 |
| 282 | Ga0207665_10373067 | 3300025939 | Bacteria | 1081 |
| 283 | Ga0207711_10393305 | 3300025941 | Bacteria | 1287 |
| 284 | Ga0207689_10016068 | 3300025942 | Bacteria | 6335 |
| 285 | Ga0207689_10382258 | 3300025942 | Unclassified | 1172 |
| 286 | Ga0207661_10148433 | 3300025944 | Bacteria | 2025 |
| 287 | Ga0207661_10239512 | 3300025944 | Bacteria | 1609 |
| 288 | Ga0207661_11378328 | 3300025944 | Bacteria | 647 |
| 289 | Ga0207679_10547160 | 3300025945 | Bacteria | 1038 |
| 290 | Ga0207667_10176095 | 3300025949 | Bacteria | 2197 |
| 291 | Ga0207651_10106109 | 3300025960 | Bacteria | 2097 |
| 292 | Ga0207712_10012939 | 3300025961 | Bacteria | 5341 |
| 293 | Ga0207712_10152875 | 3300025961 | Bacteria | 1784 |
| 294 | Ga0207712_10797695 | 3300025961 | Bacteria | 830 |
| 295 | Ga0207668_10039446 | 3300025972 | Bacteria | 3179 |
| 296 | Ga0207640_10100267 | 3300025981 | Bacteria | 2029 |
| 297 | Ga0207677_10087556 | 3300026023 | Unclassified | 2255 |
| 298 | Ga0207677_10420747 | 3300026023 | Unclassified | 1138 |
| 299 | Ga0207703_10129485 | 3300026035 | Bacteria | 2177 |
| 300 | Ga0207678_10036007 | 3300026067 | Bacteria | 4308 |
| 301 | Ga0207678_11076708 | 3300026067 | Bacteria | 712 |
| 302 | Ga0207678_11125456 | 3300026067 | Bacteria | 695 |
| 303 | Ga0207708_10012012 | 3300026075 | Bacteria | 6452 |
| 304 | Ga0207708_10016501 | 3300026075 | Bacteria | 5554 |
| 305 | Ga0207708_10177616 | 3300026075 | Bacteria | 1689 |
| 306 | Ga0207641_10556324 | 3300026088 | Unclassified | 1119 |
| 307 | Ga0207648_10000662 | 3300026089 | Bacteria | 38576 |
| 308 | Ga0207648_10872967 | 3300026089 | Bacteria | 839 |
| 309 | Ga0207676_10161183 | 3300026095 | Bacteria | 1943 |
| 310 | Ga0207676_11224014 | 3300026095 | Bacteria | 744 |
| 311 | Ga0207674_10015884 | 3300026116 | Bacteria | 8252 |
| 312 | Ga0207674_10035517 | 3300026116 | Bacteria | 5201 |
| 313 | Ga0207675_100012080 | 3300026118 | Bacteria | 8069 |
| 314 | Ga0207675_100016431 | 3300026118 | Bacteria | 6912 |
| 315 | Ga0207675_100365359 | 3300026118 | Bacteria | 1417 |
| 316 | Ga0207683_10165482 | 3300026121 | Bacteria | 2001 |
| 317 | Ga0207683_10291027 | 3300026121 | Bacteria | 1493 |
| 318 | Ga0207683_10674046 | 3300026121 | Bacteria | 958 |
| 319 | Ga0207698_10047334 | 3300026142 | Bacteria | 3257 |
| 320 | Ga0207698_10650570 | 3300026142 | Bacteria | 1044 |
| 321 | Ga0209983_1048599 | 3300027665 | Bacteria | 926 |
| 322 | Ga0209983_1072951 | 3300027665 | Unclassified | 766 |
| 323 | Ga0209974_10029984 | 3300027876 | Bacteria | 1803 |
| 324 | Ga0207428_10031535 | 3300027907 | Bacteria | 4370 |
| 325 | Ga0207428_10034264 | 3300027907 | Bacteria | 4163 |
| 326 | Ga0207428_10642744 | 3300027907 | Unclassified | 762 |
| 327 | Ga0207428_10988301 | 3300027907 | Unclassified | 592 |
| 328 | Ga0268266_10149676 | 3300028379 | Bacteria | 2103 |
| 329 | Ga0268265_10640666 | 3300028380 | Bacteria | 1020 |
| 330 | Ga0268265_11313074 | 3300028380 | Bacteria | 724 |
| 331 | Ga0268264_10243981 | 3300028381 | Bacteria | 1665 |
| 332 | Ga0268264_10494354 | 3300028381 | Bacteria | 1192 |
| 333 | Ga0268264_11612935 | 3300028381 | Unclassified | 659 |
| 334 | Ga0265326_10051236 | 3300028558 | Bacteria | 1169 |
| 335 | Ga0265319_1113762 | 3300028563 | Bacteria | 845 |
| 336 | Ga0265334_10070824 | 3300028573 | Bacteria | 1299 |
| 337 | Ga0265318_10163811 | 3300028577 | Bacteria | 815 |
| 338 | Ga0265323_10076808 | 3300028653 | Bacteria | 1133 |
| 339 | Ga0265336_10072605 | 3300028666 | Unclassified | 1029 |
| 340 | Ga0265336_10084863 | 3300028666 | Unclassified | 945 |
| 341 | Ga0265338_10015195 | 3300028800 | Bacteria | 8485 |
| 342 | Ga0265338_10745884 | 3300028800 | Unclassified | 673 |
| 343 | Ga0265324_10029965 | 3300029957 | Bacteria | 1912 |
| 344 | Ga0265332_10082229 | 3300031238 | Bacteria | 1366 |
| 345 | Ga0265320_10004262 | 3300031240 | Bacteria | 9398 |
| 346 | Ga0265325_10058238 | 3300031241 | Bacteria | 1969 |
| 347 | Ga0265329_10012442 | 3300031242 | Bacteria | 3058 |
| 348 | Ga0265339_10013978 | 3300031249 | Bacteria | 4854 |
| 349 | Ga0265331_10045383 | 3300031250 | Bacteria | 2121 |
| 350 | Ga0265316_10052421 | 3300031344 | Unclassified | 3201 |
| 351 | Ga0265316_10099361 | 3300031344 | Bacteria | 2213 |
| 352 | Ga0307408_100030415 | 3300031548 | Bacteria | 3750 |
| 353 | Ga0316575_10083809 | 3300031665 | Bacteria | 1287 |
| 354 | Ga0265314_10112969 | 3300031711 | Bacteria | 1723 |
| 355 | Ga0265342_10043506 | 3300031712 | Bacteria | 2710 |
| 356 | Ga0307413_10134844 | 3300031824 | Bacteria | 1696 |
| 357 | Ga0307413_10406102 | 3300031824 | Unclassified | 1069 |
| 358 | Ga0307413_10769000 | 3300031824 | Bacteria | 807 |
| 359 | Ga0307410_10321943 | 3300031852 | Bacteria | 1227 |
| 360 | Ga0307406_10406795 | 3300031901 | Unclassified | 1080 |
| 361 | Ga0307406_10460933 | 3300031901 | Unclassified | 1022 |
| 362 | Ga0307412_10354516 | 3300031911 | Bacteria | 1179 |
| 363 | Ga0307412_10716355 | 3300031911 | Bacteria | 860 |
| 364 | Ga0307412_11121454 | 3300031911 | Unclassified | 701 |
| 365 | Ga0307409_100019934 | 3300031995 | Bacteria | 4556 |
| 366 | Ga0307409_100054802 | 3300031995 | Bacteria | 3074 |
| 367 | Ga0307409_100092330 | 3300031995 | Bacteria | 2484 |
| 368 | Ga0307416_100006460 | 3300032002 | Bacteria | 7342 |
| 369 | Ga0307416_100322590 | 3300032002 | Bacteria | 1547 |
| 370 | Ga0307416_100523239 | 3300032002 | Bacteria | 1255 |
| 371 | Ga0307416_101860919 | 3300032002 | Unclassified | 705 |
| 372 | Ga0307416_102368506 | 3300032002 | Bacteria | 631 |
| 373 | Ga0307416_103183564 | 3300032002 | Bacteria | 549 |
| 374 | Ga0307414_10497364 | 3300032004 | Unclassified | 1078 |
| 375 | Ga0307411_10234023 | 3300032005 | Unclassified | 1434 |
| 376 | Ga0307415_100040624 | 3300032126 | Bacteria | 3083 |
| 377 | Ga0307415_100042533 | 3300032126 | Bacteria | 3024 |
| 378 | Ga0307415_101851041 | 3300032126 | Unclassified | 585 |
| 379 | Ga0307415_102011585 | 3300032126 | Bacteria | 563 |
| 380 | Ga0316583_10012329 | 3300032133 | Bacteria | 3084 |
| 381 | Ga0373926_0282798 | 3300035083 | Bacteria | 646 |
| 382 | Ga0373936_0143158 | 3300035113 | Bacteria | 1033 |
| 383 | Ga0373939_0010691 | 3300035114 | Bacteria | 2302 |
| 384 | Ga0373941_0066602 | 3300035115 | Bacteria | 1186 |
| 385 | Ga0373945_0056063 | 3300035116 | Bacteria | 1461 |
| 386 | Ga0373954_0008438 | 3300035118 | Unclassified | 4520 |
| 387 | Ga0373946_0350943 | 3300035171 | Bacteria | 738 |
| 388 | Ga0373962_0017216 | 3300035242 | Unclassified | 1872 |
| 389 | Ga0316574_0060258 | 3300035398 | Bacteria | 2382 |
| 390 | Ga0316574_0150782 | 3300035398 | Bacteria | 1498 |
| 391 | Ga0373924_0242837 | 3300035410 | Archaea | 797 |
| 392 | Ga0373931_0219822 | 3300035691 | Unclassified | 1143 |
| 393 | Ga0373935_1249176 | 3300035692 | Bacteria | 554 |
| 394 | Ga0373927_0000014 | 3300035695 | Bacteria | 156951 |
| 395 | Ga0373937_1150248 | 3300036401 | Bacteria | 725 |
| 396 | Ga0316582_0712445 | 3300036647 | Unclassified | 689 |
| 397 | Ga0373925_0521991 | 3300037068 | Bacteria | 976 |
| 398 | Ga0395901_0024236 | 3300038443 | Bacteria | 6226 |
| 399 | Ga0439466_0094162 | 3300041411 | Bacteria | 938 |
| 400 | Ga0451802_1162171 | 3300041460 | Bacteria | 513 |
| 401 | Ga0451807_0831768 | 3300041486 | Unclassified | 664 |
| 402 | Ga0451839_1096332 | 3300041496 | Bacteria | 576 |
| 403 | Ga0451839_1257871 | 3300041496 | Bacteria | 848 |
| 404 | Ga0451843_1176553 | 3300041509 | Bacteria | 964 |
| 405 | Ga0451853_2341168 | 3300041512 | Bacteria | 1117 |
| 406 | Ga0450903_016733 | 3300042138 | Bacteria | 1150 |
| 407 | Ga0450910_003647 | 3300042147 | Bacteria | 2052 |
| 408 | Ga0439446_0101619 | 3300042156 | Bacteria | 910 |
| 409 | Ga0439458_0041328 | 3300042157 | Bacteria | 1120 |
| 410 | Ga0439434_0020185 | 3300042435 | Bacteria | 2000 |
| 411 | Ga0439460_0110536 | 3300042461 | Bacteria | 891 |
| 412 | Ga0450916_049755 | 3300042530 | Bacteria | 658 |
| 413 | Ga0466963_0989970 | 3300044694 | Bacteria | 592 |
| 414 | Ga0453684_0419249 | 3300044712 | Bacteria | 1496 |
| 415 | Ga0466960_0092415 | 3300044901 | Bacteria | 1545 |
| 416 | Ga0451576_0291608 | 3300045051 | Bacteria | 1706 |
| 417 | Ga0466967_1367096 | 3300045976 | Bacteria | 705 |
| 418 | Ga0495629_0247181 | 3300046459 | Bacteria | 1228 |
| 419 | Ga0495641_0065719 | 3300046461 | Bacteria | 1633 |
| 420 | Ga0495628_0679114 | 3300046516 | Bacteria | 729 |
| 421 | Ga0495628_0888906 | 3300046516 | Bacteria | 619 |
| 422 | Ga0495652_0518768 | 3300046529 | Bacteria | 824 |
| 423 | Ga0495652_0989004 | 3300046529 | Bacteria | 551 |
| 424 | Ga0495667_0206015 | 3300046559 | Bacteria | 1258 |
| 425 | Ga0495635_0332941 | 3300046663 | Bacteria | 1015 |
| 426 | Ga0495658_0218813 | 3300046683 | Unclassified | 1192 |
| 427 | Ga0495624_0322833 | 3300046690 | Bacteria | 930 |
| 428 | Ga0495674_0202973 | 3300047319 | Bacteria | 1644 |
| 429 | Ga0495676_0312067 | 3300047321 | Unclassified | 1058 |
| 430 | Ga0496101_0366095 | 3300048904 | Bacteria | 1134 |
| 431 | Ga0496102_0072109 | 3300048905 | Bacteria | 3173 |
| 432 | Ga0496102_0171063 | 3300048905 | Bacteria | 2045 |
| 433 | Ga0496102_0275093 | 3300048905 | Unclassified | 1587 |
| 434 | Ga0496102_0292077 | 3300048905 | Bacteria | 1536 |
| 435 | Ga0496102_0861838 | 3300048905 | Unclassified | 828 |
| 436 | Ga0496103_0004894 | 3300048906 | Bacteria | 8084 |
| 437 | Ga0496104_0009047 | 3300048907 | Bacteria | 8855 |
| 438 | Ga0496104_0061252 | 3300048907 | Bacteria | 3567 |
| 439 | Ga0496104_0262077 | 3300048907 | Bacteria | 1641 |
| 440 | Ga0496105_0079524 | 3300048908 | Bacteria | 2707 |
| 441 | Ga0496105_0171309 | 3300048908 | Bacteria | 1779 |
| 442 | Ga0496106_0262711 | 3300048909 | Unclassified | 1381 |
| 443 | Ga0496107_0117330 | 3300048910 | Bacteria | 1960 |
| 444 | Ga0496107_0385928 | 3300048910 | Bacteria | 1042 |
| 445 | Ga0496108_0019232 | 3300048911 | Bacteria | 5606 |
| 446 | Ga0496108_0079315 | 3300048911 | Bacteria | 2779 |
| 447 | Ga0496108_0097111 | 3300048911 | Bacteria | 2510 |
| 448 | Ga0496109_0017002 | 3300048912 | Bacteria | 6367 |
| 449 | Ga0496109_0018489 | 3300048912 | Bacteria | 6122 |
| 450 | Ga0496109_0054234 | 3300048912 | Bacteria | 3657 |
| 451 | Ga0496109_0108621 | 3300048912 | Bacteria | 2578 |
| 452 | Ga0496109_0654758 | 3300048912 | Unclassified | 987 |
| 453 | Ga0496110_0083658 | 3300048913 | Bacteria | 2847 |
| 454 | Ga0496110_0256613 | 3300048913 | Bacteria | 1591 |
| 455 | Ga0496110_0670808 | 3300048913 | Bacteria | 937 |
| 456 | Ga0496111_0095920 | 3300048914 | Bacteria | 2176 |
| 457 | Ga0496111_0171823 | 3300048914 | Bacteria | 1610 |
| 458 | Ga0496112_0079131 | 3300048915 | Bacteria | 3251 |
| 459 | Ga0496112_0101512 | 3300048915 | Bacteria | 2846 |
| 460 | Ga0496113_0062223 | 3300048916 | Bacteria | 2818 |
| 461 | Ga0496113_0065947 | 3300048916 | Bacteria | 2741 |
| 462 | Ga0496113_0135385 | 3300048916 | Bacteria | 1935 |
| 463 | Ga0496114_0131403 | 3300048917 | Bacteria | 2162 |
| 464 | Ga0496114_0147108 | 3300048917 | Bacteria | 2043 |
| 465 | Ga0501031_0009488 | 3300049568 | Bacteria | 6331 |
| 466 | Ga0501031_0020611 | 3300049568 | Bacteria | 4299 |
| 467 | Ga0501031_0071707 | 3300049568 | Bacteria | 2256 |
| 468 | Ga0501031_0158439 | 3300049568 | Bacteria | 1480 |
| 469 | Ga0501031_0189547 | 3300049568 | Bacteria | 1343 |
| 470 | Ga0501031_0358283 | 3300049568 | Bacteria | 944 |
| 471 | Ga0501032_0252912 | 3300049569 | Bacteria | 1143 |
| 472 | Ga0501033_0051727 | 3300049570 | Bacteria | 3045 |
| 473 | Ga0501036_0005132 | 3300049572 | Bacteria | 10581 |
| 474 | Ga0501036_0446681 | 3300049572 | Bacteria | 1077 |
| 475 | Ga0501036_1267078 | 3300049572 | Bacteria | 600 |
| 476 | Ga0501037_0028128 | 3300049573 | Bacteria | 4153 |
| 477 | Ga0501037_0078142 | 3300049573 | Bacteria | 2401 |
| 478 | Ga0501037_0479361 | 3300049573 | Bacteria | 846 |
| 479 | Ga0501038_0004000 | 3300049574 | Bacteria | 13689 |
| 480 | Ga0501038_0014155 | 3300049574 | Bacteria | 7268 |
| 481 | Ga0501038_0137375 | 3300049574 | Bacteria | 2002 |
| 482 | Ga0501039_0005881 | 3300049575 | Bacteria | 9292 |
| 483 | Ga0501039_0058790 | 3300049575 | Bacteria | 2978 |
| 484 | Ga0501039_0328519 | 3300049575 | Bacteria | 1202 |
| 485 | Ga0501039_0748485 | 3300049575 | Unclassified | 763 |
| 486 | Ga0501040_0010408 | 3300049576 | Bacteria | 6081 |
| 487 | Ga0501040_0046352 | 3300049576 | Bacteria | 2967 |
| 488 | Ga0501040_0053961 | 3300049576 | Bacteria | 2755 |
| 489 | Ga0501040_0164984 | 3300049576 | Bacteria | 1567 |
| 490 | Ga0501040_0318087 | 3300049576 | Bacteria | 1113 |
| 491 | Ga0501041_0009393 | 3300049577 | Bacteria | 5766 |
| 492 | Ga0501041_0019958 | 3300049577 | Bacteria | 4005 |
| 493 | Ga0501041_0028013 | 3300049577 | Bacteria | 3397 |
| 494 | Ga0501042_0051113 | 3300049578 | Bacteria | 2948 |
| 495 | Ga0501042_0368749 | 3300049578 | Bacteria | 1039 |
| 496 | Ga0501042_0394475 | 3300049578 | Unclassified | 1002 |
| 497 | Ga0501042_0433863 | 3300049578 | Bacteria | 952 |
| 498 | Ga0501042_0698495 | 3300049578 | Bacteria | 738 |
| 499 | Ga0501043_0013383 | 3300049579 | Bacteria | 6416 |
| 500 | Ga0501043_0145598 | 3300049579 | Bacteria | 1855 |
| 501 | Ga0501046_0017688 | 3300049580 | Bacteria | 5945 |
| 502 | Ga0501046_0033725 | 3300049580 | Bacteria | 4134 |
| 503 | Ga0501048_0006114 | 3300049582 | Bacteria | 9174 |
| 504 | Ga0501048_0049081 | 3300049582 | Bacteria | 3009 |
| 505 | Ga0501048_0066054 | 3300049582 | Bacteria | 2557 |
| 506 | Ga0501048_0573936 | 3300049582 | Bacteria | 809 |
| 507 | Ga0501048_0686628 | 3300049582 | Bacteria | 735 |
| 508 | Ga0501067_0022093 | 3300049583 | Bacteria | 3521 |
| 509 | Ga0501067_0036428 | 3300049583 | Bacteria | 2731 |
| 510 | Ga0501067_0166275 | 3300049583 | Bacteria | 1228 |
| 511 | Ga0501068_0163099 | 3300049584 | Unclassified | 1405 |
| 512 | Ga0501068_0420009 | 3300049584 | Unclassified | 864 |
| 513 | Ga0501069_0003512 | 3300049585 | Bacteria | 8073 |
| 514 | Ga0501069_0083564 | 3300049585 | Bacteria | 1800 |
| 515 | Ga0501069_0105549 | 3300049585 | Bacteria | 1601 |
| 516 | Ga0501069_0182675 | 3300049585 | Bacteria | 1212 |
| 517 | Ga0501069_0353108 | 3300049585 | Unclassified | 867 |
| 518 | Ga0501069_0360162 | 3300049585 | Bacteria | 858 |
| 519 | Ga0501069_0377606 | 3300049585 | Bacteria | 837 |
| 520 | Ga0501070_0035779 | 3300049586 | Bacteria | 4147 |
| 521 | Ga0501070_0120340 | 3300049586 | Bacteria | 2170 |
| 522 | Ga0501070_0559303 | 3300049586 | Bacteria | 915 |
| 523 | Ga0501071_0000870 | 3300049587 | Bacteria | 16286 |
| 524 | Ga0501071_0025657 | 3300049587 | Bacteria | 4130 |
| 525 | Ga0501071_0062316 | 3300049587 | Bacteria | 2702 |
| 526 | Ga0501071_0135318 | 3300049587 | Bacteria | 1833 |
| 527 | Ga0501071_0350393 | 3300049587 | Bacteria | 1124 |
| 528 | Ga0501071_0711925 | 3300049587 | Bacteria | 773 |
| 529 | Ga0501072_0001387 | 3300049588 | Bacteria | 18223 |
| 530 | Ga0501072_0043147 | 3300049588 | Bacteria | 3544 |
| 531 | Ga0501072_0078047 | 3300049588 | Bacteria | 2622 |
| 532 | Ga0501072_0104654 | 3300049588 | Bacteria | 2250 |
| 533 | Ga0501072_0222517 | 3300049588 | Bacteria | 1504 |
| 534 | Ga0501072_0335590 | 3300049588 | Unclassified | 1201 |
| 535 | Ga0501073_0105467 | 3300049589 | Bacteria | 1956 |
| 536 | Ga0501073_0315394 | 3300049589 | Unclassified | 1079 |
| 537 | Ga0501074_0001365 | 3300049590 | Bacteria | 16201 |
| 538 | Ga0501074_0023832 | 3300049590 | Bacteria | 4449 |
| 539 | Ga0501074_0067445 | 3300049590 | Bacteria | 2573 |
| 540 | Ga0501074_0079410 | 3300049590 | Bacteria | 2354 |
| 541 | Ga0501075_0008045 | 3300049591 | Bacteria | 7331 |
| 542 | Ga0501075_0113293 | 3300049591 | Bacteria | 2062 |
| 543 | Ga0501075_0221071 | 3300049591 | Bacteria | 1445 |
| 544 | Ga0501075_0242029 | 3300049591 | Bacteria | 1375 |
| 545 | Ga0501075_0262735 | 3300049591 | Unclassified | 1316 |
| 546 | Ga0501075_0508110 | 3300049591 | Bacteria | 919 |
| 547 | Ga0501075_0521804 | 3300049591 | Unclassified | 906 |
| 548 | Ga0501075_0522856 | 3300049591 | Bacteria | 905 |
| 549 | Ga0501076_0002459 | 3300049592 | Bacteria | 12727 |
| 550 | Ga0501076_0059326 | 3300049592 | Bacteria | 3043 |
| 551 | Ga0501076_0145387 | 3300049592 | Unclassified | 1928 |
| 552 | Ga0501076_0157175 | 3300049592 | Bacteria | 1851 |
| 553 | Ga0501076_0172073 | 3300049592 | Bacteria | 1765 |
| 554 | Ga0501076_0335519 | 3300049592 | Bacteria | 1240 |
| 555 | Ga0501077_0003242 | 3300049593 | Bacteria | 9801 |
| 556 | Ga0501077_0014521 | 3300049593 | Bacteria | 4949 |
| 557 | Ga0501077_0060899 | 3300049593 | Bacteria | 2395 |
| 558 | Ga0501077_0224965 | 3300049593 | Unclassified | 1193 |
| 559 | Ga0501209_162656 | 3300049656 | Bacteria | 676 |
| 560 | Ga0501079_0009995 | 3300049741 | Bacteria | 7202 |
| 561 | Ga0501079_0053262 | 3300049741 | Bacteria | 3121 |
| 562 | Ga0501079_0058234 | 3300049741 | Bacteria | 2981 |
| 563 | Ga0501079_0094329 | 3300049741 | Bacteria | 2319 |
| 564 | Ga0501079_0245805 | 3300049741 | Bacteria | 1398 |
| 565 | Ga0501080_0032123 | 3300049742 | Bacteria | 4894 |
| 566 | Ga0501080_0124560 | 3300049742 | Bacteria | 2387 |
| 567 | Ga0501080_0196191 | 3300049742 | Bacteria | 1854 |
| 568 | Ga0501081_0005294 | 3300049743 | Bacteria | 8318 |
| 569 | Ga0501081_0220729 | 3300049743 | Bacteria | 1378 |
| 570 | Ga0501081_0259953 | 3300049743 | Bacteria | 1268 |
| 571 | Ga0501081_0449271 | 3300049743 | Bacteria | 957 |
| 572 | Ga0501081_0586219 | 3300049743 | Unclassified | 834 |
| 573 | Ga0501083_0048629 | 3300049744 | Unclassified | 2862 |
| 574 | Ga0501083_0087933 | 3300049744 | Bacteria | 2054 |
| 575 | Ga0501035_0073771 | 3300049822 | Bacteria | 3019 |
| 576 | Ga0501035_0235754 | 3300049822 | Unclassified | 1558 |
| 577 | Ga0501044_0130530 | 3300049823 | Bacteria | 2507 |
| 578 | Ga0501044_0590933 | 3300049823 | Bacteria | 1004 |
| 579 | Ga0501045_0002473 | 3300049824 | Bacteria | 12565 |
| 580 | Ga0501045_0011588 | 3300049824 | Bacteria | 6192 |
| 581 | Ga0501045_0033475 | 3300049824 | Bacteria | 3726 |
| 582 | Ga0501045_0194558 | 3300049824 | Bacteria | 1511 |
| 583 | Ga0501045_0263745 | 3300049824 | Bacteria | 1282 |
| 584 | nmdc:mga0yw44_12985_c1 | 3300050492 | Unclassified | 4366 |
| 585 | nmdc:mga0yw44_675702_c1 | 3300050492 | Unclassified | 702 |
| 586 | nmdc:mga0k408_4293_c1 | 3300050493 | Archaea | 7569 |
| 587 | nmdc:mga05p37_20144_c1 | 3300050507 | Bacteria | 8073 |
| 588 | nmdc:mga05p37_239537_c1 | 3300050507 | Bacteria | 2182 |
| 589 | nmdc:mga05p37_449025_c1 | 3300050507 | Unclassified | 1493 |
| 590 | nmdc:mga05p37_562877_c1 | 3300050507 | Unclassified | 1295 |
| 591 | nmdc:mga05p37_578899_c1 | 3300050507 | Bacteria | 1272 |
| 592 | nmdc:mga09592_1201878_c1 | 3300050508 | Unclassified | 626 |
| 593 | nmdc:mga06r32_1343550_c1 | 3300050510 | Bacteria | 658 |
| 594 | nmdc:mga06r32_912777_c1 | 3300050510 | Bacteria | 834 |
| 595 | nmdc:mga08y16_1482508_c1 | 3300050511 | Unclassified | 639 |
| 596 | nmdc:mga08y16_158637_c1 | 3300050511 | Bacteria | 2351 |
| 597 | nmdc:mga08y16_40112_c1 | 3300050511 | Bacteria | 4909 |
| 598 | nmdc:mga08y16_467134_c1 | 3300050511 | Unclassified | 1285 |
| 599 | nmdc:mga08y16_95719_c1 | 3300050511 | Bacteria | 3093 |
| 600 | nmdc:mga08x19_334086_c1 | 3300050514 | Bacteria | 1056 |
| 601 | nmdc:mga0a205_418650_c1 | 3300050515 | Unclassified | 1202 |
| 602 | nmdc:mga0a205_49481_c1 | 3300050515 | Bacteria | 4057 |
| 603 | Ga0495601_0157190 | 3300053077 | Bacteria | 1485 |
| 604 | Ga0495601_0243545 | 3300053077 | Bacteria | 1174 |
| 605 | Ga0495601_0324679 | 3300053077 | Bacteria | 1002 |
| 606 | Ga0495612_0047168 | 3300053078 | Unclassified | 1765 |
| 607 | Ga0495619_0059363 | 3300053085 | Bacteria | 2541 |
| 608 | Ga0495619_0274633 | 3300053085 | Bacteria | 1168 |
| 609 | Ga0501084_0002117 | 3300054114 | Bacteria | 15865 |
| 610 | Ga0501084_0089499 | 3300054114 | Bacteria | 2584 |
| 611 | Ga0501084_0242430 | 3300054114 | Bacteria | 1521 |
| 612 | Ga0590071_003513 | 3300059421 | Bacteria | 3847 |
| 613 | Ga0501082_0004281 | 3300060353 | Bacteria | 12483 |
| 614 | Ga0501082_0152458 | 3300060353 | Bacteria | 2008 |
| 615 | Ga0501082_0194535 | 3300060353 | Bacteria | 1764 |
| 616 | Ga0501082_0207997 | 3300060353 | Bacteria | 1702 |
| 617 | Ga0501082_0218876 | 3300060353 | Bacteria | 1657 |
| 618 | Ga0501082_0642884 | 3300060353 | Bacteria | 928 |
| 619 | Ga0501082_0824320 | 3300060353 | Unclassified | 812 |
| 620 | Ga0501082_0894375 | 3300060353 | Unclassified | 777 |
| 621 | Ga0530510_0005043 | 3300061734 | Bacteria | 9111 |
| 622 | Ga0530510_0010637 | 3300061734 | Bacteria | 6452 |
| 623 | Ga0530510_0015303 | 3300061734 | Bacteria | 5420 |
| 624 | Ga0530510_0016613 | 3300061734 | Bacteria | 5211 |
| 625 | Ga0530510_0044381 | 3300061734 | Bacteria | 3212 |
| 626 | Ga0530510_0134757 | 3300061734 | Bacteria | 1818 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005444 | Ga0070694_101191638 | Ga0070694_1011916381 | 159 |
| 2 | 3300005545 | Ga0070695_100554025 | Ga0070695_1005540252 | 159 |
| 3 | 3300028563 | Ga0265319_1113762 | Ga0265319_11137621 | 159 |
| 4 | 3300005616 | Ga0068852_100030876 | Ga0068852_1000308762 | 161 |
| 5 | 3300038443 | Ga0395901_0024236 | Ga0395901_0024236_4385_4879 | 161 |
| 6 | 3300045976 | Ga0466967_1367096 | Ga0466967_1367096_17_508 | 161 |
| 7 | 3300005366 | Ga0070659_100538060 | Ga0070659_1005380602 | 162 |
| 8 | 3300005539 | Ga0068853_101503875 | Ga0068853_1015038751 | 162 |
| 9 | 3300006038 | Ga0075365_10002896 | Ga0075365_100028966 | 162 |
| 10 | 3300006051 | Ga0075364_10003417 | Ga0075364_100034172 | 162 |
| 11 | 3300009011 | Ga0105251_10230282 | Ga0105251_102302821 | 162 |
| 12 | 3300036401 | Ga0373937_1150248 | Ga0373937_1150248_57_548 | 162 |
| 13 | 3300049568 | Ga0501031_0009488 | Ga0501031_0009488_1813_2301 | 162 |
| 14 | 3300049572 | Ga0501036_0005132 | Ga0501036_0005132_5160_5648 | 162 |
| 15 | 3300049573 | Ga0501037_0028128 | Ga0501037_0028128_1445_1933 | 162 |
| 16 | 3300049574 | Ga0501038_0004000 | Ga0501038_0004000_3923_4411 | 162 |
| 17 | 3300049575 | Ga0501039_0005881 | Ga0501039_0005881_5139_5627 | 162 |
| 18 | 3300049576 | Ga0501040_0010408 | Ga0501040_0010408_2444_2932 | 162 |
| 19 | 3300049577 | Ga0501041_0009393 | Ga0501041_0009393_5001_5489 | 162 |
| 20 | 3300049578 | Ga0501042_0394475 | Ga0501042_0394475_465_953 | 162 |
| 21 | 3300049579 | Ga0501043_0013383 | Ga0501043_0013383_3740_4228 | 162 |
| 22 | 3300049580 | Ga0501046_0017688 | Ga0501046_0017688_2156_2644 | 162 |
| 23 | 3300049582 | Ga0501048_0006114 | Ga0501048_0006114_5409_5897 | 162 |
| 24 | 3300049584 | Ga0501068_0420009 | Ga0501068_0420009_64_552 | 162 |
| 25 | 3300049585 | Ga0501069_0083564 | Ga0501069_0083564_142_630 | 162 |
| 26 | 3300049587 | Ga0501071_0000870 | Ga0501071_0000870_2358_2846 | 162 |
| 27 | 3300049588 | Ga0501072_0001387 | Ga0501072_0001387_6820_7308 | 162 |
| 28 | 3300049589 | Ga0501073_0105467 | Ga0501073_0105467_1094_1582 | 162 |
| 29 | 3300049590 | Ga0501074_0001365 | Ga0501074_0001365_8085_8573 | 162 |
| 30 | 3300049591 | Ga0501075_0008045 | Ga0501075_0008045_143_631 | 162 |
| 31 | 3300049592 | Ga0501076_0002459 | Ga0501076_0002459_5172_5660 | 162 |
| 32 | 3300049593 | Ga0501077_0003242 | Ga0501077_0003242_4646_5134 | 162 |
| 33 | 3300049741 | Ga0501079_0009995 | Ga0501079_0009995_1882_2370 | 162 |
| 34 | 3300049742 | Ga0501080_0124560 | Ga0501080_0124560_176_664 | 162 |
| 35 | 3300049743 | Ga0501081_0005294 | Ga0501081_0005294_272_760 | 162 |
| 36 | 3300049744 | Ga0501083_0048629 | Ga0501083_0048629_558_1046 | 162 |
| 37 | 3300049822 | Ga0501035_0235754 | Ga0501035_0235754_601_1089 | 162 |
| 38 | 3300049824 | Ga0501045_0002473 | Ga0501045_0002473_7833_8321 | 162 |
| 39 | 3300050492 | nmdc:mga0yw44_12985_c1 | nmdc:mga0yw44_12985_c1_2537_3034 | 162 |
| 40 | 3300050493 | nmdc:mga0k408_4293_c1 | nmdc:mga0k408_4293_c1_389_886 | 162 |
| 41 | 3300054114 | Ga0501084_0002117 | Ga0501084_0002117_7873_8361 | 162 |
| 42 | 3300060353 | Ga0501082_0004281 | Ga0501082_0004281_4921_5409 | 162 |
| 43 | 3300061734 | Ga0530510_0010637 | Ga0530510_0010637_5824_6312 | 162 |
| 44 | 3300001991 | JGI24743J22301_10046962 | JGI24743J22301_100469622 | 163 |
| 45 | 3300002076 | JGI24749J21850_1020202 | JGI24749J21850_10202022 | 163 |
| 46 | 3300005293 | Ga0065715_10509233 | Ga0065715_105092331 | 163 |
| 47 | 3300005295 | Ga0065707_10375342 | Ga0065707_103753421 | 163 |
| 48 | 3300005327 | Ga0070658_10241879 | Ga0070658_102418792 | 163 |
| 49 | 3300005328 | Ga0070676_10111411 | Ga0070676_101114112 | 163 |
| 50 | 3300005328 | Ga0070676_10685557 | Ga0070676_106855571 | 163 |
| 51 | 3300005329 | Ga0070683_100156938 | Ga0070683_1001569383 | 163 |
| 52 | 3300005329 | Ga0070683_100863814 | Ga0070683_1008638141 | 163 |
| 53 | 3300005329 | Ga0070683_100901499 | Ga0070683_1009014992 | 163 |
| 54 | 3300005330 | Ga0070690_100014092 | Ga0070690_1000140924 | 163 |
| 55 | 3300005331 | Ga0070670_100089777 | Ga0070670_1000897772 | 163 |
| 56 | 3300005331 | Ga0070670_100311092 | Ga0070670_1003110922 | 163 |
| 57 | 3300005334 | Ga0068869_100030300 | Ga0068869_1000303005 | 163 |
| 58 | 3300005334 | Ga0068869_100576464 | Ga0068869_1005764642 | 163 |
| 59 | 3300005335 | Ga0070666_10394560 | Ga0070666_103945602 | 163 |
| 60 | 3300005336 | Ga0070680_100436709 | Ga0070680_1004367092 | 163 |
| 61 | 3300005337 | Ga0070682_100161518 | Ga0070682_1001615182 | 163 |
| 62 | 3300005337 | Ga0070682_100939009 | Ga0070682_1009390091 | 163 |
| 63 | 3300005338 | Ga0068868_100491901 | Ga0068868_1004919012 | 163 |
| 64 | 3300005338 | Ga0068868_100548167 | Ga0068868_1005481672 | 163 |
| 65 | 3300005339 | Ga0070660_100066802 | Ga0070660_1000668021 | 163 |
| 66 | 3300005339 | Ga0070660_100325088 | Ga0070660_1003250882 | 163 |
| 67 | 3300005340 | Ga0070689_100003459 | Ga0070689_1000034597 | 163 |
| 68 | 3300005341 | Ga0070691_10003464 | Ga0070691_100034644 | 163 |
| 69 | 3300005343 | Ga0070687_100000829 | Ga0070687_1000008293 | 163 |
| 70 | 3300005343 | Ga0070687_100460365 | Ga0070687_1004603651 | 163 |
| 71 | 3300005344 | Ga0070661_100600595 | Ga0070661_1006005952 | 163 |
| 72 | 3300005345 | Ga0070692_10327643 | Ga0070692_103276432 | 163 |
| 73 | 3300005345 | Ga0070692_10383334 | Ga0070692_103833341 | 163 |
| 74 | 3300005347 | Ga0070668_100074006 | Ga0070668_1000740062 | 163 |
| 75 | 3300005347 | Ga0070668_100338209 | Ga0070668_1003382092 | 163 |
| 76 | 3300005353 | Ga0070669_100129992 | Ga0070669_1001299922 | 163 |
| 77 | 3300005353 | Ga0070669_100817082 | Ga0070669_1008170821 | 163 |
| 78 | 3300005354 | Ga0070675_100148623 | Ga0070675_1001486233 | 163 |
| 79 | 3300005355 | Ga0070671_100343230 | Ga0070671_1003432302 | 163 |
| 80 | 3300005355 | Ga0070671_100572225 | Ga0070671_1005722252 | 163 |
| 81 | 3300005356 | Ga0070674_100006333 | Ga0070674_1000063335 | 163 |
| 82 | 3300005364 | Ga0070673_100002033 | Ga0070673_1000020335 | 163 |
| 83 | 3300005365 | Ga0070688_100002572 | Ga0070688_1000025726 | 163 |
| 84 | 3300005365 | Ga0070688_100597440 | Ga0070688_1005974401 | 163 |
| 85 | 3300005366 | Ga0070659_100008430 | Ga0070659_1000084306 | 163 |
| 86 | 3300005366 | Ga0070659_100395402 | Ga0070659_1003954022 | 163 |
| 87 | 3300005366 | Ga0070659_100504916 | Ga0070659_1005049162 | 163 |
| 88 | 3300005406 | Ga0070703_10009342 | Ga0070703_100093422 | 163 |
| 89 | 3300005438 | Ga0070701_10040831 | Ga0070701_100408313 | 163 |
| 90 | 3300005440 | Ga0070705_100010402 | Ga0070705_1000104025 | 163 |
| 91 | 3300005440 | Ga0070705_100012300 | Ga0070705_1000123002 | 163 |
| 92 | 3300005440 | Ga0070705_100016836 | Ga0070705_1000168362 | 163 |
| 93 | 3300005440 | Ga0070705_100119196 | Ga0070705_1001191963 | 163 |
| 94 | 3300005441 | Ga0070700_100071854 | Ga0070700_1000718543 | 163 |
| 95 | 3300005441 | Ga0070700_100129481 | Ga0070700_1001294812 | 163 |
| 96 | 3300005441 | Ga0070700_100488357 | Ga0070700_1004883572 | 163 |
| 97 | 3300005444 | Ga0070694_100006418 | Ga0070694_1000064185 | 163 |
| 98 | 3300005444 | Ga0070694_100068632 | Ga0070694_1000686322 | 163 |
| 99 | 3300005444 | Ga0070694_100124864 | Ga0070694_1001248642 | 163 |
| 100 | 3300005444 | Ga0070694_100166317 | Ga0070694_1001663172 | 163 |
| 101 | 3300005444 | Ga0070694_100325647 | Ga0070694_1003256471 | 163 |
| 102 | 3300005444 | Ga0070694_100452547 | Ga0070694_1004525472 | 163 |
| 103 | 3300005445 | Ga0070708_100002789 | Ga0070708_1000027899 | 163 |
| 104 | 3300005445 | Ga0070708_100051497 | Ga0070708_1000514972 | 163 |
| 105 | 3300005455 | Ga0070663_100042986 | Ga0070663_1000429863 | 163 |
| 106 | 3300005455 | Ga0070663_100817833 | Ga0070663_1008178331 | 163 |
| 107 | 3300005456 | Ga0070678_100306182 | Ga0070678_1003061822 | 163 |
| 108 | 3300005456 | Ga0070678_101091679 | Ga0070678_1010916792 | 163 |
| 109 | 3300005457 | Ga0070662_100231572 | Ga0070662_1002315723 | 163 |
| 110 | 3300005458 | Ga0070681_10348031 | Ga0070681_103480312 | 163 |
| 111 | 3300005458 | Ga0070681_10454317 | Ga0070681_104543171 | 163 |
| 112 | 3300005458 | Ga0070681_10512080 | Ga0070681_105120801 | 163 |
| 113 | 3300005458 | Ga0070681_10651383 | Ga0070681_106513831 | 163 |
| 114 | 3300005458 | Ga0070681_10833048 | Ga0070681_108330482 | 163 |
| 115 | 3300005459 | Ga0068867_100018046 | Ga0068867_1000180465 | 163 |
| 116 | 3300005466 | Ga0070685_10011431 | Ga0070685_100114313 | 163 |
| 117 | 3300005467 | Ga0070706_100000374 | Ga0070706_10000037422 | 163 |
| 118 | 3300005467 | Ga0070706_100000528 | Ga0070706_10000052844 | 163 |
| 119 | 3300005467 | Ga0070706_100149509 | Ga0070706_1001495092 | 163 |
| 120 | 3300005468 | Ga0070707_100004216 | Ga0070707_10000421610 | 163 |
| 121 | 3300005468 | Ga0070707_100096671 | Ga0070707_1000966712 | 163 |
| 122 | 3300005471 | Ga0070698_100316825 | Ga0070698_1003168252 | 163 |
| 123 | 3300005471 | Ga0070698_100646393 | Ga0070698_1006463931 | 163 |
| 124 | 3300005518 | Ga0070699_100014846 | Ga0070699_1000148461 | 163 |
| 125 | 3300005518 | Ga0070699_100046650 | Ga0070699_1000466501 | 163 |
| 126 | 3300005518 | Ga0070699_100436108 | Ga0070699_1004361083 | 163 |
| 127 | 3300005518 | Ga0070699_100462510 | Ga0070699_1004625101 | 163 |
| 128 | 3300005518 | Ga0070699_100674512 | Ga0070699_1006745121 | 163 |
| 129 | 3300005518 | Ga0070699_101291291 | Ga0070699_1012912911 | 163 |
| 130 | 3300005530 | Ga0070679_100028396 | Ga0070679_1000283962 | 163 |
| 131 | 3300005530 | Ga0070679_100561141 | Ga0070679_1005611411 | 163 |
| 132 | 3300005530 | Ga0070679_100570255 | Ga0070679_1005702552 | 163 |
| 133 | 3300005530 | Ga0070679_101323782 | Ga0070679_1013237821 | 163 |
| 134 | 3300005535 | Ga0070684_100278410 | Ga0070684_1002784102 | 163 |
| 135 | 3300005535 | Ga0070684_100463968 | Ga0070684_1004639682 | 163 |
| 136 | 3300005536 | Ga0070697_100005120 | Ga0070697_1000051209 | 163 |
| 137 | 3300005536 | Ga0070697_100020214 | Ga0070697_1000202144 | 163 |
| 138 | 3300005536 | Ga0070697_100062839 | Ga0070697_1000628394 | 163 |
| 139 | 3300005536 | Ga0070697_100218326 | Ga0070697_1002183262 | 163 |
| 140 | 3300005536 | Ga0070697_100399139 | Ga0070697_1003991392 | 163 |
| 141 | 3300005539 | Ga0068853_100140477 | Ga0068853_1001404772 | 163 |
| 142 | 3300005539 | Ga0068853_101231188 | Ga0068853_1012311881 | 163 |
| 143 | 3300005539 | Ga0068853_101360863 | Ga0068853_1013608631 | 163 |
| 144 | 3300005545 | Ga0070695_100016070 | Ga0070695_1000160703 | 163 |
| 145 | 3300005545 | Ga0070695_100044621 | Ga0070695_1000446213 | 163 |
| 146 | 3300005545 | Ga0070695_100176304 | Ga0070695_1001763042 | 163 |
| 147 | 3300005545 | Ga0070695_100236169 | Ga0070695_1002361692 | 163 |
| 148 | 3300005546 | Ga0070696_100076132 | Ga0070696_1000761322 | 163 |
| 149 | 3300005546 | Ga0070696_100132572 | Ga0070696_1001325722 | 163 |
| 150 | 3300005547 | Ga0070693_100249941 | Ga0070693_1002499412 | 163 |
| 151 | 3300005548 | Ga0070665_100639374 | Ga0070665_1006393742 | 163 |
| 152 | 3300005549 | Ga0070704_100007204 | Ga0070704_1000072042 | 163 |
| 153 | 3300005549 | Ga0070704_100087709 | Ga0070704_1000877092 | 163 |
| 154 | 3300005549 | Ga0070704_100115718 | Ga0070704_1001157182 | 163 |
| 155 | 3300005549 | Ga0070704_100335892 | Ga0070704_1003358922 | 163 |
| 156 | 3300005549 | Ga0070704_100587702 | Ga0070704_1005877022 | 163 |
| 157 | 3300005563 | Ga0068855_100104951 | Ga0068855_1001049511 | 163 |
| 158 | 3300005577 | Ga0068857_100024638 | Ga0068857_1000246385 | 163 |
| 159 | 3300005615 | Ga0070702_100000984 | Ga0070702_1000009842 | 163 |
| 160 | 3300005616 | Ga0068852_100021181 | Ga0068852_1000211815 | 163 |
| 161 | 3300005617 | Ga0068859_100085464 | Ga0068859_1000854643 | 163 |
| 162 | 3300005617 | Ga0068859_100637390 | Ga0068859_1006373902 | 163 |
| 163 | 3300005617 | Ga0068859_100982247 | Ga0068859_1009822472 | 163 |
| 164 | 3300005618 | Ga0068864_100033660 | Ga0068864_1000336603 | 163 |
| 165 | 3300005618 | Ga0068864_101152616 | Ga0068864_1011526162 | 163 |
| 166 | 3300005718 | Ga0068866_10038039 | Ga0068866_100380392 | 163 |
| 167 | 3300005719 | Ga0068861_100583356 | Ga0068861_1005833563 | 163 |
| 168 | 3300005842 | Ga0068858_100058133 | Ga0068858_1000581333 | 163 |
| 169 | 3300005843 | Ga0068860_100183995 | Ga0068860_1001839952 | 163 |
| 170 | 3300005843 | Ga0068860_100440293 | Ga0068860_1004402932 | 163 |
| 171 | 3300005844 | Ga0068862_100046135 | Ga0068862_1000461354 | 163 |
| 172 | 3300005844 | Ga0068862_100291867 | Ga0068862_1002918673 | 163 |
| 173 | 3300005985 | Ga0081539_10010782 | Ga0081539_100107823 | 163 |
| 174 | 3300006058 | Ga0075432_10131836 | Ga0075432_101318362 | 163 |
| 175 | 3300006173 | Ga0070716_100487190 | Ga0070716_1004871902 | 163 |
| 176 | 3300006173 | Ga0070716_100526722 | Ga0070716_1005267222 | 163 |
| 177 | 3300006173 | Ga0070716_100654739 | Ga0070716_1006547392 | 163 |
| 178 | 3300006237 | Ga0097621_100216434 | Ga0097621_1002164341 | 163 |
| 179 | 3300006237 | Ga0097621_100975018 | Ga0097621_1009750183 | 163 |
| 180 | 3300006844 | Ga0075428_100769637 | Ga0075428_1007696373 | 163 |
| 181 | 3300006847 | Ga0075431_100214169 | Ga0075431_1002141692 | 163 |
| 182 | 3300006847 | Ga0075431_100229100 | Ga0075431_1002291001 | 163 |
| 183 | 3300006847 | Ga0075431_100947492 | Ga0075431_1009474922 | 163 |
| 184 | 3300006852 | Ga0075433_10129634 | Ga0075433_101296343 | 163 |
| 185 | 3300006852 | Ga0075433_10275738 | Ga0075433_102757383 | 163 |
| 186 | 3300006852 | Ga0075433_10325324 | Ga0075433_103253242 | 163 |
| 187 | 3300006871 | Ga0075434_100814863 | Ga0075434_1008148632 | 163 |
| 188 | 3300006880 | Ga0075429_100963741 | Ga0075429_1009637412 | 163 |
| 189 | 3300006881 | Ga0068865_100012709 | Ga0068865_1000127092 | 163 |
| 190 | 3300006914 | Ga0075436_100369594 | Ga0075436_1003695942 | 163 |
| 191 | 3300006931 | Ga0097620_100085471 | Ga0097620_1000854713 | 163 |
| 192 | 3300006931 | Ga0097620_100637388 | Ga0097620_1006373882 | 163 |
| 193 | 3300006931 | Ga0097620_100981930 | Ga0097620_1009819302 | 163 |
| 194 | 3300006931 | Ga0097620_101474530 | Ga0097620_1014745301 | 163 |
| 195 | 3300007076 | Ga0075435_100560275 | Ga0075435_1005602751 | 163 |
| 196 | 3300009093 | Ga0105240_10392956 | Ga0105240_103929563 | 163 |
| 197 | 3300009094 | Ga0111539_10000282 | Ga0111539_1000028245 | 163 |
| 198 | 3300009094 | Ga0111539_10008872 | Ga0111539_100088724 | 163 |
| 199 | 3300009094 | Ga0111539_10112699 | Ga0111539_101126993 | 163 |
| 200 | 3300009094 | Ga0111539_10147186 | Ga0111539_101471864 | 163 |
| 201 | 3300009094 | Ga0111539_10720575 | Ga0111539_107205751 | 163 |
| 202 | 3300009094 | Ga0111539_11892564 | Ga0111539_118925641 | 163 |
| 203 | 3300009098 | Ga0105245_10013989 | Ga0105245_100139892 | 163 |
| 204 | 3300009098 | Ga0105245_10136678 | Ga0105245_101366782 | 163 |
| 205 | 3300009098 | Ga0105245_10315057 | Ga0105245_103150572 | 163 |
| 206 | 3300009098 | Ga0105245_10424725 | Ga0105245_104247251 | 163 |
| 207 | 3300009147 | Ga0114129_10090097 | Ga0114129_100900973 | 163 |
| 208 | 3300009147 | Ga0114129_10096844 | Ga0114129_100968442 | 163 |
| 209 | 3300009147 | Ga0114129_10131066 | Ga0114129_101310662 | 163 |
| 210 | 3300009147 | Ga0114129_10184981 | Ga0114129_101849814 | 163 |
| 211 | 3300009147 | Ga0114129_10583749 | Ga0114129_105837493 | 163 |
| 212 | 3300009147 | Ga0114129_10947684 | Ga0114129_109476842 | 163 |
| 213 | 3300009148 | Ga0105243_10133193 | Ga0105243_101331933 | 163 |
| 214 | 3300009148 | Ga0105243_10163660 | Ga0105243_101636603 | 163 |
| 215 | 3300009148 | Ga0105243_10433996 | Ga0105243_104339962 | 163 |
| 216 | 3300009174 | Ga0105241_10252514 | Ga0105241_102525142 | 163 |
| 217 | 3300009174 | Ga0105241_11324039 | Ga0105241_113240391 | 163 |
| 218 | 3300009176 | Ga0105242_10440333 | Ga0105242_104403333 | 163 |
| 219 | 3300009177 | Ga0105248_10382383 | Ga0105248_103823833 | 163 |
| 220 | 3300009177 | Ga0105248_10921216 | Ga0105248_109212162 | 163 |
| 221 | 3300009545 | Ga0105237_10144150 | Ga0105237_101441503 | 163 |
| 222 | 3300009545 | Ga0105237_11395431 | Ga0105237_113954312 | 163 |
| 223 | 3300009551 | Ga0105238_10093437 | Ga0105238_100934373 | 163 |
| 224 | 3300009553 | Ga0105249_10004683 | Ga0105249_100046838 | 163 |
| 225 | 3300009553 | Ga0105249_10210713 | Ga0105249_102107132 | 163 |
| 226 | 3300009553 | Ga0105249_10222811 | Ga0105249_102228112 | 163 |
| 227 | 3300009553 | Ga0105249_10401397 | Ga0105249_104013972 | 163 |
| 228 | 3300009553 | Ga0105249_11257653 | Ga0105249_112576532 | 163 |
| 229 | 3300009553 | Ga0105249_11363206 | Ga0105249_113632062 | 163 |
| 230 | 3300010375 | Ga0105239_10038180 | Ga0105239_100381805 | 163 |
| 231 | 3300010375 | Ga0105239_10429901 | Ga0105239_104299013 | 163 |
| 232 | 3300011119 | Ga0105246_10306592 | Ga0105246_103065922 | 163 |
| 233 | 3300011119 | Ga0105246_10313786 | Ga0105246_103137863 | 163 |
| 234 | 3300011119 | Ga0105246_10407201 | Ga0105246_104072013 | 163 |
| 235 | 3300011119 | Ga0105246_11033385 | Ga0105246_110333851 | 163 |
| 236 | 3300013100 | Ga0157373_10505813 | Ga0157373_105058131 | 163 |
| 237 | 3300013296 | Ga0157374_10630779 | Ga0157374_106307792 | 163 |
| 238 | 3300013297 | Ga0157378_10069343 | Ga0157378_100693432 | 163 |
| 239 | 3300013297 | Ga0157378_10461061 | Ga0157378_104610612 | 163 |
| 240 | 3300013297 | Ga0157378_10625912 | Ga0157378_106259122 | 163 |
| 241 | 3300013306 | Ga0163162_10355703 | Ga0163162_103557033 | 163 |
| 242 | 3300013308 | Ga0157375_10317204 | Ga0157375_103172042 | 163 |
| 243 | 3300013308 | Ga0157375_10689966 | Ga0157375_106899662 | 163 |
| 244 | 3300013308 | Ga0157375_12022470 | Ga0157375_120224701 | 163 |
| 245 | 3300014325 | Ga0163163_10049588 | Ga0163163_100495883 | 163 |
| 246 | 3300014325 | Ga0163163_10218725 | Ga0163163_102187253 | 163 |
| 247 | 3300014325 | Ga0163163_10228807 | Ga0163163_102288072 | 163 |
| 248 | 3300014326 | Ga0157380_10016559 | Ga0157380_100165595 | 163 |
| 249 | 3300014326 | Ga0157380_10380583 | Ga0157380_103805832 | 163 |
| 250 | 3300014745 | Ga0157377_10001089 | Ga0157377_100010893 | 163 |
| 251 | 3300014745 | Ga0157377_10060360 | Ga0157377_100603602 | 163 |
| 252 | 3300014745 | Ga0157377_10240500 | Ga0157377_102405001 | 163 |
| 253 | 3300014968 | Ga0157379_10190614 | Ga0157379_101906143 | 163 |
| 254 | 3300014968 | Ga0157379_10289179 | Ga0157379_102891792 | 163 |
| 255 | 3300014968 | Ga0157379_10373201 | Ga0157379_103732013 | 163 |
| 256 | 3300014969 | Ga0157376_10721007 | Ga0157376_107210073 | 163 |
| 257 | 3300014969 | Ga0157376_10782660 | Ga0157376_107826601 | 163 |
| 258 | 3300017792 | Ga0163161_10109057 | Ga0163161_101090573 | 163 |
| 259 | 3300017792 | Ga0163161_10680954 | Ga0163161_106809543 | 163 |
| 260 | 3300017792 | Ga0163161_10681861 | Ga0163161_106818613 | 163 |
| 261 | 3300017792 | Ga0163161_10775744 | Ga0163161_107757441 | 163 |
| 262 | 3300020070 | Ga0206356_11066570 | Ga0206356_110665701 | 163 |
| 263 | 3300020077 | Ga0206351_10832329 | Ga0206351_108323292 | 163 |
| 264 | 3300020081 | Ga0206354_10664940 | Ga0206354_106649402 | 163 |
| 265 | 3300022467 | Ga0224712_10002139 | Ga0224712_100021392 | 163 |
| 266 | 3300025321 | Ga0207656_10205789 | Ga0207656_102057892 | 163 |
| 267 | 3300025899 | Ga0207642_10286676 | Ga0207642_102866761 | 163 |
| 268 | 3300025901 | Ga0207688_10000452 | Ga0207688_100004527 | 163 |
| 269 | 3300025903 | Ga0207680_10594878 | Ga0207680_105948783 | 163 |
| 270 | 3300025907 | Ga0207645_10061144 | Ga0207645_100611442 | 163 |
| 271 | 3300025907 | Ga0207645_10543641 | Ga0207645_105436412 | 163 |
| 272 | 3300025908 | Ga0207643_10427345 | Ga0207643_104273453 | 163 |
| 273 | 3300025908 | Ga0207643_10494022 | Ga0207643_104940222 | 163 |
| 274 | 3300025909 | Ga0207705_10668966 | Ga0207705_106689661 | 163 |
| 275 | 3300025910 | Ga0207684_10000636 | Ga0207684_1000063610 | 163 |
| 276 | 3300025910 | Ga0207684_10008151 | Ga0207684_100081515 | 163 |
| 277 | 3300025910 | Ga0207684_10009155 | Ga0207684_100091558 | 163 |
| 278 | 3300025910 | Ga0207684_10041677 | Ga0207684_100416773 | 163 |
| 279 | 3300025910 | Ga0207684_11154786 | Ga0207684_111547861 | 163 |
| 280 | 3300025911 | Ga0207654_10132183 | Ga0207654_101321832 | 163 |
| 281 | 3300025912 | Ga0207707_10105470 | Ga0207707_101054702 | 163 |
| 282 | 3300025912 | Ga0207707_10284397 | Ga0207707_102843972 | 163 |
| 283 | 3300025912 | Ga0207707_10716608 | Ga0207707_107166082 | 163 |
| 284 | 3300025912 | Ga0207707_10910477 | Ga0207707_109104771 | 163 |
| 285 | 3300025913 | Ga0207695_11120202 | Ga0207695_111202021 | 163 |
| 286 | 3300025914 | Ga0207671_10283364 | Ga0207671_102833643 | 163 |
| 287 | 3300025916 | Ga0207663_10871990 | Ga0207663_108719901 | 163 |
| 288 | 3300025917 | Ga0207660_10028234 | Ga0207660_100282342 | 163 |
| 289 | 3300025917 | Ga0207660_11214964 | Ga0207660_112149641 | 163 |
| 290 | 3300025918 | Ga0207662_10001307 | Ga0207662_1000130710 | 163 |
| 291 | 3300025919 | Ga0207657_10015330 | Ga0207657_100153305 | 163 |
| 292 | 3300025919 | Ga0207657_10213656 | Ga0207657_102136562 | 163 |
| 293 | 3300025921 | Ga0207652_10025593 | Ga0207652_100255932 | 163 |
| 294 | 3300025922 | Ga0207646_10005701 | Ga0207646_100057015 | 163 |
| 295 | 3300025922 | Ga0207646_10005912 | Ga0207646_100059123 | 163 |
| 296 | 3300025923 | Ga0207681_10056929 | Ga0207681_100569292 | 163 |
| 297 | 3300025923 | Ga0207681_10756828 | Ga0207681_107568282 | 163 |
| 298 | 3300025924 | Ga0207694_10157765 | Ga0207694_101577652 | 163 |
| 299 | 3300025926 | Ga0207659_10048570 | Ga0207659_100485703 | 163 |
| 300 | 3300025927 | Ga0207687_10022727 | Ga0207687_100227272 | 163 |
| 301 | 3300025927 | Ga0207687_10058726 | Ga0207687_100587263 | 163 |
| 302 | 3300025927 | Ga0207687_10162136 | Ga0207687_101621363 | 163 |
| 303 | 3300025932 | Ga0207690_10060829 | Ga0207690_100608293 | 163 |
| 304 | 3300025932 | Ga0207690_10110902 | Ga0207690_101109022 | 163 |
| 305 | 3300025933 | Ga0207706_10057655 | Ga0207706_100576555 | 163 |
| 306 | 3300025933 | Ga0207706_10070012 | Ga0207706_100700123 | 163 |
| 307 | 3300025934 | Ga0207686_10026237 | Ga0207686_100262372 | 163 |
| 308 | 3300025935 | Ga0207709_10400062 | Ga0207709_104000621 | 163 |
| 309 | 3300025935 | Ga0207709_10522548 | Ga0207709_105225483 | 163 |
| 310 | 3300025935 | Ga0207709_10662281 | Ga0207709_106622811 | 163 |
| 311 | 3300025936 | Ga0207670_10085430 | Ga0207670_100854302 | 163 |
| 312 | 3300025937 | Ga0207669_10037965 | Ga0207669_100379652 | 163 |
| 313 | 3300025937 | Ga0207669_10776750 | Ga0207669_107767502 | 163 |
| 314 | 3300025938 | Ga0207704_10197482 | Ga0207704_101974823 | 163 |
| 315 | 3300025938 | Ga0207704_10253151 | Ga0207704_102531511 | 163 |
| 316 | 3300025939 | Ga0207665_10217740 | Ga0207665_102177402 | 163 |
| 317 | 3300025939 | Ga0207665_10373067 | Ga0207665_103730672 | 163 |
| 318 | 3300025941 | Ga0207711_10393305 | Ga0207711_103933052 | 163 |
| 319 | 3300025942 | Ga0207689_10016068 | Ga0207689_100160685 | 163 |
| 320 | 3300025942 | Ga0207689_10382258 | Ga0207689_103822583 | 163 |
| 321 | 3300025944 | Ga0207661_10148433 | Ga0207661_101484332 | 163 |
| 322 | 3300025944 | Ga0207661_10239512 | Ga0207661_102395123 | 163 |
| 323 | 3300025944 | Ga0207661_11378328 | Ga0207661_113783281 | 163 |
| 324 | 3300025945 | Ga0207679_10547160 | Ga0207679_105471602 | 163 |
| 325 | 3300025949 | Ga0207667_10176095 | Ga0207667_101760953 | 163 |
| 326 | 3300025960 | Ga0207651_10106109 | Ga0207651_101061093 | 163 |
| 327 | 3300025961 | Ga0207712_10012939 | Ga0207712_100129393 | 163 |
| 328 | 3300025961 | Ga0207712_10152875 | Ga0207712_101528753 | 163 |
| 329 | 3300025961 | Ga0207712_10797695 | Ga0207712_107976951 | 163 |
| 330 | 3300025972 | Ga0207668_10039446 | Ga0207668_100394463 | 163 |
| 331 | 3300025981 | Ga0207640_10100267 | Ga0207640_101002672 | 163 |
| 332 | 3300026023 | Ga0207677_10087556 | Ga0207677_100875562 | 163 |
| 333 | 3300026023 | Ga0207677_10420747 | Ga0207677_104207472 | 163 |
| 334 | 3300026035 | Ga0207703_10129485 | Ga0207703_101294853 | 163 |
| 335 | 3300026067 | Ga0207678_10036007 | Ga0207678_100360074 | 163 |
| 336 | 3300026067 | Ga0207678_11076708 | Ga0207678_110767082 | 163 |
| 337 | 3300026067 | Ga0207678_11125456 | Ga0207678_111254561 | 163 |
| 338 | 3300026075 | Ga0207708_10012012 | Ga0207708_100120126 | 163 |
| 339 | 3300026075 | Ga0207708_10016501 | Ga0207708_100165013 | 163 |
| 340 | 3300026075 | Ga0207708_10177616 | Ga0207708_101776163 | 163 |
| 341 | 3300026088 | Ga0207641_10556324 | Ga0207641_105563241 | 163 |
| 342 | 3300026089 | Ga0207648_10000662 | Ga0207648_1000066230 | 163 |
| 343 | 3300026089 | Ga0207648_10872967 | Ga0207648_108729673 | 163 |
| 344 | 3300026095 | Ga0207676_10161183 | Ga0207676_101611832 | 163 |
| 345 | 3300026095 | Ga0207676_11224014 | Ga0207676_112240141 | 163 |
| 346 | 3300026116 | Ga0207674_10015884 | Ga0207674_100158842 | 163 |
| 347 | 3300026116 | Ga0207674_10035517 | Ga0207674_100355173 | 163 |
| 348 | 3300026118 | Ga0207675_100012080 | Ga0207675_1000120806 | 163 |
| 349 | 3300026118 | Ga0207675_100016431 | Ga0207675_1000164314 | 163 |
| 350 | 3300026118 | Ga0207675_100365359 | Ga0207675_1003653593 | 163 |
| 351 | 3300026121 | Ga0207683_10165482 | Ga0207683_101654823 | 163 |
| 352 | 3300026121 | Ga0207683_10291027 | Ga0207683_102910273 | 163 |
| 353 | 3300026121 | Ga0207683_10674046 | Ga0207683_106740462 | 163 |
| 354 | 3300026142 | Ga0207698_10047334 | Ga0207698_100473341 | 163 |
| 355 | 3300026142 | Ga0207698_10650570 | Ga0207698_106505702 | 163 |
| 356 | 3300027665 | Ga0209983_1048599 | Ga0209983_10485992 | 163 |
| 357 | 3300027665 | Ga0209983_1072951 | Ga0209983_10729512 | 163 |
| 358 | 3300027876 | Ga0209974_10029984 | Ga0209974_100299842 | 163 |
| 359 | 3300027907 | Ga0207428_10031535 | Ga0207428_100315355 | 163 |
| 360 | 3300027907 | Ga0207428_10034264 | Ga0207428_100342643 | 163 |
| 361 | 3300027907 | Ga0207428_10642744 | Ga0207428_106427441 | 163 |
| 362 | 3300027907 | Ga0207428_10988301 | Ga0207428_109883011 | 163 |
| 363 | 3300028379 | Ga0268266_10149676 | Ga0268266_101496762 | 163 |
| 364 | 3300028380 | Ga0268265_10640666 | Ga0268265_106406661 | 163 |
| 365 | 3300028380 | Ga0268265_11313074 | Ga0268265_113130742 | 163 |
| 366 | 3300028381 | Ga0268264_10243981 | Ga0268264_102439812 | 163 |
| 367 | 3300028381 | Ga0268264_10494354 | Ga0268264_104943541 | 163 |
| 368 | 3300028381 | Ga0268264_11612935 | Ga0268264_116129351 | 163 |
| 369 | 3300028558 | Ga0265326_10051236 | Ga0265326_100512362 | 163 |
| 370 | 3300028573 | Ga0265334_10070824 | Ga0265334_100708242 | 163 |
| 371 | 3300028577 | Ga0265318_10163811 | Ga0265318_101638111 | 163 |
| 372 | 3300028653 | Ga0265323_10076808 | Ga0265323_100768082 | 163 |
| 373 | 3300028666 | Ga0265336_10072605 | Ga0265336_100726051 | 163 |
| 374 | 3300028666 | Ga0265336_10084863 | Ga0265336_100848631 | 163 |
| 375 | 3300028800 | Ga0265338_10015195 | Ga0265338_100151956 | 163 |
| 376 | 3300028800 | Ga0265338_10745884 | Ga0265338_107458841 | 163 |
| 377 | 3300029957 | Ga0265324_10029965 | Ga0265324_100299652 | 163 |
| 378 | 3300031238 | Ga0265332_10082229 | Ga0265332_100822292 | 163 |
| 379 | 3300031240 | Ga0265320_10004262 | Ga0265320_100042625 | 163 |
| 380 | 3300031241 | Ga0265325_10058238 | Ga0265325_100582383 | 163 |
| 381 | 3300031242 | Ga0265329_10012442 | Ga0265329_100124423 | 163 |
| 382 | 3300031249 | Ga0265339_10013978 | Ga0265339_100139784 | 163 |
| 383 | 3300031250 | Ga0265331_10045383 | Ga0265331_100453833 | 163 |
| 384 | 3300031344 | Ga0265316_10052421 | Ga0265316_100524213 | 163 |
| 385 | 3300031344 | Ga0265316_10099361 | Ga0265316_100993611 | 163 |
| 386 | 3300031548 | Ga0307408_100030415 | Ga0307408_1000304153 | 163 |
| 387 | 3300031665 | Ga0316575_10083809 | Ga0316575_100838092 | 163 |
| 388 | 3300031711 | Ga0265314_10112969 | Ga0265314_101129693 | 163 |
| 389 | 3300031712 | Ga0265342_10043506 | Ga0265342_100435063 | 163 |
| 390 | 3300031824 | Ga0307413_10134844 | Ga0307413_101348443 | 163 |
| 391 | 3300031824 | Ga0307413_10406102 | Ga0307413_104061021 | 163 |
| 392 | 3300031824 | Ga0307413_10769000 | Ga0307413_107690003 | 163 |
| 393 | 3300031852 | Ga0307410_10321943 | Ga0307410_103219433 | 163 |
| 394 | 3300031901 | Ga0307406_10406795 | Ga0307406_104067953 | 163 |
| 395 | 3300031901 | Ga0307406_10460933 | Ga0307406_104609333 | 163 |
| 396 | 3300031911 | Ga0307412_10354516 | Ga0307412_103545162 | 163 |
| 397 | 3300031911 | Ga0307412_10716355 | Ga0307412_107163552 | 163 |
| 398 | 3300031911 | Ga0307412_11121454 | Ga0307412_111214541 | 163 |
| 399 | 3300031995 | Ga0307409_100019934 | Ga0307409_1000199346 | 163 |
| 400 | 3300031995 | Ga0307409_100054802 | Ga0307409_1000548023 | 163 |
| 401 | 3300031995 | Ga0307409_100092330 | Ga0307409_1000923302 | 163 |
| 402 | 3300032002 | Ga0307416_100006460 | Ga0307416_1000064607 | 163 |
| 403 | 3300032002 | Ga0307416_100322590 | Ga0307416_1003225903 | 163 |
| 404 | 3300032002 | Ga0307416_100523239 | Ga0307416_1005232392 | 163 |
| 405 | 3300032002 | Ga0307416_101860919 | Ga0307416_1018609192 | 163 |
| 406 | 3300032002 | Ga0307416_102368506 | Ga0307416_1023685061 | 163 |
| 407 | 3300032002 | Ga0307416_103183564 | Ga0307416_1031835641 | 163 |
| 408 | 3300032004 | Ga0307414_10497364 | Ga0307414_104973642 | 163 |
| 409 | 3300032005 | Ga0307411_10234023 | Ga0307411_102340233 | 163 |
| 410 | 3300032126 | Ga0307415_100040624 | Ga0307415_1000406242 | 163 |
| 411 | 3300032126 | Ga0307415_100042533 | Ga0307415_1000425333 | 163 |
| 412 | 3300032126 | Ga0307415_101851041 | Ga0307415_1018510411 | 163 |
| 413 | 3300032126 | Ga0307415_102011585 | Ga0307415_1020115851 | 163 |
| 414 | 3300032133 | Ga0316583_10012329 | Ga0316583_100123294 | 163 |
| 415 | 3300035083 | Ga0373926_0282798 | Ga0373926_0282798_38_532 | 163 |
| 416 | 3300035113 | Ga0373936_0143158 | Ga0373936_0143158_291_785 | 163 |
| 417 | 3300035114 | Ga0373939_0010691 | Ga0373939_0010691_668_1159 | 163 |
| 418 | 3300035115 | Ga0373941_0066602 | Ga0373941_0066602_80_571 | 163 |
| 419 | 3300035116 | Ga0373945_0056063 | Ga0373945_0056063_881_1375 | 163 |
| 420 | 3300035118 | Ga0373954_0008438 | Ga0373954_0008438_1599_2093 | 163 |
| 421 | 3300035171 | Ga0373946_0350943 | Ga0373946_0350943_116_610 | 163 |
| 422 | 3300035242 | Ga0373962_0017216 | Ga0373962_0017216_624_1115 | 163 |
| 423 | 3300035398 | Ga0316574_0060258 | Ga0316574_0060258_140_631 | 163 |
| 424 | 3300035398 | Ga0316574_0150782 | Ga0316574_0150782_609_1100 | 163 |
| 425 | 3300035410 | Ga0373924_0242837 | Ga0373924_0242837_101_595 | 163 |
| 426 | 3300035691 | Ga0373931_0219822 | Ga0373931_0219822_550_1041 | 163 |
| 427 | 3300035692 | Ga0373935_1249176 | Ga0373935_1249176_12_506 | 163 |
| 428 | 3300035695 | Ga0373927_0000014 | Ga0373927_0000014_59883_60377 | 163 |
| 429 | 3300036647 | Ga0316582_0712445 | Ga0316582_0712445_149_640 | 163 |
| 430 | 3300037068 | Ga0373925_0521991 | Ga0373925_0521991_91_585 | 163 |
| 431 | 3300041411 | Ga0439466_0094162 | Ga0439466_0094162_77_568 | 163 |
| 432 | 3300041460 | Ga0451802_1162171 | Ga0451802_1162171_12_503 | 163 |
| 433 | 3300041486 | Ga0451807_0831768 | Ga0451807_0831768_65_556 | 163 |
| 434 | 3300041496 | Ga0451839_1096332 | Ga0451839_1096332_68_562 | 163 |
| 435 | 3300041496 | Ga0451839_1257871 | Ga0451839_1257871_221_712 | 163 |
| 436 | 3300041509 | Ga0451843_1176553 | Ga0451843_1176553_195_686 | 163 |
| 437 | 3300041512 | Ga0451853_2341168 | Ga0451853_2341168_464_955 | 163 |
| 438 | 3300042138 | Ga0450903_016733 | Ga0450903_016733_130_621 | 163 |
| 439 | 3300042147 | Ga0450910_003647 | Ga0450910_003647_1417_1908 | 163 |
| 440 | 3300042156 | Ga0439446_0101619 | Ga0439446_0101619_206_697 | 163 |
| 441 | 3300042157 | Ga0439458_0041328 | Ga0439458_0041328_334_828 | 163 |
| 442 | 3300042435 | Ga0439434_0020185 | Ga0439434_0020185_49_546 | 163 |
| 443 | 3300042461 | Ga0439460_0110536 | Ga0439460_0110536_228_722 | 163 |
| 444 | 3300042530 | Ga0450916_049755 | Ga0450916_049755_48_539 | 163 |
| 445 | 3300044694 | Ga0466963_0989970 | Ga0466963_0989970_47_538 | 163 |
| 446 | 3300044712 | Ga0453684_0419249 | Ga0453684_0419249_606_1097 | 163 |
| 447 | 3300044901 | Ga0466960_0092415 | Ga0466960_0092415_788_1279 | 163 |
| 448 | 3300045051 | Ga0451576_0291608 | Ga0451576_0291608_913_1494 | 163 |
| 449 | 3300046459 | Ga0495629_0247181 | Ga0495629_0247181_186_677 | 163 |
| 450 | 3300046461 | Ga0495641_0065719 | Ga0495641_0065719_83_574 | 163 |
| 451 | 3300046516 | Ga0495628_0679114 | Ga0495628_0679114_147_638 | 163 |
| 452 | 3300046516 | Ga0495628_0888906 | Ga0495628_0888906_60_554 | 163 |
| 453 | 3300046529 | Ga0495652_0518768 | Ga0495652_0518768_47_538 | 163 |
| 454 | 3300046529 | Ga0495652_0989004 | Ga0495652_0989004_13_507 | 163 |
| 455 | 3300046559 | Ga0495667_0206015 | Ga0495667_0206015_285_776 | 163 |
| 456 | 3300046663 | Ga0495635_0332941 | Ga0495635_0332941_301_792 | 163 |
| 457 | 3300046683 | Ga0495658_0218813 | Ga0495658_0218813_316_810 | 163 |
| 458 | 3300046690 | Ga0495624_0322833 | Ga0495624_0322833_253_744 | 163 |
| 459 | 3300047319 | Ga0495674_0202973 | Ga0495674_0202973_275_766 | 163 |
| 460 | 3300047321 | Ga0495676_0312067 | Ga0495676_0312067_124_615 | 163 |
| 461 | 3300048904 | Ga0496101_0366095 | Ga0496101_0366095_314_805 | 163 |
| 462 | 3300048905 | Ga0496102_0072109 | Ga0496102_0072109_2387_2881 | 163 |
| 463 | 3300048905 | Ga0496102_0171063 | Ga0496102_0171063_176_667 | 163 |
| 464 | 3300048905 | Ga0496102_0275093 | Ga0496102_0275093_235_726 | 163 |
| 465 | 3300048905 | Ga0496102_0292077 | Ga0496102_0292077_894_1385 | 163 |
| 466 | 3300048905 | Ga0496102_0861838 | Ga0496102_0861838_290_781 | 163 |
| 467 | 3300048906 | Ga0496103_0004894 | Ga0496103_0004894_4108_4599 | 163 |
| 468 | 3300048907 | Ga0496104_0009047 | Ga0496104_0009047_6651_7142 | 163 |
| 469 | 3300048907 | Ga0496104_0061252 | Ga0496104_0061252_2239_2733 | 163 |
| 470 | 3300048907 | Ga0496104_0262077 | Ga0496104_0262077_241_735 | 163 |
| 471 | 3300048908 | Ga0496105_0079524 | Ga0496105_0079524_1812_2303 | 163 |
| 472 | 3300048908 | Ga0496105_0171309 | Ga0496105_0171309_400_894 | 163 |
| 473 | 3300048909 | Ga0496106_0262711 | Ga0496106_0262711_610_1101 | 163 |
| 474 | 3300048910 | Ga0496107_0117330 | Ga0496107_0117330_244_735 | 163 |
| 475 | 3300048910 | Ga0496107_0385928 | Ga0496107_0385928_16_597 | 163 |
| 476 | 3300048911 | Ga0496108_0019232 | Ga0496108_0019232_443_937 | 163 |
| 477 | 3300048911 | Ga0496108_0079315 | Ga0496108_0079315_1760_2251 | 163 |
| 478 | 3300048911 | Ga0496108_0097111 | Ga0496108_0097111_506_997 | 163 |
| 479 | 3300048912 | Ga0496109_0017002 | Ga0496109_0017002_2996_3490 | 163 |
| 480 | 3300048912 | Ga0496109_0018489 | Ga0496109_0018489_2221_2712 | 163 |
| 481 | 3300048912 | Ga0496109_0054234 | Ga0496109_0054234_2258_2752 | 163 |
| 482 | 3300048912 | Ga0496109_0108621 | Ga0496109_0108621_1012_1503 | 163 |
| 483 | 3300048912 | Ga0496109_0654758 | Ga0496109_0654758_191_682 | 163 |
| 484 | 3300048913 | Ga0496110_0083658 | Ga0496110_0083658_1186_1677 | 163 |
| 485 | 3300048913 | Ga0496110_0256613 | Ga0496110_0256613_637_1128 | 163 |
| 486 | 3300048913 | Ga0496110_0670808 | Ga0496110_0670808_153_647 | 163 |
| 487 | 3300048914 | Ga0496111_0095920 | Ga0496111_0095920_439_930 | 163 |
| 488 | 3300048914 | Ga0496111_0171823 | Ga0496111_0171823_181_675 | 163 |
| 489 | 3300048915 | Ga0496112_0079131 | Ga0496112_0079131_480_974 | 163 |
| 490 | 3300048915 | Ga0496112_0101512 | Ga0496112_0101512_560_1051 | 163 |
| 491 | 3300048916 | Ga0496113_0062223 | Ga0496113_0062223_1169_1663 | 163 |
| 492 | 3300048916 | Ga0496113_0065947 | Ga0496113_0065947_1862_2353 | 163 |
| 493 | 3300048916 | Ga0496113_0135385 | Ga0496113_0135385_1159_1650 | 163 |
| 494 | 3300048917 | Ga0496114_0131403 | Ga0496114_0131403_1332_1826 | 163 |
| 495 | 3300048917 | Ga0496114_0147108 | Ga0496114_0147108_1231_1722 | 163 |
| 496 | 3300049568 | Ga0501031_0020611 | Ga0501031_0020611_457_948 | 163 |
| 497 | 3300049568 | Ga0501031_0071707 | Ga0501031_0071707_1598_2089 | 163 |
| 498 | 3300049568 | Ga0501031_0158439 | Ga0501031_0158439_715_1206 | 163 |
| 499 | 3300049568 | Ga0501031_0189547 | Ga0501031_0189547_279_770 | 163 |
| 500 | 3300049568 | Ga0501031_0358283 | Ga0501031_0358283_396_887 | 163 |
| 501 | 3300049569 | Ga0501032_0252912 | Ga0501032_0252912_450_941 | 163 |
| 502 | 3300049570 | Ga0501033_0051727 | Ga0501033_0051727_2028_2519 | 163 |
| 503 | 3300049572 | Ga0501036_0446681 | Ga0501036_0446681_314_805 | 163 |
| 504 | 3300049572 | Ga0501036_1267078 | Ga0501036_1267078_98_589 | 163 |
| 505 | 3300049573 | Ga0501037_0078142 | Ga0501037_0078142_1765_2256 | 163 |
| 506 | 3300049573 | Ga0501037_0479361 | Ga0501037_0479361_327_818 | 163 |
| 507 | 3300049574 | Ga0501038_0014155 | Ga0501038_0014155_5103_5594 | 163 |
| 508 | 3300049574 | Ga0501038_0137375 | Ga0501038_0137375_538_1029 | 163 |
| 509 | 3300049575 | Ga0501039_0058790 | Ga0501039_0058790_1965_2456 | 163 |
| 510 | 3300049575 | Ga0501039_0328519 | Ga0501039_0328519_581_1072 | 163 |
| 511 | 3300049575 | Ga0501039_0748485 | Ga0501039_0748485_204_695 | 163 |
| 512 | 3300049576 | Ga0501040_0046352 | Ga0501040_0046352_247_738 | 163 |
| 513 | 3300049576 | Ga0501040_0053961 | Ga0501040_0053961_720_1211 | 163 |
| 514 | 3300049576 | Ga0501040_0164984 | Ga0501040_0164984_867_1358 | 163 |
| 515 | 3300049576 | Ga0501040_0318087 | Ga0501040_0318087_352_843 | 163 |
| 516 | 3300049577 | Ga0501041_0019958 | Ga0501041_0019958_713_1204 | 163 |
| 517 | 3300049577 | Ga0501041_0028013 | Ga0501041_0028013_684_1175 | 163 |
| 518 | 3300049578 | Ga0501042_0051113 | Ga0501042_0051113_2007_2498 | 163 |
| 519 | 3300049578 | Ga0501042_0368749 | Ga0501042_0368749_159_650 | 163 |
| 520 | 3300049578 | Ga0501042_0433863 | Ga0501042_0433863_79_570 | 163 |
| 521 | 3300049578 | Ga0501042_0698495 | Ga0501042_0698495_211_702 | 163 |
| 522 | 3300049579 | Ga0501043_0145598 | Ga0501043_0145598_908_1399 | 163 |
| 523 | 3300049580 | Ga0501046_0033725 | Ga0501046_0033725_1032_1523 | 163 |
| 524 | 3300049582 | Ga0501048_0049081 | Ga0501048_0049081_1012_1503 | 163 |
| 525 | 3300049582 | Ga0501048_0066054 | Ga0501048_0066054_1491_1982 | 163 |
| 526 | 3300049582 | Ga0501048_0573936 | Ga0501048_0573936_25_516 | 163 |
| 527 | 3300049582 | Ga0501048_0686628 | Ga0501048_0686628_123_620 | 163 |
| 528 | 3300049583 | Ga0501067_0022093 | Ga0501067_0022093_2901_3395 | 163 |
| 529 | 3300049583 | Ga0501067_0036428 | Ga0501067_0036428_1568_2059 | 163 |
| 530 | 3300049583 | Ga0501067_0166275 | Ga0501067_0166275_120_611 | 163 |
| 531 | 3300049584 | Ga0501068_0163099 | Ga0501068_0163099_483_974 | 163 |
| 532 | 3300049585 | Ga0501069_0003512 | Ga0501069_0003512_6970_7461 | 163 |
| 533 | 3300049585 | Ga0501069_0105549 | Ga0501069_0105549_671_1165 | 163 |
| 534 | 3300049585 | Ga0501069_0182675 | Ga0501069_0182675_46_537 | 163 |
| 535 | 3300049585 | Ga0501069_0353108 | Ga0501069_0353108_305_796 | 163 |
| 536 | 3300049585 | Ga0501069_0360162 | Ga0501069_0360162_36_527 | 163 |
| 537 | 3300049585 | Ga0501069_0377606 | Ga0501069_0377606_287_778 | 163 |
| 538 | 3300049586 | Ga0501070_0035779 | Ga0501070_0035779_601_1092 | 163 |
| 539 | 3300049586 | Ga0501070_0120340 | Ga0501070_0120340_146_637 | 163 |
| 540 | 3300049586 | Ga0501070_0559303 | Ga0501070_0559303_84_575 | 163 |
| 541 | 3300049587 | Ga0501071_0025657 | Ga0501071_0025657_388_879 | 163 |
| 542 | 3300049587 | Ga0501071_0062316 | Ga0501071_0062316_1980_2471 | 163 |
| 543 | 3300049587 | Ga0501071_0135318 | Ga0501071_0135318_1106_1597 | 163 |
| 544 | 3300049587 | Ga0501071_0350393 | Ga0501071_0350393_393_890 | 163 |
| 545 | 3300049587 | Ga0501071_0711925 | Ga0501071_0711925_200_691 | 163 |
| 546 | 3300049588 | Ga0501072_0043147 | Ga0501072_0043147_2666_3157 | 163 |
| 547 | 3300049588 | Ga0501072_0078047 | Ga0501072_0078047_1011_1502 | 163 |
| 548 | 3300049588 | Ga0501072_0104654 | Ga0501072_0104654_1539_2030 | 163 |
| 549 | 3300049588 | Ga0501072_0222517 | Ga0501072_0222517_817_1308 | 163 |
| 550 | 3300049588 | Ga0501072_0335590 | Ga0501072_0335590_272_763 | 163 |
| 551 | 3300049589 | Ga0501073_0315394 | Ga0501073_0315394_454_945 | 163 |
| 552 | 3300049590 | Ga0501074_0023832 | Ga0501074_0023832_3460_3951 | 163 |
| 553 | 3300049590 | Ga0501074_0067445 | Ga0501074_0067445_1342_1833 | 163 |
| 554 | 3300049590 | Ga0501074_0079410 | Ga0501074_0079410_1178_1669 | 163 |
| 555 | 3300049591 | Ga0501075_0113293 | Ga0501075_0113293_444_935 | 163 |
| 556 | 3300049591 | Ga0501075_0221071 | Ga0501075_0221071_757_1248 | 163 |
| 557 | 3300049591 | Ga0501075_0242029 | Ga0501075_0242029_44_535 | 163 |
| 558 | 3300049591 | Ga0501075_0262735 | Ga0501075_0262735_171_662 | 163 |
| 559 | 3300049591 | Ga0501075_0508110 | Ga0501075_0508110_242_733 | 163 |
| 560 | 3300049591 | Ga0501075_0521804 | Ga0501075_0521804_221_712 | 163 |
| 561 | 3300049591 | Ga0501075_0522856 | Ga0501075_0522856_270_761 | 163 |
| 562 | 3300049592 | Ga0501076_0059326 | Ga0501076_0059326_2012_2503 | 163 |
| 563 | 3300049592 | Ga0501076_0145387 | Ga0501076_0145387_269_760 | 163 |
| 564 | 3300049592 | Ga0501076_0157175 | Ga0501076_0157175_279_770 | 163 |
| 565 | 3300049592 | Ga0501076_0172073 | Ga0501076_0172073_1104_1595 | 163 |
| 566 | 3300049592 | Ga0501076_0335519 | Ga0501076_0335519_300_791 | 163 |
| 567 | 3300049593 | Ga0501077_0014521 | Ga0501077_0014521_1500_1991 | 163 |
| 568 | 3300049593 | Ga0501077_0060899 | Ga0501077_0060899_327_818 | 163 |
| 569 | 3300049593 | Ga0501077_0224965 | Ga0501077_0224965_500_991 | 163 |
| 570 | 3300049656 | Ga0501209_162656 | Ga0501209_162656_104_595 | 163 |
| 571 | 3300049741 | Ga0501079_0053262 | Ga0501079_0053262_512_1003 | 163 |
| 572 | 3300049741 | Ga0501079_0058234 | Ga0501079_0058234_1780_2271 | 163 |
| 573 | 3300049741 | Ga0501079_0094329 | Ga0501079_0094329_1024_1518 | 163 |
| 574 | 3300049741 | Ga0501079_0245805 | Ga0501079_0245805_854_1345 | 163 |
| 575 | 3300049742 | Ga0501080_0032123 | Ga0501080_0032123_1337_1828 | 163 |
| 576 | 3300049742 | Ga0501080_0196191 | Ga0501080_0196191_1255_1746 | 163 |
| 577 | 3300049743 | Ga0501081_0220729 | Ga0501081_0220729_450_941 | 163 |
| 578 | 3300049743 | Ga0501081_0259953 | Ga0501081_0259953_371_862 | 163 |
| 579 | 3300049743 | Ga0501081_0449271 | Ga0501081_0449271_30_521 | 163 |
| 580 | 3300049743 | Ga0501081_0586219 | Ga0501081_0586219_37_528 | 163 |
| 581 | 3300049744 | Ga0501083_0087933 | Ga0501083_0087933_1270_1761 | 163 |
| 582 | 3300049822 | Ga0501035_0073771 | Ga0501035_0073771_404_895 | 163 |
| 583 | 3300049823 | Ga0501044_0130530 | Ga0501044_0130530_1128_1619 | 163 |
| 584 | 3300049823 | Ga0501044_0590933 | Ga0501044_0590933_363_854 | 163 |
| 585 | 3300049824 | Ga0501045_0011588 | Ga0501045_0011588_4597_5088 | 163 |
| 586 | 3300049824 | Ga0501045_0033475 | Ga0501045_0033475_1291_1782 | 163 |
| 587 | 3300049824 | Ga0501045_0194558 | Ga0501045_0194558_517_1008 | 163 |
| 588 | 3300049824 | Ga0501045_0263745 | Ga0501045_0263745_649_1140 | 163 |
| 589 | 3300050492 | nmdc:mga0yw44_675702_c1 | nmdc:mga0yw44_675702_c1_70_561 | 163 |
| 590 | 3300050507 | nmdc:mga05p37_20144_c1 | nmdc:mga05p37_20144_c1_5586_6077 | 163 |
| 591 | 3300050507 | nmdc:mga05p37_239537_c1 | nmdc:mga05p37_239537_c1_981_1472 | 163 |
| 592 | 3300050507 | nmdc:mga05p37_449025_c1 | nmdc:mga05p37_449025_c1_426_917 | 163 |
| 593 | 3300050507 | nmdc:mga05p37_562877_c1 | nmdc:mga05p37_562877_c1_750_1241 | 163 |
| 594 | 3300050507 | nmdc:mga05p37_578899_c1 | nmdc:mga05p37_578899_c1_574_1065 | 163 |
| 595 | 3300050508 | nmdc:mga09592_1201878_c1 | nmdc:mga09592_1201878_c1_124_615 | 163 |
| 596 | 3300050510 | nmdc:mga06r32_1343550_c1 | nmdc:mga06r32_1343550_c1_103_594 | 163 |
| 597 | 3300050510 | nmdc:mga06r32_912777_c1 | nmdc:mga06r32_912777_c1_11_511 | 163 |
| 598 | 3300050511 | nmdc:mga08y16_1482508_c1 | nmdc:mga08y16_1482508_c1_104_595 | 163 |
| 599 | 3300050511 | nmdc:mga08y16_158637_c1 | nmdc:mga08y16_158637_c1_1438_1929 | 163 |
| 600 | 3300050511 | nmdc:mga08y16_40112_c1 | nmdc:mga08y16_40112_c1_1379_1879 | 163 |
| 601 | 3300050511 | nmdc:mga08y16_467134_c1 | nmdc:mga08y16_467134_c1_425_916 | 163 |
| 602 | 3300050511 | nmdc:mga08y16_95719_c1 | nmdc:mga08y16_95719_c1_57_548 | 163 |
| 603 | 3300050514 | nmdc:mga08x19_334086_c1 | nmdc:mga08x19_334086_c1_274_765 | 163 |
| 604 | 3300050515 | nmdc:mga0a205_418650_c1 | nmdc:mga0a205_418650_c1_261_752 | 163 |
| 605 | 3300050515 | nmdc:mga0a205_49481_c1 | nmdc:mga0a205_49481_c1_735_1229 | 163 |
| 606 | 3300053077 | Ga0495601_0157190 | Ga0495601_0157190_560_1054 | 163 |
| 607 | 3300053077 | Ga0495601_0243545 | Ga0495601_0243545_187_681 | 163 |
| 608 | 3300053077 | Ga0495601_0324679 | Ga0495601_0324679_241_732 | 163 |
| 609 | 3300053078 | Ga0495612_0047168 | Ga0495612_0047168_593_1087 | 163 |
| 610 | 3300053085 | Ga0495619_0059363 | Ga0495619_0059363_480_974 | 163 |
| 611 | 3300053085 | Ga0495619_0274633 | Ga0495619_0274633_127_621 | 163 |
| 612 | 3300054114 | Ga0501084_0089499 | Ga0501084_0089499_577_1068 | 163 |
| 613 | 3300054114 | Ga0501084_0242430 | Ga0501084_0242430_674_1165 | 163 |
| 614 | 3300059421 | Ga0590071_003513 | Ga0590071_003513_2795_3286 | 163 |
| 615 | 3300060353 | Ga0501082_0152458 | Ga0501082_0152458_298_789 | 163 |
| 616 | 3300060353 | Ga0501082_0194535 | Ga0501082_0194535_574_1068 | 163 |
| 617 | 3300060353 | Ga0501082_0207997 | Ga0501082_0207997_537_1028 | 163 |
| 618 | 3300060353 | Ga0501082_0218876 | Ga0501082_0218876_560_1051 | 163 |
| 619 | 3300060353 | Ga0501082_0642884 | Ga0501082_0642884_284_775 | 163 |
| 620 | 3300060353 | Ga0501082_0824320 | Ga0501082_0824320_204_695 | 163 |
| 621 | 3300060353 | Ga0501082_0894375 | Ga0501082_0894375_19_510 | 163 |
| 622 | 3300061734 | Ga0530510_0005043 | Ga0530510_0005043_8610_9101 | 163 |
| 623 | 3300061734 | Ga0530510_0015303 | Ga0530510_0015303_4680_5171 | 163 |
| 624 | 3300061734 | Ga0530510_0016613 | Ga0530510_0016613_1360_1851 | 163 |
| 625 | 3300061734 | Ga0530510_0044381 | Ga0530510_0044381_463_954 | 163 |
| 626 | 3300061734 | Ga0530510_0134757 | Ga0530510_0134757_268_759 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.9039 | 5 | 163 |
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.8882 | 5 | 163 |
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.8737 | 6 | 163 |
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.8494 | 6 | 163 |
| 3u1k-assembly2.cif.gz_B | crystal structure of human pnpase | 0.7124 | 110 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFK9_11_96_3.30.70.990 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9463 | 13 | 96 | 3.30.70.990 |
| 1in0B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9431 | 102 | 163 | 3.30.70.860 |
| 1in0A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9403 | 12 | 101 | 3.30.70.990 |
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9262 | 12 | 101 | 3.30.70.990 |
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9164 | 12 | 101 | 3.30.70.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9SD14-F1-model_v4 | DUF520 family protein | 0.9902 | 13 | 99 |
GO:0000166
GO:0005829 |
| AF-A0A535HTI7-F1-model_v4 | UPF0234 protein E6J14_05950 | 0.9863 | 1 | 163 |
GO:0000166
GO:0005829 |
| AF-A0A383DX75-F1-model_v4 | YajQ family cyclic di-GMP-binding protein | 0.9821 | 14 | 99 |
GO:0000166
GO:0005829 |
| AF-A0A6J4JM05-F1-model_v4 | UPF0234 protein Yitk | 0.9806 | 10 | 79 |
GO:0000166
GO:0005829 |
| AF-A0A7W0J5U9-F1-model_v4 | Nucleotide-binding protein | 0.9797 | 14 | 100 |
GO:0000166
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar