F470285

General Info

Members Datasets Scaffolds Average Seq Length
624 336 1248 218

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10019363|Ga0265334_100193632
Length 238
Sequence VTRLYLSQANFNFGKTKTGIMFEYKGIKIQWLGHDSFLLAANVKVIIDPFKITKQEKADLILISHNHFDHCNIDDIKNVSTSDTIIIAANECIDVLKGFPFKEKIGISPGQEKTIHGVVIKSVPAYNLSKINPDTKKPFHPKEDGKLGFMVSMNGVTIYHAGDTDMIPEMSDLRPDIALVPVSGTYVMTAQEAANAIEKIKPKIAIPMHYGTIVGSEKDAHDFKQLVKSCDVQIVTKE

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
16 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
17 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
18 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
19 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
20 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
21 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
22 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
23 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
24 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
25 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
26 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
117 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
118 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
119 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
120 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
121 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
122 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
123 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
124 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
125 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
126 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
127 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
128 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
129 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
130 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
131 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
132 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
133 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
134 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
135 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
216 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
217 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
221 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
222 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
229 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
234 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
235 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
236 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
237 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
245 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
251 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
252 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
255 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
256 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
257 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
258 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
261 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
262 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
263 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
264 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
265 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
266 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
267 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
268 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
269 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
270 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
273 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
274 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
275 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
276 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
277 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
315 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.37
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10019363 3300028573 Archaea 2800
2 SwRhRL2b_contig_590888 2162886007 Archaea 1780
3 2214800756 2209111006 Archaea 10996
4 ARcpr5oldR_c002438 3300000041 Archaea 1720
5 ARSoilYngRDRAFT_c00116 3300000042 Archaea 13641
6 ARSoilOldRDRAFT_c006026 3300000044 Archaea 1021
7 ARCol0oldRDRAFT_c00005 3300000045 Archaea 19653
8 ARCol0yngRDRAFT_1000089 3300000652 Archaea 17005
9 JGI24736J21556_1003449 3300001904 Archaea 2743
10 JGI24736J21556_1013936 3300001904 Archaea 1295
11 JGI24739J22299_10009516 3300001989 Unclassified 3621
12 JGI24744J21845_10003309 3300002077 Archaea 3309
13 JGI24033J26618_1001938 3300002155 Archaea 2075
14 JGI24033J26618_1009303 3300002155 Archaea 1142
15 JGI24033J26618_1026255 3300002155 Archaea 766
16 JGI24742J22300_10002922 3300002244 Archaea 2758
17 JGI24751J29686_10045000 3300002459 Archaea 912
18 JGI26145J50221_1000327 3300003371 Archaea 4149
19 JGI26142J50222_100267 3300003379 Archaea 1980
20 JGI26144J50225_100277 3300003380 Archaea 2258
21 JGI26139J50223_100014 3300003382 Archaea 9996
22 JGI26134J50242_100111 3300003392 Archaea 4534
23 JGI26137J50245_100428 3300003396 Archaea 1584
24 JGI26130J50248_100253 3300003398 Archaea 2507
25 JGI26136J50244_100162 3300003399 Archaea 2725
26 JGI26131J50246_100150 3300003400 Archaea 3452
27 JGI26143J51219_1000183 3300003502 Archaea 2676
28 JGI26138J51218_100066 3300003504 Archaea 4664
29 Ga0058860_12142259 3300004801 Archaea 891
30 Ga0065716_1000013 3300005277 Archaea 10239
31 Ga0065704_10005989 3300005289 Archaea 2695
32 Ga0065704_10006788 3300005289 Archaea 4666
33 Ga0065704_10222827 3300005289 Archaea 1068
34 Ga0065712_10069371 3300005290 Archaea 7430
35 Ga0065715_10000387 3300005293 Archaea 23221
36 Ga0065715_10002097 3300005293 Archaea 5156
37 Ga0065715_10089725 3300005293 Archaea 8729
38 Ga0065707_10003175 3300005295 Archaea 5259
39 Ga0065707_10004455 3300005295 Archaea 3390
40 Ga0065707_10287942 3300005295 Archaea 1026
41 Ga0070676_10001279 3300005328 Archaea 12631
42 Ga0070676_10003575 3300005328 Archaea 8130
43 Ga0070676_10014863 3300005328 Archaea 4284
44 Ga0070683_100043496 3300005329 Unclassified 4139
45 Ga0070683_100183663 3300005329 Archaea 1985
46 Ga0070690_100226787 3300005330 Archaea 1311
47 Ga0070670_100035583 3300005331 Archaea 4286
48 Ga0068869_100002560 3300005334 Archaea 10976
49 Ga0068869_100003611 3300005334 Archaea 9494
50 Ga0068869_100080651 3300005334 Archaea 2428
51 Ga0068869_100122482 3300005334 Archaea 1990
52 Ga0070680_100002879 3300005336 Archaea 12789
53 Ga0070680_100020826 3300005336 Archaea 5205
54 Ga0070682_100046792 3300005337 Archaea 2686
55 Ga0068868_100019400 3300005338 Archaea 5095
56 Ga0068868_100132767 3300005338 Archaea 2039
57 Ga0070689_100287343 3300005340 Archaea 1366
58 Ga0070691_10017324 3300005341 Archaea 3315
59 Ga0070691_10027576 3300005341 Archaea 2651
60 Ga0070687_100066863 3300005343 Archaea 1916
61 Ga0070692_10014869 3300005345 Unclassified 3667
62 Ga0070692_10015040 3300005345 Archaea 3651
63 Ga0070668_100083225 3300005347 Archaea 2512
64 Ga0070669_100159961 3300005353 Archaea 1749
65 Ga0070675_100025385 3300005354 Archaea 4751
66 Ga0070675_100115793 3300005354 Archaea 2273
67 Ga0070675_100342774 3300005354 Unclassified 1324
68 Ga0070671_100503499 3300005355 Archaea 1042
69 Ga0070674_100585062 3300005356 Archaea 941
70 Ga0070674_100740511 3300005356 Archaea 844
71 Ga0070673_100007900 3300005364 Archaea 7052
72 Ga0070673_100020926 3300005364 Unclassified 4729
73 Ga0070688_100147093 3300005365 Archaea 1607
74 Ga0070659_100022332 3300005366 Archaea 4830
75 Ga0070659_100034970 3300005366 Archaea 3910
76 Ga0070667_100038286 3300005367 Archaea 4020
77 Ga0070709_10002559 3300005434 Archaea 9843
78 Ga0070713_100010883 3300005436 Archaea 6595
79 Ga0070713_100510205 3300005436 Archaea 1135
80 Ga0070713_100763565 3300005436 Archaea 925
81 Ga0070710_10006923 3300005437 Archaea 5468
82 Ga0070701_10034405 3300005438 Archaea 2537
83 Ga0070701_10205054 3300005438 Archaea 1168
84 Ga0070711_100008039 3300005439 Archaea 6439
85 Ga0070711_100064351 3300005439 Archaea 2562
86 Ga0070711_100229969 3300005439 Archaea 1445
87 Ga0070711_100322042 3300005439 Archaea 1235
88 Ga0070705_100000634 3300005440 Archaea 20188
89 Ga0070705_100168742 3300005440 Archaea 1471
90 Ga0070700_100003915 3300005441 Archaea 7734
91 Ga0070700_100767110 3300005441 Archaea 773
92 Ga0070694_100000525 3300005444 Archaea 21124
93 Ga0070694_100004520 3300005444 Archaea 8363
94 Ga0070694_100005128 3300005444 Archaea 7899
95 Ga0070708_100357901 3300005445 Archaea 1375
96 Ga0070708_101019820 3300005445 Archaea 776
97 Ga0070678_100251309 3300005456 Archaea 1483
98 Ga0070678_100261716 3300005456 Archaea 1455
99 Ga0070678_100527344 3300005456 Archaea 1046
100 Ga0070662_100455376 3300005457 Archaea 1062
101 Ga0070681_10008638 3300005458 Archaea 9986
102 Ga0070681_10017773 3300005458 Archaea 7105
103 Ga0068867_100011521 3300005459 Archaea 6242
104 Ga0068867_100016310 3300005459 Archaea 5274
105 Ga0068867_100051617 3300005459 Archaea 3033
106 Ga0068867_100119265 3300005459 Archaea 2037
107 Ga0068867_100141744 3300005459 Archaea 1879
108 Ga0070685_10023706 3300005466 Archaea 3364
109 Ga0070685_10090680 3300005466 Archaea 1849
110 Ga0070698_100002568 3300005471 Archaea 19985
111 Ga0070698_100076493 3300005471 Archaea 3349
112 Ga0070698_100320847 3300005471 Archaea 1480
113 Ga0070699_100050745 3300005518 Archaea 3592
114 Ga0070684_100171878 3300005535 Archaea 1968
115 Ga0070697_100077491 3300005536 Archaea 2735
116 Ga0070697_100323051 3300005536 Archaea 1329
117 Ga0068853_100105655 3300005539 Archaea 2494
118 Ga0068853_100337357 3300005539 Archaea 1400
119 Ga0070672_100005659 3300005543 Archaea 8319
120 Ga0070672_100056588 3300005543 Archaea 3076
121 Ga0070672_100882285 3300005543 Archaea 790
122 Ga0070686_100028086 3300005544 Unclassified 3409
123 Ga0070686_100273089 3300005544 Archaea 1244
124 Ga0070686_100493570 3300005544 Archaea 949
125 Ga0070695_100006616 3300005545 Archaea 6850
126 Ga0070696_100003894 3300005546 Archaea 9969
127 Ga0070696_100132970 3300005546 Archaea 1812
128 Ga0070696_100197087 3300005546 Archaea 1501
129 Ga0070696_100268337 3300005546 Archaea 1297
130 Ga0070693_100000651 3300005547 Archaea 15324
131 Ga0070693_100035683 3300005547 Archaea 2760
132 Ga0070693_100297458 3300005547 Archaea 1087
133 Ga0070704_100054890 3300005549 Archaea 2822
134 Ga0070704_100163328 3300005549 Archaea 1763
135 Ga0070704_100454672 3300005549 Archaea 1103
136 Ga0070664_100014273 3300005564 Archaea 6479
137 Ga0070664_100051458 3300005564 Archaea 3488
138 Ga0068854_100168879 3300005578 Archaea 1700
139 Ga0068854_100615957 3300005578 Unclassified 928
140 Ga0068856_100005396 3300005614 Archaea 12606
141 Ga0070702_100000990 3300005615 Archaea 11216
142 Ga0070702_100151653 3300005615 Archaea 1488
143 Ga0070702_100306666 3300005615 Archaea 1100
144 Ga0068852_100470082 3300005616 Archaea 1248
145 Ga0068859_100449454 3300005617 Archaea 1385
146 Ga0068864_100003535 3300005618 Archaea 12925
147 Ga0068864_100060307 3300005618 Archaea 3285
148 Ga0068864_100248427 3300005618 Archaea 1651
149 Ga0068866_10005164 3300005718 Archaea 5379
150 Ga0068866_10108697 3300005718 Archaea 1543
151 Ga0068866_10494602 3300005718 Archaea 808
152 Ga0068861_100270203 3300005719 Archaea 1460
153 Ga0068870_10000331 3300005840 Archaea 17600
154 Ga0068870_10000748 3300005840 Archaea 12501
155 Ga0068860_100204429 3300005843 Archaea 1915
156 Ga0068860_100761083 3300005843 Archaea 981
157 Ga0068862_100263699 3300005844 Archaea 1573
158 Ga0081455_10000789 3300005937 Archaea 40686
159 Ga0081455_10001696 3300005937 Archaea 26681
160 Ga0081455_10172482 3300005937 Archaea 1646
161 Ga0075432_10094061 3300006058 Archaea 1100
162 Ga0070716_100038314 3300006173 Archaea 2654
163 Ga0070712_100010561 3300006175 Archaea 5830
164 Ga0070712_100074025 3300006175 Archaea 2445
165 Ga0075427_10018144 3300006194 Archaea 1102
166 Ga0097621_100133661 3300006237 Archaea 2114
167 Ga0097621_100144244 3300006237 Archaea 2037
168 Ga0097621_100708264 3300006237 Archaea 927
169 Ga0075428_100000216 3300006844 Archaea 55573
170 Ga0075428_100101742 3300006844 Archaea 3132
171 Ga0075430_100000111 3300006846 Archaea 48980
172 Ga0075430_100009963 3300006846 Archaea 8039
173 Ga0075430_100662157 3300006846 Archaea 861
174 Ga0075431_100000106 3300006847 Archaea 53157
175 Ga0075431_100039128 3300006847 Archaea 4885
176 Ga0075431_100141691 3300006847 Archaea 2478
177 Ga0075433_10001680 3300006852 Archaea 16476
178 Ga0075433_10054236 3300006852 Archaea 3497
179 Ga0075434_100010656 3300006871 Archaea 8630
180 Ga0075434_100012212 3300006871 Archaea 8137
181 Ga0075434_100990726 3300006871 Archaea 854
182 Ga0075429_100000053 3300006880 Archaea 55602
183 Ga0075429_100000760 3300006880 Archaea 25379
184 Ga0075429_100139605 3300006880 Archaea 2121
185 Ga0075429_100525995 3300006880 Archaea 1036
186 Ga0075429_100826138 3300006880 Unclassified 811
187 Ga0068865_100001196 3300006881 Archaea 15108
188 Ga0068865_100037581 3300006881 Archaea 3270
189 Ga0068865_100081849 3300006881 Archaea 2320
190 Ga0068865_100162099 3300006881 Archaea 1707
191 Ga0068865_100203842 3300006881 Archaea 1537
192 Ga0075436_100001241 3300006914 Archaea 17333
193 Ga0075436_100011573 3300006914 Archaea 6052
194 Ga0075436_100021075 3300006914 Archaea 4471
195 Ga0075436_100103151 3300006914 Archaea 1988
196 Ga0097620_100449493 3300006931 Archaea 1385
197 Ga0075435_100001537 3300007076 Archaea 14853
198 Ga0075435_100041689 3300007076 Archaea 3670
199 Ga0075435_100122238 3300007076 Archaea 2173
200 Ga0075435_100178881 3300007076 Archaea 1792
201 Ga0105244_10215139 3300009036 Archaea 903
202 Ga0105240_10072612 3300009093 Archaea 4253
203 Ga0111539_10000137 3300009094 Archaea 82991
204 Ga0111539_10021453 3300009094 Archaea 7948
205 Ga0111539_10029925 3300009094 Archaea 6623
206 Ga0111539_10078531 3300009094 Archaea 3882
207 Ga0111539_10104207 3300009094 Archaea 3329
208 Ga0105245_10040573 3300009098 Archaea 4148
209 Ga0105245_10260853 3300009098 Archaea 1686
210 Ga0114129_10000299 3300009147 Archaea 57581
211 Ga0114129_10003280 3300009147 Archaea 22712
212 Ga0114129_10008119 3300009147 Archaea 14960
213 Ga0114129_10054930 3300009147 Archaea 5582
214 Ga0114129_10326849 3300009147 Archaea 2037
215 Ga0114129_10586673 3300009147 Archaea 1446
216 Ga0114129_10745430 3300009147 Archaea 1254
217 Ga0105241_10052121 3300009174 Archaea 3123
218 Ga0105241_10100132 3300009174 Archaea 2303
219 Ga0105241_10499287 3300009174 Archaea 1084
220 Ga0105242_10062530 3300009176 Archaea 3063
221 Ga0105242_10093064 3300009176 Archaea 2540
222 Ga0105242_10235586 3300009176 Archaea 1643
223 Ga0105249_10061811 3300009553 Archaea 3437
224 Ga0105249_10217066 3300009553 Archaea 1880
225 Ga0105239_10032554 3300010375 Archaea 5729
226 Ga0105239_10143838 3300010375 Archaea 2658
227 Ga0105239_10632264 3300010375 Archaea 1222
228 Ga0105246_10004333 3300011119 Archaea 8632
229 Ga0105246_10005177 3300011119 Archaea 7924
230 Ga0105246_10123047 3300011119 Archaea 1925
231 Ga0105246_10184728 3300011119 Archaea 1608
232 Ga0105246_10229730 3300011119 Archaea 1460
233 Ga0157340_1000149 3300012473 Archaea 2355
234 Ga0157336_1000265 3300012477 Archaea 2304
235 Ga0157328_1000082 3300012478 Unclassified 3027
236 Ga0157346_1000115 3300012480 Archaea 3148
237 Ga0157337_1000039 3300012483 Archaea 5344
238 Ga0157325_1000015 3300012485 Archaea 7255
239 Ga0157321_1000004 3300012487 Archaea 10054
240 Ga0157343_1000190 3300012488 Unclassified 2180
241 Ga0157341_1000019 3300012494 Archaea 6754
242 Ga0157319_1000173 3300012497 Unclassified 3239
243 Ga0157345_1000208 3300012498 Archaea 8866
244 Ga0157347_1000010 3300012502 Archaea 6548
245 Ga0157313_1000012 3300012503 Archaea 7747
246 Ga0157339_1000002 3300012505 Archaea 16247
247 Ga0157342_1000002 3300012507 Archaea 12652
248 Ga0157315_1000061 3300012508 Archaea 4567
249 Ga0157316_1000034 3300012510 Archaea 5562
250 Ga0157327_1000002 3300012512 Archaea 15839
251 Ga0157326_1000092 3300012513 Archaea 9020
252 Ga0157338_1000148 3300012515 Archaea 3415
253 Ga0157371_10047925 3300013102 Archaea 3038
254 Ga0157371_10139623 3300013102 Archaea 1726
255 Ga0157374_10006453 3300013296 Archaea 9959
256 Ga0157374_10014451 3300013296 Archaea 6908
257 Ga0157374_10217999 3300013296 Unclassified 1872
258 Ga0157374_10242927 3300013296 Archaea 1771
259 Ga0157378_10000805 3300013297 Archaea 29179
260 Ga0157378_10002092 3300013297 Archaea 17833
261 Ga0157378_10002894 3300013297 Archaea 15285
262 Ga0157378_10111004 3300013297 Archaea 2514
263 Ga0157378_10227707 3300013297 Archaea 1775
264 Ga0163162_10286031 3300013306 Archaea 1781
265 Ga0157372_10201415 3300013307 Archaea 2306
266 Ga0157372_10565769 3300013307 Archaea 1325
267 Ga0157372_11218316 3300013307 Archaea 870
268 Ga0157375_10079601 3300013308 Archaea 3313
269 Ga0163163_10818887 3300014325 Archaea 994
270 Ga0163163_11265172 3300014325 Archaea 800
271 Ga0157380_10135040 3300014326 Archaea 2110
272 Ga0157380_10666579 3300014326 Archaea 1040
273 Ga0157377_10003465 3300014745 Archaea 7151
274 Ga0157377_10014957 3300014745 Unclassified 3957
275 Ga0157379_10171633 3300014968 Archaea 1958
276 Ga0157376_10117647 3300014969 Archaea 2350
277 Ga0163161_10013855 3300017792 Archaea 5616
278 Ga0206353_11852760 3300020082 Archaea 931
279 Ga0207697_10003909 3300025315 Archaea 7262
280 Ga0207692_10049943 3300025898 Archaea 2113
281 Ga0207692_10310030 3300025898 Archaea 963
282 Ga0207642_10324410 3300025899 Archaea 900
283 Ga0207688_10019341 3300025901 Archaea 3708
284 Ga0207688_10047355 3300025901 Archaea 2401
285 Ga0207647_10000349 3300025904 Archaea 37360
286 Ga0207647_10002658 3300025904 Archaea 13498
287 Ga0207647_10011834 3300025904 Archaea 6098
288 Ga0207647_10040556 3300025904 Archaea 2931
289 Ga0207699_10027536 3300025906 Archaea 3148
290 Ga0207645_10000818 3300025907 Archaea 26061
291 Ga0207645_10006677 3300025907 Archaea 8240
292 Ga0207645_10067898 3300025907 Archaea 2279
293 Ga0207645_10146582 3300025907 Archaea 1539
294 Ga0207643_10000171 3300025908 Archaea 44412
295 Ga0207643_10000281 3300025908 Archaea 35370
296 Ga0207643_10000758 3300025908 Archaea 19814
297 Ga0207643_10024573 3300025908 Archaea 3325
298 Ga0207654_10014665 3300025911 Archaea 4052
299 Ga0207654_10391175 3300025911 Archaea 965
300 Ga0207707_10052182 3300025912 Archaea 3562
301 Ga0207707_10055104 3300025912 Archaea 3460
302 Ga0207707_10269415 3300025912 Archaea 1476
303 Ga0207707_10621644 3300025912 Archaea 912
304 Ga0207693_10001014 3300025915 Archaea 25156
305 Ga0207693_10352463 3300025915 Archaea 1152
306 Ga0207663_10013635 3300025916 Archaea 4422
307 Ga0207663_10023427 3300025916 Archaea 3542
308 Ga0207663_10063272 3300025916 Archaea 2355
309 Ga0207663_10158057 3300025916 Archaea 1597
310 Ga0207660_10005952 3300025917 Archaea 7916
311 Ga0207660_10026930 3300025917 Archaea 3919
312 Ga0207660_10099222 3300025917 Archaea 2173
313 Ga0207660_10381147 3300025917 Bacteria 1133
314 Ga0207662_10001549 3300025918 Archaea 11227
315 Ga0207662_10200512 3300025918 Archaea 1291
316 Ga0207662_10267692 3300025918 Archaea 1127
317 Ga0207657_10556262 3300025919 Archaea 897
318 Ga0207652_10022658 3300025921 Archaea 5200
319 Ga0207681_10004812 3300025923 Archaea 8303
320 Ga0207681_10526531 3300025923 Archaea 970
321 Ga0207650_10011333 3300025925 Archaea 6135
322 Ga0207650_10026365 3300025925 Archaea 4145
323 Ga0207659_10061623 3300025926 Archaea 2704
324 Ga0207659_10072585 3300025926 Archaea 2517
325 Ga0207700_10012231 3300025928 Archaea 5523
326 Ga0207664_10626156 3300025929 Archaea 967
327 Ga0207644_10772508 3300025931 Archaea 803
328 Ga0207690_10031103 3300025932 Archaea 3412
329 Ga0207690_10033686 3300025932 Archaea 3296
330 Ga0207706_10002205 3300025933 Archaea 18993
331 Ga0207706_10087972 3300025933 Archaea 2732
332 Ga0207686_10079378 3300025934 Archaea 2137
333 Ga0207686_10422309 3300025934 Archaea 1020
334 Ga0207670_10584710 3300025936 Archaea 915
335 Ga0207704_10010200 3300025938 Archaea 4570
336 Ga0207704_10225484 3300025938 Archaea 1390
337 Ga0207704_10245181 3300025938 Archaea 1341
338 Ga0207665_10001928 3300025939 Archaea 13957
339 Ga0207691_10001101 3300025940 Archaea 26872
340 Ga0207691_10021416 3300025940 Archaea 6104
341 Ga0207691_10069244 3300025940 Archaea 3188
342 Ga0207689_10000513 3300025942 Archaea 36760
343 Ga0207689_10001534 3300025942 Archaea 21980
344 Ga0207689_10219393 3300025942 Archaea 1571
345 Ga0207689_10553724 3300025942 Unclassified 966
346 Ga0207661_10108374 3300025944 Unclassified 2345
347 Ga0207661_10465125 3300025944 Archaea 1153
348 Ga0207679_10032774 3300025945 Archaea 3651
349 Ga0207679_10253127 3300025945 Archaea 1498
350 Ga0207679_10614488 3300025945 Archaea 981
351 Ga0207651_10002976 3300025960 Archaea 8203
352 Ga0207712_10010137 3300025961 Archaea 5975
353 Ga0207712_10017246 3300025961 Archaea 4688
354 Ga0207712_10102690 3300025961 Archaea 2129
355 Ga0207668_10035102 3300025972 Archaea 3336
356 Ga0207640_10029781 3300025981 Archaea 3355
357 Ga0207640_10243120 3300025981 Archaea 1392
358 Ga0207677_10015797 3300026023 Archaea 4452
359 Ga0207677_10026896 3300026023 Archaea 3614
360 Ga0207677_10065869 3300026023 Archaea 2530
361 Ga0207639_10340913 3300026041 Archaea 1336
362 Ga0207639_10698100 3300026041 Archaea 941
363 Ga0207708_10000160 3300026075 Archaea 52909
364 Ga0207708_10004320 3300026075 Archaea 10463
365 Ga0207708_10231555 3300026075 Bacteria 1483
366 Ga0207702_10311690 3300026078 Archaea 1496
367 Ga0207648_10004476 3300026089 Archaea 14339
368 Ga0207648_10006850 3300026089 Archaea 11293
369 Ga0207648_10016288 3300026089 Archaea 6798
370 Ga0207648_10061429 3300026089 Archaea 3276
371 Ga0207676_10031724 3300026095 Archaea 3975
372 Ga0207676_10325013 3300026095 Archaea 1413
373 Ga0207674_10007897 3300026116 Archaea 12360
374 Ga0207675_100183572 3300026118 Archaea 2004
375 Ga0207675_100184160 3300026118 Archaea 2001
376 Ga0207683_10033817 3300026121 Archaea 4443
377 Ga0207683_10239657 3300026121 Archaea 1654
378 Ga0207698_10224691 3300026142 Archaea 1700
379 Ga0209973_1021439 3300027252 Archaea 860
380 Ga0209969_1000277 3300027360 Archaea 6832
381 Ga0209967_1000066 3300027364 Archaea 14032
382 Ga0209967_1012433 3300027364 Archaea 1203
383 Ga0209981_1000023 3300027378 Archaea 14873
384 Ga0209996_1000213 3300027395 Archaea 7581
385 Ga0209984_1000029 3300027424 Archaea 15160
386 Ga0210000_1000189 3300027462 Archaea 8933
387 Ga0209995_1000211 3300027471 Archaea 9342
388 Ga0209968_1000367 3300027526 Archaea 7409
389 Ga0209999_1000715 3300027543 Archaea 5382
390 Ga0209982_1000658 3300027552 Archaea 4362
391 Ga0209970_1000212 3300027614 Archaea 9302
392 Ga0210002_1000157 3300027617 Archaea 9988
393 Ga0209983_1000333 3300027665 Archaea 9855
394 Ga0209983_1001482 3300027665 Archaea 5216
395 Ga0209971_1025227 3300027682 Bacteria 1420
396 Ga0209998_10000849 3300027717 Archaea 7867
397 Ga0209998_10002293 3300027717 Unclassified 4427
398 Ga0209974_10000671 3300027876 Archaea 11605
399 Ga0207428_10000136 3300027907 Archaea 98986
400 Ga0207428_10000194 3300027907 Archaea 84753
401 Ga0207428_10000202 3300027907 Archaea 82984
402 Ga0207428_10014773 3300027907 Archaea 6763
403 Ga0207428_10016347 3300027907 Archaea 6385
404 Ga0268265_10013196 3300028380 Archaea 5612
405 Ga0268264_10061073 3300028381 Archaea 3160
406 Ga0268264_10066955 3300028381 Archaea 3030
407 Ga0268264_10103058 3300028381 Archaea 2484
408 Ga0265337_1004604 3300028556 Archaea 5683
409 Ga0265326_10000122 3300028558 Archaea 39804
410 Ga0265326_10000238 3300028558 Archaea 26558
411 Ga0265322_10000025 3300028654 Archaea 94104
412 Ga0265336_10000367 3300028666 Archaea 29003
413 Ga0265336_10001101 3300028666 Archaea 13004
414 Ga0265338_10000252 3300028800 Archaea 98113
415 Ga0265338_10000447 3300028800 Archaea 73595
416 Ga0265324_10000190 3300029957 Archaea 47102
417 Ga0265324_10000357 3300029957 Archaea 33048
418 Ga0265328_10071072 3300031239 Archaea 1279
419 Ga0265320_10094589 3300031240 Archaea 1382
420 Ga0265325_10000038 3300031241 Archaea 93419
421 Ga0265340_10001405 3300031247 Archaea 13818
422 Ga0265340_10001597 3300031247 Archaea 13005
423 Ga0265339_10000569 3300031249 Archaea 28904
424 Ga0265339_10001631 3300031249 Archaea 16571
425 Ga0265331_10000114 3300031250 Archaea 105363
426 Ga0265331_10000140 3300031250 Archaea 95408
427 Ga0265316_10000537 3300031344 Archaea 42729
428 Ga0316575_10012096 3300031665 Bacteria 3204
429 Ga0316579_10016438 3300031691 Bacteria 3232
430 Ga0265314_10000667 3300031711 Archaea 42056
431 Ga0265342_10007714 3300031712 Archaea 7834
432 Ga0265342_10034234 3300031712 Archaea 3117
433 Ga0316576_10083724 3300031727 Unclassified 2370
434 Ga0316578_10365542 3300031728 Unclassified 858
435 Ga0316583_10102243 3300032133 Bacteria 999
436 Ga0373948_0003338 3300034817 Archaea 2460
437 Ga0373959_0013798 3300034820 Archaea 1462
438 Ga0373929_0055803 3300035085 Archaea 914
439 Ga0373949_0011674 3300035090 Archaea 1937
440 Ga0373939_0005577 3300035114 Archaea 2999
441 Ga0373941_0101028 3300035115 Archaea 1004
442 Ga0373960_0029949 3300035121 Archaea 1513
443 Ga0373942_0002265 3300035207 Archaea 4713
444 Ga0373961_0000792 3300035241 Archaea 10821
445 Ga0373962_0052815 3300035242 Archaea 1175
446 Ga0316574_0338540 3300035398 Archaea 953
447 Ga0373931_0024607 3300035691 Archaea 3052
448 Ga0373927_0505962 3300035695 Unclassified 798
449 Ga0316582_0002337 3300036647 Bacteria 8875
450 Ga0316584_0112191 3300036712 Archaea 2040
451 Ga0316581_0015091 3300037588 Bacteria 2204
452 Ga0242420_011567 3300038996 Archaea 1483
453 Ga0242420_048232 3300038996 Archaea 827
454 Ga0400489_61988 3300039093 Bacteria 10107
455 Ga0439436_0016738 3300041404 Archaea 2198
456 Ga0439439_0125887 3300041406 Unclassified 717
457 Ga0439453_0000715 3300041408 Archaea 3831
458 Ga0439453_0011439 3300041408 Archaea 1480
459 Ga0451807_2093164 3300041486 Archaea 966
460 Ga0439441_000096 3300042001 Archaea 7026
461 Ga0439443_001698 3300042003 Archaea 2499
462 Ga0439443_024691 3300042003 Archaea 965
463 Ga0439445_0025488 3300042004 Archaea 1509
464 Ga0439448_0021728 3300042005 Archaea 1990
465 Ga0439448_0030745 3300042005 Archaea 1705
466 Ga0439432_015849 3300042006 Unclassified 2538
467 Ga0439450_000304 3300042008 Archaea 6086
468 Ga0439451_004257 3300042009 Archaea 2903
469 Ga0439451_007268 3300042009 Archaea 2261
470 Ga0439451_057475 3300042009 Unclassified 778
471 Ga0439454_000182 3300042011 Archaea 4368
472 Ga0439454_019046 3300042011 Archaea 995
473 Ga0439455_0005822 3300042012 Archaea 2525
474 Ga0439455_0017533 3300042012 Archaea 1670
475 Ga0439456_007286 3300042013 Archaea 2266
476 Ga0439462_0064446 3300042015 Archaea 992
477 Ga0439463_000690 3300042016 Archaea 9368
478 Ga0439463_064523 3300042016 Archaea 936
479 Ga0450915_002874 3300042119 Archaea 936
480 Ga0450920_054333 3300042122 Unclassified 805
481 Ga0439446_0005742 3300042156 Archaea 3205
482 Ga0439434_0128107 3300042435 Archaea 831
483 Ga0439435_0015718 3300042436 Archaea 1887
484 Ga0439435_0017456 3300042436 Archaea 1814
485 Ga0439444_0000055 3300042437 Archaea 8280
486 Ga0439464_0003391 3300042439 Archaea 4016
487 Ga0439460_0004717 3300042461 Archaea 3325
488 Ga0439460_0021803 3300042461 Archaea 1754
489 Ga0450893_0005113 3300042532 Archaea 2098
490 Ga0451577_0290376 3300042876 Archaea 1482
491 Ga0451577_0313559 3300042876 Bacteria 1422
492 Ga0451577_0559591 3300042876 Unclassified 1038
493 Ga0451577_0638884 3300042876 Bacteria 965
494 Ga0439440_0000695 3300042993 Archaea 5775
495 Ga0439440_0031829 3300042993 Archaea 1249
496 Ga0453684_0000209 3300044712 Bacteria 255543
497 Ga0453684_0011179 3300044712 Bacteria 15114
498 Ga0453684_0016247 3300044712 Bacteria 11660
499 Ga0453684_0039518 3300044712 Bacteria 6427
500 Ga0453684_0393522 3300044712 Archaea 1553
501 Ga0453684_0408042 3300044712 Unclassified 1520
502 Ga0451576_0701228 3300045051 Bacteria 1064
503 Ga0466967_0159870 3300045976 Archaea 2114
504 Ga0495607_0088664 3300046501 Archaea 1681
505 Ga0495656_0118176 3300046615 Archaea 1248
506 Ga0495659_0012244 3300046664 Archaea 2776
507 Ga0496102_0015346 3300048905 Archaea 6672
508 Ga0496102_1187544 3300048905 Unclassified 682
509 Ga0496103_0152542 3300048906 Archaea 1480
510 Ga0496103_0492824 3300048906 Unclassified 784
511 Ga0496104_0208222 3300048907 Unclassified 1867
512 Ga0496105_0106724 3300048908 Archaea 2312
513 Ga0496106_0001781 3300048909 Archaea 16078
514 Ga0496106_0035260 3300048909 Archaea 3741
515 Ga0496106_0239571 3300048909 Archaea 1449
516 Ga0496107_0173562 3300048910 Archaea 1600
517 Ga0496108_0067423 3300048911 Archaea 3018
518 Ga0496108_0910139 3300048911 Archaea 755
519 Ga0496109_0216769 3300048912 Archaea 1800
520 Ga0496109_0220292 3300048912 Archaea 1784
521 Ga0496110_0058742 3300048913 Archaea 3387
522 Ga0496111_0157469 3300048914 Archaea 1685
523 Ga0496112_0319263 3300048915 Archaea 1497
524 Ga0496113_0228495 3300048916 Archaea 1483
525 Ga0496114_0231403 3300048917 Archaea 1624
526 Ga0496115_0212143 3300048918 Archaea 1599
527 Ga0501031_0092877 3300049568 Archaea 1969
528 Ga0501031_0223077 3300049568 Archaea 1227
529 Ga0501031_0461303 3300049568 Archaea 820
530 Ga0501036_0006389 3300049572 Archaea 9568
531 Ga0501036_0169590 3300049572 Archaea 1839
532 Ga0501036_0512777 3300049572 Unclassified 997
533 Ga0501037_0102241 3300049573 Archaea 2067
534 Ga0501037_0123364 3300049573 Archaea 1861
535 Ga0501039_0020661 3300049575 Archaea 5046
536 Ga0501039_0208748 3300049575 Archaea 1536
537 Ga0501039_0613941 3300049575 Archaea 852
538 Ga0501040_0011578 3300049576 Archaea 5773
539 Ga0501040_0035048 3300049576 Unclassified 3402
540 Ga0501041_0000178 3300049577 Archaea 28622
541 Ga0501041_0009273 3300049577 Unclassified 5795
542 Ga0501041_0248926 3300049577 Unclassified 1117
543 Ga0501042_0127146 3300049578 Archaea 1835
544 Ga0501042_0202951 3300049578 Archaea 1429
545 Ga0501042_0260665 3300049578 Archaea 1251
546 Ga0501042_0326020 3300049578 Archaea 1110
547 Ga0501043_0420030 3300049579 Archaea 1008
548 Ga0501043_0499066 3300049579 Archaea 909
549 Ga0501046_0021636 3300049580 Unclassified 5306
550 Ga0501046_0046309 3300049580 Archaea 3452
551 Ga0501046_0081026 3300049580 Unclassified 2507
552 Ga0501046_0106592 3300049580 Archaea 2144
553 Ga0501046_0220310 3300049580 Archaea 1405
554 Ga0501048_0006905 3300049582 Archaea 8627
555 Ga0501048_0008467 3300049582 Archaea 7777
556 Ga0501048_0200690 3300049582 Archaea 1414
557 Ga0501067_0535386 3300049583 Archaea 656
558 Ga0501068_0263936 3300049584 Unclassified 1099
559 Ga0501071_0001982 3300049587 Archaea 12243
560 Ga0501071_0051480 3300049587 Archaea 2968
561 Ga0501071_0101765 3300049587 Archaea 2118
562 Ga0501072_0000385 3300049588 Archaea 31596
563 Ga0501072_0084738 3300049588 Unclassified 2513
564 Ga0501072_0599040 3300049588 Unclassified 869
565 Ga0501072_0727338 3300049588 Unclassified 779
566 Ga0501074_0008693 3300049590 Unclassified 7359
567 Ga0501075_0001577 3300049591 Archaea 14903
568 Ga0501076_0000139 3300049592 Archaea 41179
569 Ga0501076_0089364 3300049592 Archaea 2476
570 Ga0501076_0577508 3300049592 Archaea 927
571 Ga0501077_0065896 3300049593 Archaea 2297
572 Ga0501077_0216256 3300049593 Unclassified 1218
573 Ga0501079_0010447 3300049741 Archaea 7056
574 Ga0501079_0124095 3300049741 Unclassified 2009
575 Ga0501079_0168735 3300049741 Archaea 1707
576 Ga0501080_0241634 3300049742 Archaea 1648
577 Ga0501081_0000879 3300049743 Archaea 17728
578 Ga0501081_0035958 3300049743 Unclassified 3374
579 Ga0501044_0244899 3300049823 Archaea 1736
580 Ga0501045_0002181 3300049824 Archaea 13269
581 Ga0501045_0119403 3300049824 Archaea 1957
582 Ga0501045_0314150 3300049824 Bacteria 1166
583 Ga0501045_0441315 3300049824 Archaea 968
584 nmdc:mga05p37_1401_c1 3300050507 Archaea 28045
585 nmdc:mga05p37_143_c1 3300050507 Archaea 66924
586 nmdc:mga05p37_31663_c1 3300050507 Archaea 6462
587 nmdc:mga05p37_60869_c1 3300050507 Archaea 4648
588 nmdc:mga05p37_718110_c1 3300050507 Archaea 1107
589 nmdc:mga09592_132_c1 3300050508 Archaea 48634
590 nmdc:mga09592_2021_c1 3300050508 Archaea 16363
591 nmdc:mga09592_2347_c1 3300050508 Archaea 15283
592 nmdc:mga09592_90084_c1 3300050508 Archaea 2621
593 nmdc:mga0qj67_51333_c1 3300050509 Archaea 3261
594 nmdc:mga0qj67_56_c1 3300050509 Archaea 82510
595 nmdc:mga06r32_39248_c1 3300050510 Archaea 4492
596 nmdc:mga06r32_809_c1 3300050510 Archaea 27783
597 nmdc:mga06r32_817528_c1 3300050510 Archaea 892
598 nmdc:mga08y16_14386_c1 3300050511 Archaea 8329
599 nmdc:mga08y16_375894_c1 3300050511 Archaea 1457
600 nmdc:mga08y16_454912_c1 3300050511 Archaea 1305
601 nmdc:mga08y16_519_c1 3300050511 Archaea 35560
602 nmdc:mga08y16_553_c1 3300050511 Archaea 30679
603 nmdc:mga08y16_86991_c1 3300050511 Archaea 3256
604 nmdc:mga0n895_268_c1 3300050512 Archaea 33964
605 nmdc:mga0n895_323503_c1 3300050512 Archaea 1563
606 nmdc:mga0n895_60722_c1 3300050512 Archaea 3731
607 nmdc:mga0rr50_114734_c1 3300050513 Archaea 2137
608 nmdc:mga0rr50_262297_c1 3300050513 Archaea 1438
609 nmdc:mga0rr50_847_c1 3300050513 Archaea 16468
610 nmdc:mga08x19_186533_c1 3300050514 Bacteria 1418
611 nmdc:mga08x19_3385_c1 3300050514 Archaea 9512
612 nmdc:mga08x19_55912_c1 3300050514 Archaea 2545
613 nmdc:mga0a205_1108_c1 3300050515 Archaea 22322
614 nmdc:mga0a205_26692_c1 3300050515 Archaea 5510
615 nmdc:mga0a205_31773_c1 3300050515 Archaea 5061
616 nmdc:mga0a205_642509_c1 3300050515 Archaea 913
617 Ga0501084_0003407 3300054114 Archaea 12893
618 Ga0501084_0148625 3300054114 Archaea 1974
619 Ga0590071_030144 3300059421 Archaea 1291
620 Ga0590074_030206 3300059423 Unclassified 955
621 Ga0501082_0000836 3300060353 Archaea 27096
622 Ga0501082_0370696 3300060353 Unclassified 1249
623 Ga0530510_0000300 3300061734 Archaea 31454
624 Ga0530510_0055640 3300061734 Archaea 2858
625 Ga0265334_10019363
626 SwRhRL2b_contig_590888
627 2214800756
628 ARcpr5oldR_c002438
629 ARSoilYngRDRAFT_c00116
630 ARSoilOldRDRAFT_c006026
631 ARCol0oldRDRAFT_c00005
632 ARCol0yngRDRAFT_1000089
633 JGI24736J21556_1003449
634 JGI24736J21556_1013936
635 JGI24739J22299_10009516
636 JGI24744J21845_10003309
637 JGI24033J26618_1001938
638 JGI24033J26618_1009303
639 JGI24033J26618_1026255
640 JGI24742J22300_10002922
641 JGI24751J29686_10045000
642 JGI26145J50221_1000327
643 JGI26142J50222_100267
644 JGI26144J50225_100277
645 JGI26139J50223_100014
646 JGI26134J50242_100111
647 JGI26137J50245_100428
648 JGI26130J50248_100253
649 JGI26136J50244_100162
650 JGI26131J50246_100150
651 JGI26143J51219_1000183
652 JGI26138J51218_100066
653 Ga0058860_12142259
654 Ga0065716_1000013
655 Ga0065704_10005989
656 Ga0065704_10006788
657 Ga0065704_10222827
658 Ga0065712_10069371
659 Ga0065715_10000387
660 Ga0065715_10002097
661 Ga0065715_10089725
662 Ga0065707_10003175
663 Ga0065707_10004455
664 Ga0065707_10287942
665 Ga0070676_10001279
666 Ga0070676_10003575
667 Ga0070676_10014863
668 Ga0070683_100043496
669 Ga0070683_100183663
670 Ga0070690_100226787
671 Ga0070670_100035583
672 Ga0068869_100002560
673 Ga0068869_100003611
674 Ga0068869_100080651
675 Ga0068869_100122482
676 Ga0070680_100002879
677 Ga0070680_100020826
678 Ga0070682_100046792
679 Ga0068868_100019400
680 Ga0068868_100132767
681 Ga0070689_100287343
682 Ga0070691_10017324
683 Ga0070691_10027576
684 Ga0070687_100066863
685 Ga0070692_10014869
686 Ga0070692_10015040
687 Ga0070668_100083225
688 Ga0070669_100159961
689 Ga0070675_100025385
690 Ga0070675_100115793
691 Ga0070675_100342774
692 Ga0070671_100503499
693 Ga0070674_100585062
694 Ga0070674_100740511
695 Ga0070673_100007900
696 Ga0070673_100020926
697 Ga0070688_100147093
698 Ga0070659_100022332
699 Ga0070659_100034970
700 Ga0070667_100038286
701 Ga0070709_10002559
702 Ga0070713_100010883
703 Ga0070713_100510205
704 Ga0070713_100763565
705 Ga0070710_10006923
706 Ga0070701_10034405
707 Ga0070701_10205054
708 Ga0070711_100008039
709 Ga0070711_100064351
710 Ga0070711_100229969
711 Ga0070711_100322042
712 Ga0070705_100000634
713 Ga0070705_100168742
714 Ga0070700_100003915
715 Ga0070700_100767110
716 Ga0070694_100000525
717 Ga0070694_100004520
718 Ga0070694_100005128
719 Ga0070708_100357901
720 Ga0070708_101019820
721 Ga0070678_100251309
722 Ga0070678_100261716
723 Ga0070678_100527344
724 Ga0070662_100455376
725 Ga0070681_10008638
726 Ga0070681_10017773
727 Ga0068867_100011521
728 Ga0068867_100016310
729 Ga0068867_100051617
730 Ga0068867_100119265
731 Ga0068867_100141744
732 Ga0070685_10023706
733 Ga0070685_10090680
734 Ga0070698_100002568
735 Ga0070698_100076493
736 Ga0070698_100320847
737 Ga0070699_100050745
738 Ga0070684_100171878
739 Ga0070697_100077491
740 Ga0070697_100323051
741 Ga0068853_100105655
742 Ga0068853_100337357
743 Ga0070672_100005659
744 Ga0070672_100056588
745 Ga0070672_100882285
746 Ga0070686_100028086
747 Ga0070686_100273089
748 Ga0070686_100493570
749 Ga0070695_100006616
750 Ga0070696_100003894
751 Ga0070696_100132970
752 Ga0070696_100197087
753 Ga0070696_100268337
754 Ga0070693_100000651
755 Ga0070693_100035683
756 Ga0070693_100297458
757 Ga0070704_100054890
758 Ga0070704_100163328
759 Ga0070704_100454672
760 Ga0070664_100014273
761 Ga0070664_100051458
762 Ga0068854_100168879
763 Ga0068854_100615957
764 Ga0068856_100005396
765 Ga0070702_100000990
766 Ga0070702_100151653
767 Ga0070702_100306666
768 Ga0068852_100470082
769 Ga0068859_100449454
770 Ga0068864_100003535
771 Ga0068864_100060307
772 Ga0068864_100248427
773 Ga0068866_10005164
774 Ga0068866_10108697
775 Ga0068866_10494602
776 Ga0068861_100270203
777 Ga0068870_10000331
778 Ga0068870_10000748
779 Ga0068860_100204429
780 Ga0068860_100761083
781 Ga0068862_100263699
782 Ga0081455_10000789
783 Ga0081455_10001696
784 Ga0081455_10172482
785 Ga0075432_10094061
786 Ga0070716_100038314
787 Ga0070712_100010561
788 Ga0070712_100074025
789 Ga0075427_10018144
790 Ga0097621_100133661
791 Ga0097621_100144244
792 Ga0097621_100708264
793 Ga0075428_100000216
794 Ga0075428_100101742
795 Ga0075430_100000111
796 Ga0075430_100009963
797 Ga0075430_100662157
798 Ga0075431_100000106
799 Ga0075431_100039128
800 Ga0075431_100141691
801 Ga0075433_10001680
802 Ga0075433_10054236
803 Ga0075434_100010656
804 Ga0075434_100012212
805 Ga0075434_100990726
806 Ga0075429_100000053
807 Ga0075429_100000760
808 Ga0075429_100139605
809 Ga0075429_100525995
810 Ga0075429_100826138
811 Ga0068865_100001196
812 Ga0068865_100037581
813 Ga0068865_100081849
814 Ga0068865_100162099
815 Ga0068865_100203842
816 Ga0075436_100001241
817 Ga0075436_100011573
818 Ga0075436_100021075
819 Ga0075436_100103151
820 Ga0097620_100449493
821 Ga0075435_100001537
822 Ga0075435_100041689
823 Ga0075435_100122238
824 Ga0075435_100178881
825 Ga0105244_10215139
826 Ga0105240_10072612
827 Ga0111539_10000137
828 Ga0111539_10021453
829 Ga0111539_10029925
830 Ga0111539_10078531
831 Ga0111539_10104207
832 Ga0105245_10040573
833 Ga0105245_10260853
834 Ga0114129_10000299
835 Ga0114129_10003280
836 Ga0114129_10008119
837 Ga0114129_10054930
838 Ga0114129_10326849
839 Ga0114129_10586673
840 Ga0114129_10745430
841 Ga0105241_10052121
842 Ga0105241_10100132
843 Ga0105241_10499287
844 Ga0105242_10062530
845 Ga0105242_10093064
846 Ga0105242_10235586
847 Ga0105249_10061811
848 Ga0105249_10217066
849 Ga0105239_10032554
850 Ga0105239_10143838
851 Ga0105239_10632264
852 Ga0105246_10004333
853 Ga0105246_10005177
854 Ga0105246_10123047
855 Ga0105246_10184728
856 Ga0105246_10229730
857 Ga0157340_1000149
858 Ga0157336_1000265
859 Ga0157328_1000082
860 Ga0157346_1000115
861 Ga0157337_1000039
862 Ga0157325_1000015
863 Ga0157321_1000004
864 Ga0157343_1000190
865 Ga0157341_1000019
866 Ga0157319_1000173
867 Ga0157345_1000208
868 Ga0157347_1000010
869 Ga0157313_1000012
870 Ga0157339_1000002
871 Ga0157342_1000002
872 Ga0157315_1000061
873 Ga0157316_1000034
874 Ga0157327_1000002
875 Ga0157326_1000092
876 Ga0157338_1000148
877 Ga0157371_10047925
878 Ga0157371_10139623
879 Ga0157374_10006453
880 Ga0157374_10014451
881 Ga0157374_10217999
882 Ga0157374_10242927
883 Ga0157378_10000805
884 Ga0157378_10002092
885 Ga0157378_10002894
886 Ga0157378_10111004
887 Ga0157378_10227707
888 Ga0163162_10286031
889 Ga0157372_10201415
890 Ga0157372_10565769
891 Ga0157372_11218316
892 Ga0157375_10079601
893 Ga0163163_10818887
894 Ga0163163_11265172
895 Ga0157380_10135040
896 Ga0157380_10666579
897 Ga0157377_10003465
898 Ga0157377_10014957
899 Ga0157379_10171633
900 Ga0157376_10117647
901 Ga0163161_10013855
902 Ga0206353_11852760
903 Ga0207697_10003909
904 Ga0207692_10049943
905 Ga0207692_10310030
906 Ga0207642_10324410
907 Ga0207688_10019341
908 Ga0207688_10047355
909 Ga0207647_10000349
910 Ga0207647_10002658
911 Ga0207647_10011834
912 Ga0207647_10040556
913 Ga0207699_10027536
914 Ga0207645_10000818
915 Ga0207645_10006677
916 Ga0207645_10067898
917 Ga0207645_10146582
918 Ga0207643_10000171
919 Ga0207643_10000281
920 Ga0207643_10000758
921 Ga0207643_10024573
922 Ga0207654_10014665
923 Ga0207654_10391175
924 Ga0207707_10052182
925 Ga0207707_10055104
926 Ga0207707_10269415
927 Ga0207707_10621644
928 Ga0207693_10001014
929 Ga0207693_10352463
930 Ga0207663_10013635
931 Ga0207663_10023427
932 Ga0207663_10063272
933 Ga0207663_10158057
934 Ga0207660_10005952
935 Ga0207660_10026930
936 Ga0207660_10099222
937 Ga0207660_10381147
938 Ga0207662_10001549
939 Ga0207662_10200512
940 Ga0207662_10267692
941 Ga0207657_10556262
942 Ga0207652_10022658
943 Ga0207681_10004812
944 Ga0207681_10526531
945 Ga0207650_10011333
946 Ga0207650_10026365
947 Ga0207659_10061623
948 Ga0207659_10072585
949 Ga0207700_10012231
950 Ga0207664_10626156
951 Ga0207644_10772508
952 Ga0207690_10031103
953 Ga0207690_10033686
954 Ga0207706_10002205
955 Ga0207706_10087972
956 Ga0207686_10079378
957 Ga0207686_10422309
958 Ga0207670_10584710
959 Ga0207704_10010200
960 Ga0207704_10225484
961 Ga0207704_10245181
962 Ga0207665_10001928
963 Ga0207691_10001101
964 Ga0207691_10021416
965 Ga0207691_10069244
966 Ga0207689_10000513
967 Ga0207689_10001534
968 Ga0207689_10219393
969 Ga0207689_10553724
970 Ga0207661_10108374
971 Ga0207661_10465125
972 Ga0207679_10032774
973 Ga0207679_10253127
974 Ga0207679_10614488
975 Ga0207651_10002976
976 Ga0207712_10010137
977 Ga0207712_10017246
978 Ga0207712_10102690
979 Ga0207668_10035102
980 Ga0207640_10029781
981 Ga0207640_10243120
982 Ga0207677_10015797
983 Ga0207677_10026896
984 Ga0207677_10065869
985 Ga0207639_10340913
986 Ga0207639_10698100
987 Ga0207708_10000160
988 Ga0207708_10004320
989 Ga0207708_10231555
990 Ga0207702_10311690
991 Ga0207648_10004476
992 Ga0207648_10006850
993 Ga0207648_10016288
994 Ga0207648_10061429
995 Ga0207676_10031724
996 Ga0207676_10325013
997 Ga0207674_10007897
998 Ga0207675_100183572
999 Ga0207675_100184160
1000 Ga0207683_10033817
1001 Ga0207683_10239657
1002 Ga0207698_10224691
1003 Ga0209973_1021439
1004 Ga0209969_1000277
1005 Ga0209967_1000066
1006 Ga0209967_1012433
1007 Ga0209981_1000023
1008 Ga0209996_1000213
1009 Ga0209984_1000029
1010 Ga0210000_1000189
1011 Ga0209995_1000211
1012 Ga0209968_1000367
1013 Ga0209999_1000715
1014 Ga0209982_1000658
1015 Ga0209970_1000212
1016 Ga0210002_1000157
1017 Ga0209983_1000333
1018 Ga0209983_1001482
1019 Ga0209971_1025227
1020 Ga0209998_10000849
1021 Ga0209998_10002293
1022 Ga0209974_10000671
1023 Ga0207428_10000136
1024 Ga0207428_10000194
1025 Ga0207428_10000202
1026 Ga0207428_10014773
1027 Ga0207428_10016347
1028 Ga0268265_10013196
1029 Ga0268264_10061073
1030 Ga0268264_10066955
1031 Ga0268264_10103058
1032 Ga0265337_1004604
1033 Ga0265326_10000122
1034 Ga0265326_10000238
1035 Ga0265322_10000025
1036 Ga0265336_10000367
1037 Ga0265336_10001101
1038 Ga0265338_10000252
1039 Ga0265338_10000447
1040 Ga0265324_10000190
1041 Ga0265324_10000357
1042 Ga0265328_10071072
1043 Ga0265320_10094589
1044 Ga0265325_10000038
1045 Ga0265340_10001405
1046 Ga0265340_10001597
1047 Ga0265339_10000569
1048 Ga0265339_10001631
1049 Ga0265331_10000114
1050 Ga0265331_10000140
1051 Ga0265316_10000537
1052 Ga0316575_10012096
1053 Ga0316579_10016438
1054 Ga0265314_10000667
1055 Ga0265342_10007714
1056 Ga0265342_10034234
1057 Ga0316576_10083724
1058 Ga0316578_10365542
1059 Ga0316583_10102243
1060 Ga0373948_0003338
1061 Ga0373959_0013798
1062 Ga0373929_0055803
1063 Ga0373949_0011674
1064 Ga0373939_0005577
1065 Ga0373941_0101028
1066 Ga0373960_0029949
1067 Ga0373942_0002265
1068 Ga0373961_0000792
1069 Ga0373962_0052815
1070 Ga0316574_0338540
1071 Ga0373931_0024607
1072 Ga0373927_0505962
1073 Ga0316582_0002337
1074 Ga0316584_0112191
1075 Ga0316581_0015091
1076 Ga0242420_011567
1077 Ga0242420_048232
1078 Ga0400489_61988
1079 Ga0439436_0016738
1080 Ga0439439_0125887
1081 Ga0439453_0000715
1082 Ga0439453_0011439
1083 Ga0451807_2093164
1084 Ga0439441_000096
1085 Ga0439443_001698
1086 Ga0439443_024691
1087 Ga0439445_0025488
1088 Ga0439448_0021728
1089 Ga0439448_0030745
1090 Ga0439432_015849
1091 Ga0439450_000304
1092 Ga0439451_004257
1093 Ga0439451_007268
1094 Ga0439451_057475
1095 Ga0439454_000182
1096 Ga0439454_019046
1097 Ga0439455_0005822
1098 Ga0439455_0017533
1099 Ga0439456_007286
1100 Ga0439462_0064446
1101 Ga0439463_000690
1102 Ga0439463_064523
1103 Ga0450915_002874
1104 Ga0450920_054333
1105 Ga0439446_0005742
1106 Ga0439434_0128107
1107 Ga0439435_0015718
1108 Ga0439435_0017456
1109 Ga0439444_0000055
1110 Ga0439464_0003391
1111 Ga0439460_0004717
1112 Ga0439460_0021803
1113 Ga0450893_0005113
1114 Ga0451577_0290376
1115 Ga0451577_0313559
1116 Ga0451577_0559591
1117 Ga0451577_0638884
1118 Ga0439440_0000695
1119 Ga0439440_0031829
1120 Ga0453684_0000209
1121 Ga0453684_0011179
1122 Ga0453684_0016247
1123 Ga0453684_0039518
1124 Ga0453684_0393522
1125 Ga0453684_0408042
1126 Ga0451576_0701228
1127 Ga0466967_0159870
1128 Ga0495607_0088664
1129 Ga0495656_0118176
1130 Ga0495659_0012244
1131 Ga0496102_0015346
1132 Ga0496102_1187544
1133 Ga0496103_0152542
1134 Ga0496103_0492824
1135 Ga0496104_0208222
1136 Ga0496105_0106724
1137 Ga0496106_0001781
1138 Ga0496106_0035260
1139 Ga0496106_0239571
1140 Ga0496107_0173562
1141 Ga0496108_0067423
1142 Ga0496108_0910139
1143 Ga0496109_0216769
1144 Ga0496109_0220292
1145 Ga0496110_0058742
1146 Ga0496111_0157469
1147 Ga0496112_0319263
1148 Ga0496113_0228495
1149 Ga0496114_0231403
1150 Ga0496115_0212143
1151 Ga0501031_0092877
1152 Ga0501031_0223077
1153 Ga0501031_0461303
1154 Ga0501036_0006389
1155 Ga0501036_0169590
1156 Ga0501036_0512777
1157 Ga0501037_0102241
1158 Ga0501037_0123364
1159 Ga0501039_0020661
1160 Ga0501039_0208748
1161 Ga0501039_0613941
1162 Ga0501040_0011578
1163 Ga0501040_0035048
1164 Ga0501041_0000178
1165 Ga0501041_0009273
1166 Ga0501041_0248926
1167 Ga0501042_0127146
1168 Ga0501042_0202951
1169 Ga0501042_0260665
1170 Ga0501042_0326020
1171 Ga0501043_0420030
1172 Ga0501043_0499066
1173 Ga0501046_0021636
1174 Ga0501046_0046309
1175 Ga0501046_0081026
1176 Ga0501046_0106592
1177 Ga0501046_0220310
1178 Ga0501048_0006905
1179 Ga0501048_0008467
1180 Ga0501048_0200690
1181 Ga0501067_0535386
1182 Ga0501068_0263936
1183 Ga0501071_0001982
1184 Ga0501071_0051480
1185 Ga0501071_0101765
1186 Ga0501072_0000385
1187 Ga0501072_0084738
1188 Ga0501072_0599040
1189 Ga0501072_0727338
1190 Ga0501074_0008693
1191 Ga0501075_0001577
1192 Ga0501076_0000139
1193 Ga0501076_0089364
1194 Ga0501076_0577508
1195 Ga0501077_0065896
1196 Ga0501077_0216256
1197 Ga0501079_0010447
1198 Ga0501079_0124095
1199 Ga0501079_0168735
1200 Ga0501080_0241634
1201 Ga0501081_0000879
1202 Ga0501081_0035958
1203 Ga0501044_0244899
1204 Ga0501045_0002181
1205 Ga0501045_0119403
1206 Ga0501045_0314150
1207 Ga0501045_0441315
1208 nmdc:mga05p37_1401_c1
1209 nmdc:mga05p37_143_c1
1210 nmdc:mga05p37_31663_c1
1211 nmdc:mga05p37_60869_c1
1212 nmdc:mga05p37_718110_c1
1213 nmdc:mga09592_132_c1
1214 nmdc:mga09592_2021_c1
1215 nmdc:mga09592_2347_c1
1216 nmdc:mga09592_90084_c1
1217 nmdc:mga0qj67_51333_c1
1218 nmdc:mga0qj67_56_c1
1219 nmdc:mga06r32_39248_c1
1220 nmdc:mga06r32_809_c1
1221 nmdc:mga06r32_817528_c1
1222 nmdc:mga08y16_14386_c1
1223 nmdc:mga08y16_375894_c1
1224 nmdc:mga08y16_454912_c1
1225 nmdc:mga08y16_519_c1
1226 nmdc:mga08y16_553_c1
1227 nmdc:mga08y16_86991_c1
1228 nmdc:mga0n895_268_c1
1229 nmdc:mga0n895_323503_c1
1230 nmdc:mga0n895_60722_c1
1231 nmdc:mga0rr50_114734_c1
1232 nmdc:mga0rr50_262297_c1
1233 nmdc:mga0rr50_847_c1
1234 nmdc:mga08x19_186533_c1
1235 nmdc:mga08x19_3385_c1
1236 nmdc:mga08x19_55912_c1
1237 nmdc:mga0a205_1108_c1
1238 nmdc:mga0a205_26692_c1
1239 nmdc:mga0a205_31773_c1
1240 nmdc:mga0a205_642509_c1
1241 Ga0501084_0003407
1242 Ga0501084_0148625
1243 Ga0590071_030144
1244 Ga0590074_030206
1245 Ga0501082_0000836
1246 Ga0501082_0370696
1247 Ga0530510_0000300
1248 Ga0530510_0055640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

28

209

0.88

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

35

210

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kl7-assembly1.cif.gz_A crystal structure of putative metal-dependent hydrolase (yp_001302908.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution 0.8869 7 217
7e3w-assembly1.cif.gz_C metallo beta-lactamase fold protein (camp bound) 0.8423 7 214
3kl7-assembly1.cif.gz_A crystal structure of putative metal-dependent hydrolase (yp_001302908.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution 0.8403 7 217
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.8289 6 215
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8282 6 215
ID Description Score Start End Superfamily
3kl7A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8895 7 217 3.60.15.10
af_Q8ILT3_120_417_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8338 1 217 3.60.15.10
3kl7A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8308 7 217 3.60.15.10
af_Q8ILT3_120_417_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8303 1 217 3.60.15.10
af_Q2FXM0_1_229_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8246 9 214 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A6G1YQI3-F1-model_v4 MBL fold metallo-hydrolase 0.9828 1 176 GO:0016787
AF-A0A533UG20-F1-model_v4 MBL fold metallo-hydrolase 0.972 151 217 GO:0016787
AF-A0A151BCB8-F1-model_v4 MBL fold metallo-hydrolase 0.9711 92 217
AF-A0A1V5YIJ3-F1-model_v4 Metal-dependent hydrolase 0.968 8 215 GO:0016787
AF-A0A838N5I2-F1-model_v4 deleted 0.9671 1 217

Map