F470162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 623 | 350 | 1246 | 89 |
Family's Representative Sequence
| Representative Sequence | 3300005330|Ga0070690_101248346|Ga0070690_1012483461 |
| Length | 90 |
| Sequence | MALASEAKGKVITQFRVHKSDTGSPEVQVAILTRRISELSEQHFKTHQKDHHSRRGLLQMVARRRRLLDYLRSRSPERYKALIQSLGIRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 207 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 211 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 212 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 215 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 216 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 217 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 218 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 228 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 229 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 301 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 345 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 346 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 348 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.39 |
| Metatranscriptomes | 1.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.8 |
| Nodule | 0 |
| Rhizoplane | 1.28 |
| Rhizosphere | 94.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_101248346 | 3300005330 | Unclassified | 594 |
| 2 | rootH1_10061034 | 3300003323 | Bacteria | 2548 |
| 3 | Ga0065714_10445553 | 3300005288 | Unclassified | 557 |
| 4 | Ga0065712_10029910 | 3300005290 | Bacteria | 1207 |
| 5 | Ga0065715_10737414 | 3300005293 | Unclassified | 636 |
| 6 | Ga0070683_100085009 | 3300005329 | Bacteria | 2965 |
| 7 | Ga0070683_100153085 | 3300005329 | Bacteria | 2186 |
| 8 | Ga0070683_100172755 | 3300005329 | Bacteria | 2051 |
| 9 | Ga0070690_101425027 | 3300005330 | Unclassified | 558 |
| 10 | Ga0070690_101506621 | 3300005330 | Unclassified | 543 |
| 11 | Ga0068869_100654984 | 3300005334 | Bacteria | 892 |
| 12 | Ga0068869_100796552 | 3300005334 | Bacteria | 812 |
| 13 | Ga0070666_10002588 | 3300005335 | Bacteria | 10931 |
| 14 | Ga0070680_100043677 | 3300005336 | Bacteria | 3640 |
| 15 | Ga0070680_100327735 | 3300005336 | Bacteria | 1300 |
| 16 | Ga0070680_101068321 | 3300005336 | Bacteria | 697 |
| 17 | Ga0070682_101394396 | 3300005337 | Unclassified | 599 |
| 18 | Ga0068868_100685153 | 3300005338 | Bacteria | 916 |
| 19 | Ga0068868_101048903 | 3300005338 | Unclassified | 748 |
| 20 | Ga0070660_100594859 | 3300005339 | Bacteria | 925 |
| 21 | Ga0070689_100056685 | 3300005340 | Bacteria | 3039 |
| 22 | Ga0070689_100810008 | 3300005340 | Bacteria | 824 |
| 23 | Ga0070689_101515570 | 3300005340 | Bacteria | 607 |
| 24 | Ga0070689_102163570 | 3300005340 | Unclassified | 510 |
| 25 | Ga0070691_10259116 | 3300005341 | Bacteria | 935 |
| 26 | Ga0070687_101006215 | 3300005343 | Unclassified | 604 |
| 27 | Ga0070661_100636796 | 3300005344 | Bacteria | 864 |
| 28 | Ga0070692_10108356 | 3300005345 | Bacteria | 1533 |
| 29 | Ga0070692_10843919 | 3300005345 | Bacteria | 629 |
| 30 | Ga0070669_101061070 | 3300005353 | Bacteria | 697 |
| 31 | Ga0070674_100445112 | 3300005356 | Bacteria | 1068 |
| 32 | Ga0070688_100110555 | 3300005365 | Bacteria | 1827 |
| 33 | Ga0070667_101296150 | 3300005367 | Unclassified | 682 |
| 34 | Ga0070703_10117670 | 3300005406 | Bacteria | 960 |
| 35 | Ga0070709_10129474 | 3300005434 | Bacteria | 1721 |
| 36 | Ga0070709_10591074 | 3300005434 | Bacteria | 854 |
| 37 | Ga0070709_11142047 | 3300005434 | Bacteria | 624 |
| 38 | Ga0070714_100304687 | 3300005435 | Bacteria | 1486 |
| 39 | Ga0070713_100035103 | 3300005436 | Bacteria | 4034 |
| 40 | Ga0070713_101655167 | 3300005436 | Bacteria | 621 |
| 41 | Ga0070710_10646834 | 3300005437 | Unclassified | 741 |
| 42 | Ga0070701_10004174 | 3300005438 | Bacteria | 5811 |
| 43 | Ga0070711_100363166 | 3300005439 | Bacteria | 1167 |
| 44 | Ga0070705_100050376 | 3300005440 | Bacteria | 2422 |
| 45 | Ga0070705_100698059 | 3300005440 | Bacteria | 797 |
| 46 | Ga0070705_100810437 | 3300005440 | Bacteria | 746 |
| 47 | Ga0070705_101580987 | 3300005440 | Bacteria | 551 |
| 48 | Ga0070700_100066358 | 3300005441 | Bacteria | 2290 |
| 49 | Ga0070694_100409152 | 3300005444 | Bacteria | 1064 |
| 50 | Ga0070694_100803964 | 3300005444 | Unclassified | 771 |
| 51 | Ga0070681_10049531 | 3300005458 | Bacteria | 4194 |
| 52 | Ga0070681_10202479 | 3300005458 | Bacteria | 1903 |
| 53 | Ga0068867_100187691 | 3300005459 | Bacteria | 1648 |
| 54 | Ga0068867_102295859 | 3300005459 | Unclassified | 513 |
| 55 | Ga0070706_100782380 | 3300005467 | Bacteria | 884 |
| 56 | Ga0070707_100008321 | 3300005468 | Bacteria | 9629 |
| 57 | Ga0070707_100070336 | 3300005468 | Bacteria | 3371 |
| 58 | Ga0070698_100011424 | 3300005471 | Bacteria | 9420 |
| 59 | Ga0070699_100088570 | 3300005518 | Bacteria | 2703 |
| 60 | Ga0070699_102057724 | 3300005518 | Unclassified | 522 |
| 61 | Ga0070679_100297459 | 3300005530 | Bacteria | 1565 |
| 62 | Ga0070679_100374049 | 3300005530 | Bacteria | 1371 |
| 63 | Ga0070679_100552958 | 3300005530 | Bacteria | 1095 |
| 64 | Ga0070684_100063137 | 3300005535 | Bacteria | 3246 |
| 65 | Ga0070684_100087577 | 3300005535 | Bacteria | 2765 |
| 66 | Ga0070684_100692493 | 3300005535 | Unclassified | 950 |
| 67 | Ga0070697_100385824 | 3300005536 | Bacteria | 1214 |
| 68 | Ga0070697_100652243 | 3300005536 | Bacteria | 927 |
| 69 | Ga0070697_101184271 | 3300005536 | Bacteria | 681 |
| 70 | Ga0068853_100075517 | 3300005539 | Bacteria | 2941 |
| 71 | Ga0068853_100351216 | 3300005539 | Bacteria | 1372 |
| 72 | Ga0068853_100393178 | 3300005539 | Bacteria | 1296 |
| 73 | Ga0070672_101237413 | 3300005543 | Unclassified | 666 |
| 74 | Ga0070686_100308323 | 3300005544 | Bacteria | 1176 |
| 75 | Ga0070695_100303085 | 3300005545 | Bacteria | 1182 |
| 76 | Ga0070695_100417804 | 3300005545 | Bacteria | 1020 |
| 77 | Ga0070696_100508598 | 3300005546 | Bacteria | 959 |
| 78 | Ga0070696_100510108 | 3300005546 | Unclassified | 958 |
| 79 | Ga0070693_100088966 | 3300005547 | Bacteria | 1858 |
| 80 | Ga0070693_100135831 | 3300005547 | Bacteria | 1543 |
| 81 | Ga0070693_101310959 | 3300005547 | Unclassified | 560 |
| 82 | Ga0070665_100043320 | 3300005548 | Bacteria | 4523 |
| 83 | Ga0070665_102112399 | 3300005548 | Bacteria | 568 |
| 84 | Ga0070704_100037953 | 3300005549 | Bacteria | 3295 |
| 85 | Ga0070704_100167470 | 3300005549 | Bacteria | 1744 |
| 86 | Ga0070704_100181822 | 3300005549 | Bacteria | 1682 |
| 87 | Ga0070704_100931483 | 3300005549 | Bacteria | 783 |
| 88 | Ga0068855_100027852 | 3300005563 | Bacteria | 6759 |
| 89 | Ga0070664_100626405 | 3300005564 | Bacteria | 999 |
| 90 | Ga0070664_101161990 | 3300005564 | Bacteria | 728 |
| 91 | Ga0068857_100003138 | 3300005577 | Bacteria | 13678 |
| 92 | Ga0068857_101533563 | 3300005577 | Unclassified | 650 |
| 93 | Ga0068854_101364682 | 3300005578 | Unclassified | 640 |
| 94 | Ga0068856_100060941 | 3300005614 | Bacteria | 3727 |
| 95 | Ga0068856_100093928 | 3300005614 | Bacteria | 2985 |
| 96 | Ga0068852_100165566 | 3300005616 | Bacteria | 2068 |
| 97 | Ga0068852_100802611 | 3300005616 | Bacteria | 955 |
| 98 | Ga0068859_100185648 | 3300005617 | Bacteria | 2163 |
| 99 | Ga0068859_100605384 | 3300005617 | Bacteria | 1189 |
| 100 | Ga0068859_101331433 | 3300005617 | Unclassified | 792 |
| 101 | Ga0068861_100286927 | 3300005719 | Bacteria | 1420 |
| 102 | Ga0068861_101266412 | 3300005719 | Unclassified | 716 |
| 103 | Ga0068870_10451764 | 3300005840 | Unclassified | 847 |
| 104 | Ga0068870_10600464 | 3300005840 | Bacteria | 748 |
| 105 | Ga0068863_100025272 | 3300005841 | Bacteria | 5661 |
| 106 | Ga0068863_101424533 | 3300005841 | Bacteria | 701 |
| 107 | Ga0068858_100153960 | 3300005842 | Bacteria | 2163 |
| 108 | Ga0068858_100176886 | 3300005842 | Bacteria | 2014 |
| 109 | Ga0068858_101497454 | 3300005842 | Unclassified | 665 |
| 110 | Ga0068860_102615557 | 3300005843 | Bacteria | 524 |
| 111 | Ga0068862_100070739 | 3300005844 | Bacteria | 3012 |
| 112 | Ga0068862_101256395 | 3300005844 | Unclassified | 740 |
| 113 | Ga0068862_102421582 | 3300005844 | Unclassified | 537 |
| 114 | Ga0081540_1040597 | 3300005983 | Bacteria | 2423 |
| 115 | Ga0070717_10006427 | 3300006028 | Bacteria | 8645 |
| 116 | Ga0070717_10475384 | 3300006028 | Unclassified | 1128 |
| 117 | Ga0070715_10769041 | 3300006163 | Bacteria | 582 |
| 118 | Ga0070712_100800317 | 3300006175 | Unclassified | 809 |
| 119 | Ga0070712_101511376 | 3300006175 | Unclassified | 587 |
| 120 | Ga0097621_100063115 | 3300006237 | Bacteria | 3044 |
| 121 | Ga0097621_100105483 | 3300006237 | Bacteria | 2376 |
| 122 | Ga0097621_100467175 | 3300006237 | Bacteria | 1139 |
| 123 | Ga0097621_101935548 | 3300006237 | Bacteria | 563 |
| 124 | Ga0068871_100016154 | 3300006358 | Bacteria | 5611 |
| 125 | Ga0068871_100362546 | 3300006358 | Bacteria | 1284 |
| 126 | Ga0068871_100362720 | 3300006358 | Bacteria | 1284 |
| 127 | Ga0068871_100611627 | 3300006358 | Bacteria | 992 |
| 128 | Ga0075428_102078164 | 3300006844 | Bacteria | 588 |
| 129 | Ga0075430_100026446 | 3300006846 | Bacteria | 4937 |
| 130 | Ga0075431_100029249 | 3300006847 | Bacteria | 5670 |
| 131 | Ga0075433_10117111 | 3300006852 | Bacteria | 2364 |
| 132 | Ga0075429_100112856 | 3300006880 | Bacteria | 2375 |
| 133 | Ga0068865_100047930 | 3300006881 | Bacteria | 2939 |
| 134 | Ga0068865_101163567 | 3300006881 | Unclassified | 681 |
| 135 | Ga0068865_101787402 | 3300006881 | Unclassified | 555 |
| 136 | Ga0075436_100148030 | 3300006914 | Bacteria | 1651 |
| 137 | Ga0075436_100967950 | 3300006914 | Unclassified | 638 |
| 138 | Ga0097620_100185660 | 3300006931 | Bacteria | 2163 |
| 139 | Ga0097620_100605419 | 3300006931 | Bacteria | 1189 |
| 140 | Ga0097620_101331568 | 3300006931 | Unclassified | 792 |
| 141 | Ga0075435_100234612 | 3300007076 | Bacteria | 1559 |
| 142 | Ga0105250_10000023 | 3300009092 | Bacteria | 219389 |
| 143 | Ga0105240_10082039 | 3300009093 | Bacteria | 3961 |
| 144 | Ga0105240_10138099 | 3300009093 | Bacteria | 2917 |
| 145 | Ga0105240_11571579 | 3300009093 | Bacteria | 689 |
| 146 | Ga0105240_11928791 | 3300009093 | Unclassified | 614 |
| 147 | Ga0111539_10540222 | 3300009094 | Bacteria | 1358 |
| 148 | Ga0111539_11355800 | 3300009094 | Bacteria | 825 |
| 149 | Ga0105245_10120023 | 3300009098 | Bacteria | 2455 |
| 150 | Ga0105245_10375455 | 3300009098 | Bacteria | 1415 |
| 151 | Ga0105245_11057978 | 3300009098 | Bacteria | 857 |
| 152 | Ga0105247_10608462 | 3300009101 | Bacteria | 811 |
| 153 | Ga0105243_10141367 | 3300009148 | Bacteria | 2054 |
| 154 | Ga0105243_10639702 | 3300009148 | Bacteria | 1029 |
| 155 | Ga0105243_12337691 | 3300009148 | Bacteria | 572 |
| 156 | Ga0105241_10033993 | 3300009174 | Bacteria | 3830 |
| 157 | Ga0105241_10505202 | 3300009174 | Unclassified | 1079 |
| 158 | Ga0105241_12242040 | 3300009174 | Bacteria | 542 |
| 159 | Ga0105242_10204335 | 3300009176 | Bacteria | 1756 |
| 160 | Ga0105242_11039728 | 3300009176 | Unclassified | 829 |
| 161 | Ga0105248_10280305 | 3300009177 | Bacteria | 1876 |
| 162 | Ga0105248_10860228 | 3300009177 | Unclassified | 1024 |
| 163 | Ga0105248_10944338 | 3300009177 | Bacteria | 974 |
| 164 | Ga0105248_13090241 | 3300009177 | Unclassified | 530 |
| 165 | Ga0105237_10150041 | 3300009545 | Bacteria | 2327 |
| 166 | Ga0105237_10164766 | 3300009545 | Bacteria | 2215 |
| 167 | Ga0105237_10540165 | 3300009545 | Bacteria | 1172 |
| 168 | Ga0105238_10073701 | 3300009551 | Bacteria | 3408 |
| 169 | Ga0105238_10109536 | 3300009551 | Bacteria | 2743 |
| 170 | Ga0105238_10136968 | 3300009551 | Bacteria | 2426 |
| 171 | Ga0105238_10731332 | 3300009551 | Bacteria | 1003 |
| 172 | Ga0105238_10901169 | 3300009551 | Bacteria | 903 |
| 173 | Ga0105249_10009953 | 3300009553 | Bacteria | 8341 |
| 174 | Ga0105249_13575480 | 3300009553 | Unclassified | 501 |
| 175 | Ga0105239_10001958 | 3300010375 | Bacteria | 26796 |
| 176 | Ga0105239_10069918 | 3300010375 | Bacteria | 3856 |
| 177 | Ga0105239_10458454 | 3300010375 | Bacteria | 1447 |
| 178 | Ga0105239_11216219 | 3300010375 | Bacteria | 868 |
| 179 | Ga0105239_11426562 | 3300010375 | Bacteria | 799 |
| 180 | Ga0105239_12662420 | 3300010375 | Bacteria | 583 |
| 181 | Ga0105246_10386073 | 3300011119 | Bacteria | 1159 |
| 182 | Ga0157373_11078847 | 3300013100 | Bacteria | 602 |
| 183 | Ga0157371_10594385 | 3300013102 | Bacteria | 823 |
| 184 | Ga0157370_10018228 | 3300013104 | Bacteria | 7063 |
| 185 | Ga0157370_11458361 | 3300013104 | Unclassified | 615 |
| 186 | Ga0157369_10002232 | 3300013105 | Bacteria | 23326 |
| 187 | Ga0157374_10152442 | 3300013296 | Bacteria | 2248 |
| 188 | Ga0157374_10878110 | 3300013296 | Bacteria | 914 |
| 189 | Ga0157374_10894648 | 3300013296 | Unclassified | 905 |
| 190 | Ga0157378_10324026 | 3300013297 | Bacteria | 1498 |
| 191 | Ga0157378_10521950 | 3300013297 | Bacteria | 1189 |
| 192 | Ga0157378_10784797 | 3300013297 | Bacteria | 977 |
| 193 | Ga0163162_10241032 | 3300013306 | Unclassified | 1939 |
| 194 | Ga0163162_12095291 | 3300013306 | Bacteria | 649 |
| 195 | Ga0157372_10323656 | 3300013307 | Unclassified | 1795 |
| 196 | Ga0157372_11186769 | 3300013307 | Bacteria | 882 |
| 197 | Ga0163163_10027913 | 3300014325 | Bacteria | 5412 |
| 198 | Ga0163163_10030211 | 3300014325 | Bacteria | 5218 |
| 199 | Ga0163163_11904260 | 3300014325 | Bacteria | 655 |
| 200 | Ga0157380_10044650 | 3300014326 | Bacteria | 3474 |
| 201 | Ga0157380_10060164 | 3300014326 | Bacteria | 3034 |
| 202 | Ga0157380_10310558 | 3300014326 | Bacteria | 1457 |
| 203 | Ga0157380_11330284 | 3300014326 | Unclassified | 767 |
| 204 | Ga0157377_10323378 | 3300014745 | Bacteria | 1026 |
| 205 | Ga0157377_10983688 | 3300014745 | Bacteria | 637 |
| 206 | Ga0157379_10000481 | 3300014968 | Bacteria | 32319 |
| 207 | Ga0157379_10521513 | 3300014968 | Bacteria | 1103 |
| 208 | Ga0157376_10773013 | 3300014969 | Bacteria | 971 |
| 209 | Ga0197907_11276312 | 3300020069 | Bacteria | 861 |
| 210 | Ga0206356_11385276 | 3300020070 | Bacteria | 1241 |
| 211 | Ga0206349_1073855 | 3300020075 | Bacteria | 538 |
| 212 | Ga0206352_10825994 | 3300020078 | Bacteria | 557 |
| 213 | Ga0213873_10077291 | 3300021358 | Bacteria | 926 |
| 214 | Ga0213874_10454125 | 3300021377 | Unclassified | 506 |
| 215 | Ga0213876_10071971 | 3300021384 | Bacteria | 1826 |
| 216 | Ga0213876_10304994 | 3300021384 | Unclassified | 846 |
| 217 | Ga0213875_10137678 | 3300021388 | Unclassified | 1142 |
| 218 | Ga0213875_10294347 | 3300021388 | Unclassified | 767 |
| 219 | Ga0224712_10472686 | 3300022467 | Unclassified | 604 |
| 220 | Ga0207696_1000098 | 3300025711 | Bacteria | 175181 |
| 221 | Ga0207680_10035215 | 3300025903 | Bacteria | 2872 |
| 222 | Ga0207685_10847718 | 3300025905 | Unclassified | 506 |
| 223 | Ga0207699_10234746 | 3300025906 | Bacteria | 1258 |
| 224 | Ga0207684_10686972 | 3300025910 | Bacteria | 870 |
| 225 | Ga0207654_10048684 | 3300025911 | Bacteria | 2427 |
| 226 | Ga0207654_10311708 | 3300025911 | Unclassified | 1073 |
| 227 | Ga0207654_10316692 | 3300025911 | Bacteria | 1065 |
| 228 | Ga0207707_10001936 | 3300025912 | Bacteria | 18832 |
| 229 | Ga0207707_10199439 | 3300025912 | Bacteria | 1745 |
| 230 | Ga0207707_10289740 | 3300025912 | Bacteria | 1417 |
| 231 | Ga0207695_10006278 | 3300025913 | Bacteria | 15474 |
| 232 | Ga0207695_10095111 | 3300025913 | Bacteria | 2985 |
| 233 | Ga0207695_10169747 | 3300025913 | Bacteria | 2108 |
| 234 | Ga0207671_10096342 | 3300025914 | Bacteria | 2236 |
| 235 | Ga0207671_10342511 | 3300025914 | Bacteria | 1185 |
| 236 | Ga0207671_10971850 | 3300025914 | Bacteria | 670 |
| 237 | Ga0207693_10298481 | 3300025915 | Bacteria | 1262 |
| 238 | Ga0207663_11524304 | 3300025916 | Bacteria | 538 |
| 239 | Ga0207660_10058144 | 3300025917 | Bacteria | 2771 |
| 240 | Ga0207662_10356456 | 3300025918 | Unclassified | 983 |
| 241 | Ga0207657_10622555 | 3300025919 | Unclassified | 841 |
| 242 | Ga0207649_10911441 | 3300025920 | Bacteria | 689 |
| 243 | Ga0207652_10040380 | 3300025921 | Bacteria | 3962 |
| 244 | Ga0207652_11905090 | 3300025921 | Unclassified | 500 |
| 245 | Ga0207646_10000120 | 3300025922 | Bacteria | 106913 |
| 246 | Ga0207646_10061496 | 3300025922 | Bacteria | 3352 |
| 247 | Ga0207681_10776050 | 3300025923 | Unclassified | 800 |
| 248 | Ga0207694_10037701 | 3300025924 | Bacteria | 3714 |
| 249 | Ga0207694_10143597 | 3300025924 | Bacteria | 1920 |
| 250 | Ga0207694_10277945 | 3300025924 | Bacteria | 1375 |
| 251 | Ga0207694_10341527 | 3300025924 | Bacteria | 1238 |
| 252 | Ga0207694_11384289 | 3300025924 | Bacteria | 595 |
| 253 | Ga0207650_10293711 | 3300025925 | Bacteria | 1326 |
| 254 | Ga0207659_10069889 | 3300025926 | Bacteria | 2559 |
| 255 | Ga0207687_10030384 | 3300025927 | Bacteria | 3643 |
| 256 | Ga0207687_10448720 | 3300025927 | Bacteria | 1069 |
| 257 | Ga0207687_10781202 | 3300025927 | Bacteria | 814 |
| 258 | Ga0207687_11479639 | 3300025927 | Bacteria | 583 |
| 259 | Ga0207700_10801935 | 3300025928 | Bacteria | 842 |
| 260 | Ga0207686_10354939 | 3300025934 | Bacteria | 1105 |
| 261 | Ga0207686_10427279 | 3300025934 | Bacteria | 1015 |
| 262 | Ga0207709_10187516 | 3300025935 | Bacteria | 1466 |
| 263 | Ga0207709_11106714 | 3300025935 | Bacteria | 651 |
| 264 | Ga0207670_10073655 | 3300025936 | Unclassified | 2369 |
| 265 | Ga0207669_11059521 | 3300025937 | Bacteria | 683 |
| 266 | Ga0207669_11381688 | 3300025937 | Bacteria | 599 |
| 267 | Ga0207704_10502549 | 3300025938 | Bacteria | 977 |
| 268 | Ga0207704_10732311 | 3300025938 | Unclassified | 821 |
| 269 | Ga0207665_10318813 | 3300025939 | Bacteria | 1166 |
| 270 | Ga0207665_11322168 | 3300025939 | Unclassified | 574 |
| 271 | Ga0207691_10519278 | 3300025940 | Bacteria | 1011 |
| 272 | Ga0207711_10014953 | 3300025941 | Bacteria | 6446 |
| 273 | Ga0207711_10716756 | 3300025941 | Bacteria | 933 |
| 274 | Ga0207711_10906700 | 3300025941 | Bacteria | 819 |
| 275 | Ga0207711_11882090 | 3300025941 | Unclassified | 541 |
| 276 | Ga0207689_10235650 | 3300025942 | Bacteria | 1513 |
| 277 | Ga0207661_10013838 | 3300025944 | Bacteria | 5896 |
| 278 | Ga0207661_10025358 | 3300025944 | Bacteria | 4505 |
| 279 | Ga0207661_11227820 | 3300025944 | Bacteria | 689 |
| 280 | Ga0207679_11414742 | 3300025945 | Unclassified | 638 |
| 281 | Ga0207667_10000607 | 3300025949 | Bacteria | 46284 |
| 282 | Ga0207667_10015413 | 3300025949 | Bacteria | 8686 |
| 283 | Ga0207667_11330802 | 3300025949 | Unclassified | 694 |
| 284 | Ga0207651_10480896 | 3300025960 | Bacteria | 1070 |
| 285 | Ga0207640_11919464 | 3300025981 | Unclassified | 536 |
| 286 | Ga0207658_11363661 | 3300025986 | Bacteria | 649 |
| 287 | Ga0207677_10993254 | 3300026023 | Bacteria | 761 |
| 288 | Ga0207677_12182237 | 3300026023 | Unclassified | 515 |
| 289 | Ga0207703_10128613 | 3300026035 | Bacteria | 2184 |
| 290 | Ga0207703_11231531 | 3300026035 | Unclassified | 720 |
| 291 | Ga0207639_10128307 | 3300026041 | Bacteria | 2095 |
| 292 | Ga0207639_10756396 | 3300026041 | Bacteria | 904 |
| 293 | Ga0207678_11444898 | 3300026067 | Bacteria | 608 |
| 294 | Ga0207708_10059502 | 3300026075 | Bacteria | 2916 |
| 295 | Ga0207702_10035194 | 3300026078 | Bacteria | 4187 |
| 296 | Ga0207702_10527332 | 3300026078 | Bacteria | 1153 |
| 297 | Ga0207641_10014631 | 3300026088 | Bacteria | 6433 |
| 298 | Ga0207648_10517096 | 3300026089 | Unclassified | 1093 |
| 299 | Ga0207648_10916257 | 3300026089 | Bacteria | 819 |
| 300 | Ga0207676_10358681 | 3300026095 | Unclassified | 1350 |
| 301 | Ga0207676_10872659 | 3300026095 | Bacteria | 881 |
| 302 | Ga0207674_10000109 | 3300026116 | Bacteria | 94920 |
| 303 | Ga0207675_100003060 | 3300026118 | Bacteria | 16403 |
| 304 | Ga0207675_101220555 | 3300026118 | Unclassified | 772 |
| 305 | Ga0207683_10507873 | 3300026121 | Bacteria | 1113 |
| 306 | Ga0207698_10541549 | 3300026142 | Bacteria | 1139 |
| 307 | Ga0207698_10599983 | 3300026142 | Bacteria | 1085 |
| 308 | Ga0207698_11401449 | 3300026142 | Bacteria | 714 |
| 309 | Ga0209968_1042155 | 3300027526 | Bacteria | 782 |
| 310 | Ga0210002_1023344 | 3300027617 | Bacteria | 1006 |
| 311 | Ga0209971_1061042 | 3300027682 | Bacteria | 913 |
| 312 | Ga0209966_1067015 | 3300027695 | Unclassified | 782 |
| 313 | Ga0209966_1071415 | 3300027695 | Unclassified | 761 |
| 314 | Ga0209974_10266042 | 3300027876 | Unclassified | 649 |
| 315 | Ga0268266_10055084 | 3300028379 | Bacteria | 3418 |
| 316 | Ga0268266_10430782 | 3300028379 | Bacteria | 1251 |
| 317 | Ga0268266_10561830 | 3300028379 | Unclassified | 1094 |
| 318 | Ga0268265_10644543 | 3300028380 | Bacteria | 1017 |
| 319 | Ga0268265_11410368 | 3300028380 | Unclassified | 699 |
| 320 | Ga0268265_11874239 | 3300028380 | Unclassified | 606 |
| 321 | Ga0265330_10346338 | 3300031235 | Bacteria | 627 |
| 322 | Ga0265332_10013335 | 3300031238 | Bacteria | 3643 |
| 323 | Ga0265320_10357381 | 3300031240 | Unclassified | 645 |
| 324 | Ga0265325_10004035 | 3300031241 | Bacteria | 9372 |
| 325 | Ga0265340_10036224 | 3300031247 | Bacteria | 2446 |
| 326 | Ga0265340_10066253 | 3300031247 | Bacteria | 1719 |
| 327 | Ga0265340_10097411 | 3300031247 | Bacteria | 1370 |
| 328 | Ga0265316_10892758 | 3300031344 | Bacteria | 621 |
| 329 | Ga0307408_100340967 | 3300031548 | Bacteria | 1268 |
| 330 | Ga0265314_10009858 | 3300031711 | Bacteria | 8017 |
| 331 | Ga0265342_10029099 | 3300031712 | Bacteria | 3434 |
| 332 | Ga0307407_10899191 | 3300031903 | Bacteria | 679 |
| 333 | Ga0307407_11601805 | 3300031903 | Bacteria | 517 |
| 334 | Ga0307412_10243473 | 3300031911 | Bacteria | 1392 |
| 335 | Ga0307409_102964351 | 3300031995 | Bacteria | 501 |
| 336 | Ga0307416_103336825 | 3300032002 | Unclassified | 537 |
| 337 | Ga0316593_10446480 | 3300032168 | Unclassified | 504 |
| 338 | Ga0316592_1058432 | 3300033524 | Bacteria | 865 |
| 339 | Ga0316588_1166256 | 3300033528 | Bacteria | 569 |
| 340 | Ga0316596_1178173 | 3300033541 | Bacteria | 588 |
| 341 | Ga0373926_0069778 | 3300035083 | Bacteria | 1290 |
| 342 | Ga0373926_0337667 | 3300035083 | Unclassified | 591 |
| 343 | Ga0373934_0002687 | 3300035086 | Bacteria | 6531 |
| 344 | Ga0373939_0239172 | 3300035114 | Unclassified | 702 |
| 345 | Ga0373953_0079446 | 3300035117 | Bacteria | 1362 |
| 346 | Ga0373954_0010632 | 3300035118 | Bacteria | 4064 |
| 347 | Ga0373956_0531184 | 3300035119 | Unclassified | 561 |
| 348 | Ga0373957_0185475 | 3300035120 | Bacteria | 863 |
| 349 | Ga0373946_0054691 | 3300035171 | Bacteria | 1681 |
| 350 | Ga0373955_0266711 | 3300035172 | Bacteria | 1029 |
| 351 | Ga0373955_0365278 | 3300035172 | Unclassified | 875 |
| 352 | Ga0316574_0867064 | 3300035398 | Bacteria | 547 |
| 353 | Ga0373924_0120570 | 3300035410 | Bacteria | 1138 |
| 354 | Ga0373935_0138382 | 3300035692 | Bacteria | 1643 |
| 355 | Ga0373935_0523846 | 3300035692 | Unclassified | 862 |
| 356 | Ga0373935_0633741 | 3300035692 | Unclassified | 783 |
| 357 | Ga0373927_0001127 | 3300035695 | Bacteria | 20245 |
| 358 | Ga0373927_0055836 | 3300035695 | Bacteria | 2553 |
| 359 | Ga0373927_0185962 | 3300035695 | Bacteria | 1363 |
| 360 | Ga0373933_0100299 | 3300035724 | Bacteria | 1796 |
| 361 | Ga0373933_0419722 | 3300035724 | Bacteria | 874 |
| 362 | Ga0373947_0289370 | 3300035725 | Bacteria | 1091 |
| 363 | Ga0373937_0018115 | 3300036401 | Bacteria | 6283 |
| 364 | Ga0373937_0354475 | 3300036401 | Bacteria | 1390 |
| 365 | Ga0373937_0372172 | 3300036401 | Unclassified | 1354 |
| 366 | Ga0373937_1808561 | 3300036401 | Unclassified | 557 |
| 367 | Ga0373925_0231302 | 3300037068 | Bacteria | 1478 |
| 368 | Ga0373925_0393813 | 3300037068 | Bacteria | 1129 |
| 369 | Ga0436364_0532759 | 3300037853 | Bacteria | 654 |
| 370 | Ga0436364_0871666 | 3300037853 | Bacteria | 5903 |
| 371 | Ga0436364_1065030 | 3300037853 | Bacteria | 28547 |
| 372 | Ga0400488_05905 | 3300038741 | Bacteria | 5115 |
| 373 | Ga0400486_32002 | 3300038742 | Bacteria | 1473 |
| 374 | Ga0436365_0743184 | 3300039437 | Bacteria | 1581 |
| 375 | Ga0436365_0747166 | 3300039437 | Bacteria | 2242 |
| 376 | Ga0436365_1289444 | 3300039437 | Unclassified | 614 |
| 377 | Ga0436360_1232892 | 3300039438 | Bacteria | 516 |
| 378 | Ga0436361_0986177 | 3300039447 | Unclassified | 630 |
| 379 | Ga0436363_0140569 | 3300039450 | Bacteria | 1730 |
| 380 | Ga0436363_0623487 | 3300039450 | Unclassified | 511 |
| 381 | Ga0436362_0319347 | 3300039453 | Bacteria | 1317 |
| 382 | Ga0436362_0438712 | 3300039453 | Bacteria | 530 |
| 383 | Ga0436362_0817548 | 3300039453 | Unclassified | 822 |
| 384 | Ga0436362_1273971 | 3300039453 | Bacteria | 1270 |
| 385 | Ga0451807_0367934 | 3300041486 | Bacteria | 1208 |
| 386 | Ga0451833_0310160 | 3300041491 | Unclassified | 1655 |
| 387 | Ga0451839_1296729 | 3300041496 | Bacteria | 1532 |
| 388 | Ga0451841_0816638 | 3300041498 | Bacteria | 2584 |
| 389 | Ga0451847_1013959 | 3300041503 | Bacteria | 1123 |
| 390 | Ga0451849_0884513 | 3300041505 | Bacteria | 967 |
| 391 | Ga0451853_1921323 | 3300041512 | Bacteria | 2771 |
| 392 | Ga0439449_0154953 | 3300042007 | Bacteria | 855 |
| 393 | Ga0450896_020267 | 3300042133 | Bacteria | 972 |
| 394 | Ga0451577_0005455 | 3300042876 | Bacteria | 13029 |
| 395 | Ga0451577_0016517 | 3300042876 | Bacteria | 6833 |
| 396 | Ga0439440_0048209 | 3300042993 | Bacteria | 1058 |
| 397 | Ga0466969_0012843 | 3300044656 | Bacteria | 4414 |
| 398 | Ga0466972_0415574 | 3300044658 | Bacteria | 631 |
| 399 | Ga0466966_0021331 | 3300044684 | Bacteria | 4254 |
| 400 | Ga0466964_0359471 | 3300044706 | Bacteria | 750 |
| 401 | Ga0453684_0020514 | 3300044712 | Bacteria | 9959 |
| 402 | Ga0466971_0445247 | 3300044719 | Bacteria | 635 |
| 403 | Ga0466957_1346278 | 3300044842 | Bacteria | 519 |
| 404 | Ga0466959_0013880 | 3300045049 | Bacteria | 5848 |
| 405 | Ga0466959_0947014 | 3300045049 | Bacteria | 574 |
| 406 | Ga0451576_0904733 | 3300045051 | Bacteria | 926 |
| 407 | Ga0466958_0479992 | 3300045836 | Bacteria | 806 |
| 408 | Ga0466967_1724000 | 3300045976 | Bacteria | 624 |
| 409 | Ga0495592_0068713 | 3300046454 | Bacteria | 2586 |
| 410 | Ga0495592_0586007 | 3300046454 | Unclassified | 682 |
| 411 | Ga0495603_0333043 | 3300046455 | Bacteria | 871 |
| 412 | Ga0495590_0125713 | 3300046457 | Bacteria | 920 |
| 413 | Ga0495629_1123881 | 3300046459 | Bacteria | 507 |
| 414 | Ga0495638_0334192 | 3300046460 | Bacteria | 805 |
| 415 | Ga0495651_0152688 | 3300046462 | Bacteria | 1663 |
| 416 | Ga0495653_0319912 | 3300046463 | Bacteria | 1006 |
| 417 | Ga0495650_0004212 | 3300046471 | Bacteria | 9962 |
| 418 | Ga0495650_0161683 | 3300046471 | Bacteria | 798 |
| 419 | Ga0495580_0049874 | 3300046472 | Bacteria | 2961 |
| 420 | Ga0495580_0304088 | 3300046472 | Unclassified | 1086 |
| 421 | Ga0495580_0557020 | 3300046472 | Bacteria | 761 |
| 422 | Ga0495582_0008035 | 3300046473 | Bacteria | 5825 |
| 423 | Ga0495639_0034848 | 3300046475 | Bacteria | 2252 |
| 424 | Ga0495584_0072433 | 3300046491 | Bacteria | 1731 |
| 425 | Ga0495585_0000122 | 3300046492 | Bacteria | 84570 |
| 426 | Ga0495585_0002270 | 3300046492 | Bacteria | 13878 |
| 427 | Ga0495585_0066257 | 3300046492 | Bacteria | 1977 |
| 428 | Ga0495585_0101240 | 3300046492 | Bacteria | 1540 |
| 429 | Ga0495585_0265373 | 3300046492 | Bacteria | 852 |
| 430 | Ga0495596_0211431 | 3300046500 | Bacteria | 753 |
| 431 | Ga0495607_0441693 | 3300046501 | Bacteria | 585 |
| 432 | Ga0495583_0028025 | 3300046506 | Bacteria | 2774 |
| 433 | Ga0495606_0095236 | 3300046507 | Bacteria | 1823 |
| 434 | Ga0495616_0003528 | 3300046513 | Bacteria | 10001 |
| 435 | Ga0495618_0873380 | 3300046514 | Unclassified | 520 |
| 436 | Ga0495620_0038351 | 3300046515 | Bacteria | 2127 |
| 437 | Ga0495630_0401046 | 3300046517 | Bacteria | 1051 |
| 438 | Ga0495630_0696932 | 3300046517 | Bacteria | 777 |
| 439 | Ga0495630_1225212 | 3300046517 | Unclassified | 567 |
| 440 | Ga0495631_0029680 | 3300046518 | Bacteria | 2485 |
| 441 | Ga0495632_0115097 | 3300046519 | Bacteria | 1260 |
| 442 | Ga0495643_0001229 | 3300046522 | Bacteria | 24725 |
| 443 | Ga0495644_0123028 | 3300046523 | Bacteria | 987 |
| 444 | Ga0495642_0001393 | 3300046528 | Bacteria | 10823 |
| 445 | Ga0495652_0778590 | 3300046529 | Unclassified | 638 |
| 446 | Ga0495665_0376221 | 3300046531 | Bacteria | 722 |
| 447 | Ga0495665_0549149 | 3300046531 | Unclassified | 580 |
| 448 | Ga0495640_0462215 | 3300046533 | Bacteria | 774 |
| 449 | Ga0495586_0117737 | 3300046535 | Bacteria | 1482 |
| 450 | Ga0495587_0089628 | 3300046536 | Unclassified | 1777 |
| 451 | Ga0495609_0023399 | 3300046538 | Bacteria | 2840 |
| 452 | Ga0495609_0075880 | 3300046538 | Bacteria | 1473 |
| 453 | Ga0495622_0441487 | 3300046557 | Bacteria | 558 |
| 454 | Ga0495633_0001928 | 3300046558 | Bacteria | 15107 |
| 455 | Ga0495633_0004972 | 3300046558 | Bacteria | 8297 |
| 456 | Ga0495656_0068257 | 3300046615 | Bacteria | 1571 |
| 457 | Ga0495634_0034219 | 3300046642 | Bacteria | 3488 |
| 458 | Ga0495634_0211050 | 3300046642 | Bacteria | 1202 |
| 459 | Ga0495634_0319659 | 3300046642 | Bacteria | 935 |
| 460 | Ga0495611_0076514 | 3300046648 | Bacteria | 1534 |
| 461 | Ga0495659_0388920 | 3300046664 | Unclassified | 601 |
| 462 | Ga0495588_0068161 | 3300046674 | Bacteria | 1847 |
| 463 | Ga0495588_0233479 | 3300046674 | Bacteria | 970 |
| 464 | Ga0495657_0473407 | 3300046675 | Unclassified | 732 |
| 465 | Ga0495599_0475016 | 3300046678 | Bacteria | 738 |
| 466 | Ga0495623_0033773 | 3300046679 | Bacteria | 3283 |
| 467 | Ga0495646_0475989 | 3300046680 | Bacteria | 643 |
| 468 | Ga0495647_0154819 | 3300046681 | Bacteria | 985 |
| 469 | Ga0495658_0050196 | 3300046683 | Bacteria | 2359 |
| 470 | Ga0495658_0158986 | 3300046683 | Bacteria | 1392 |
| 471 | Ga0495669_0053036 | 3300046684 | Bacteria | 1823 |
| 472 | Ga0495613_0051065 | 3300046689 | Bacteria | 3049 |
| 473 | Ga0495613_0304811 | 3300046689 | Unclassified | 1102 |
| 474 | Ga0495670_0039199 | 3300046691 | Bacteria | 2362 |
| 475 | Ga0495670_0327110 | 3300046691 | Bacteria | 823 |
| 476 | Ga0495600_0784231 | 3300046809 | Unclassified | 569 |
| 477 | Ga0495660_0070654 | 3300046810 | Bacteria | 1852 |
| 478 | Ga0495581_0749618 | 3300047315 | Unclassified | 562 |
| 479 | Ga0495674_0039104 | 3300047319 | Bacteria | 4253 |
| 480 | Ga0495674_0236027 | 3300047319 | Bacteria | 1508 |
| 481 | Ga0495674_0474474 | 3300047319 | Bacteria | 1003 |
| 482 | Ga0495683_0000079 | 3300047323 | Bacteria | 96333 |
| 483 | Ga0495683_0332370 | 3300047323 | Bacteria | 645 |
| 484 | Ga0495675_0347246 | 3300047444 | Unclassified | 873 |
| 485 | Ga0495684_0075345 | 3300047471 | Bacteria | 2564 |
| 486 | Ga0495684_0129416 | 3300047471 | Bacteria | 1897 |
| 487 | Ga0495593_0487297 | 3300047673 | Unclassified | 618 |
| 488 | Ga0495602_0019569 | 3300048088 | Bacteria | 6717 |
| 489 | Ga0495602_0773241 | 3300048088 | Unclassified | 647 |
| 490 | Ga0495615_0114722 | 3300048090 | Bacteria | 774 |
| 491 | Ga0496102_1482475 | 3300048905 | Unclassified | 597 |
| 492 | Ga0496104_0109718 | 3300048907 | Bacteria | 2645 |
| 493 | Ga0496105_0589597 | 3300048908 | Unclassified | 864 |
| 494 | Ga0496107_0781044 | 3300048910 | Bacteria | 700 |
| 495 | Ga0496108_0532312 | 3300048911 | Bacteria | 1026 |
| 496 | Ga0496114_0980524 | 3300048917 | Unclassified | 728 |
| 497 | Ga0496115_0145453 | 3300048918 | Bacteria | 1956 |
| 498 | Ga0496124_0041793 | 3300048927 | Bacteria | 3952 |
| 499 | Ga0501325_043572 | 3300049541 | Bacteria | 553 |
| 500 | Ga0501031_0027686 | 3300049568 | Bacteria | 3695 |
| 501 | Ga0501032_0003188 | 3300049569 | Bacteria | 12624 |
| 502 | Ga0501032_0143816 | 3300049569 | Bacteria | 1570 |
| 503 | Ga0501033_0034573 | 3300049570 | Bacteria | 3790 |
| 504 | Ga0501033_0633471 | 3300049570 | Bacteria | 731 |
| 505 | Ga0501034_0028629 | 3300049571 | Bacteria | 5669 |
| 506 | Ga0501034_1091784 | 3300049571 | Bacteria | 679 |
| 507 | Ga0501036_0007019 | 3300049572 | Bacteria | 9167 |
| 508 | Ga0501036_0117455 | 3300049572 | Bacteria | 2247 |
| 509 | Ga0501036_0311110 | 3300049572 | Bacteria | 1317 |
| 510 | Ga0501036_0347671 | 3300049572 | Bacteria | 1238 |
| 511 | Ga0501036_0791168 | 3300049572 | Bacteria | 781 |
| 512 | Ga0501037_0037262 | 3300049573 | Bacteria | 3584 |
| 513 | Ga0501037_0047261 | 3300049573 | Bacteria | 3155 |
| 514 | Ga0501038_0002217 | 3300049574 | Bacteria | 18080 |
| 515 | Ga0501038_0064232 | 3300049574 | Bacteria | 3131 |
| 516 | Ga0501039_0000730 | 3300049575 | Bacteria | 23721 |
| 517 | Ga0501039_0005303 | 3300049575 | Bacteria | 9749 |
| 518 | Ga0501039_0124843 | 3300049575 | Bacteria | 2019 |
| 519 | Ga0501039_0282074 | 3300049575 | Bacteria | 1306 |
| 520 | Ga0501039_0462037 | 3300049575 | Bacteria | 997 |
| 521 | Ga0501040_0071289 | 3300049576 | Bacteria | 2399 |
| 522 | Ga0501040_0681290 | 3300049576 | Bacteria | 743 |
| 523 | Ga0501041_0033096 | 3300049577 | Bacteria | 3126 |
| 524 | Ga0501041_0124760 | 3300049577 | Bacteria | 1602 |
| 525 | Ga0501041_0511828 | 3300049577 | Unclassified | 764 |
| 526 | Ga0501041_1109803 | 3300049577 | Archaea | 510 |
| 527 | Ga0501042_0001503 | 3300049578 | Bacteria | 13773 |
| 528 | Ga0501042_0114283 | 3300049578 | Bacteria | 1944 |
| 529 | Ga0501042_0135772 | 3300049578 | Bacteria | 1774 |
| 530 | Ga0501042_0203959 | 3300049578 | Bacteria | 1426 |
| 531 | Ga0501043_0020158 | 3300049579 | Bacteria | 5234 |
| 532 | Ga0501046_0004816 | 3300049580 | Bacteria | 12163 |
| 533 | Ga0501046_0162917 | 3300049580 | Bacteria | 1677 |
| 534 | Ga0501046_0276964 | 3300049580 | Bacteria | 1230 |
| 535 | Ga0501046_0281662 | 3300049580 | Bacteria | 1218 |
| 536 | Ga0501047_0019235 | 3300049581 | Bacteria | 6551 |
| 537 | Ga0501048_0035518 | 3300049582 | Bacteria | 3588 |
| 538 | Ga0501048_0115218 | 3300049582 | Bacteria | 1899 |
| 539 | Ga0501048_0428190 | 3300049582 | Bacteria | 947 |
| 540 | Ga0501048_0543525 | 3300049582 | Bacteria | 833 |
| 541 | Ga0501067_0009891 | 3300049583 | Bacteria | 5281 |
| 542 | Ga0501068_0000067 | 3300049584 | Bacteria | 40810 |
| 543 | Ga0501069_0014715 | 3300049585 | Bacteria | 4184 |
| 544 | Ga0501070_0271584 | 3300049586 | Bacteria | 1384 |
| 545 | Ga0501070_0399437 | 3300049586 | Bacteria | 1112 |
| 546 | Ga0501070_1532180 | 3300049586 | Bacteria | 504 |
| 547 | Ga0501070_1533184 | 3300049586 | Unclassified | 504 |
| 548 | Ga0501071_0009637 | 3300049587 | Bacteria | 6446 |
| 549 | Ga0501071_0084154 | 3300049587 | Bacteria | 2331 |
| 550 | Ga0501071_0254162 | 3300049587 | Bacteria | 1327 |
| 551 | Ga0501071_0331723 | 3300049587 | Bacteria | 1156 |
| 552 | Ga0501071_0537257 | 3300049587 | Bacteria | 897 |
| 553 | Ga0501072_0010601 | 3300049588 | Bacteria | 7020 |
| 554 | Ga0501072_0107518 | 3300049588 | Bacteria | 2219 |
| 555 | Ga0501072_0190876 | 3300049588 | Bacteria | 1634 |
| 556 | Ga0501072_0426266 | 3300049588 | Bacteria | 1051 |
| 557 | Ga0501072_0657668 | 3300049588 | Bacteria | 825 |
| 558 | Ga0501072_0761201 | 3300049588 | Bacteria | 759 |
| 559 | Ga0501073_0062034 | 3300049589 | Bacteria | 2607 |
| 560 | Ga0501073_1023011 | 3300049589 | Bacteria | 568 |
| 561 | Ga0501073_1146368 | 3300049589 | Bacteria | 534 |
| 562 | Ga0501074_0031933 | 3300049590 | Bacteria | 3816 |
| 563 | Ga0501075_0032599 | 3300049591 | Bacteria | 3871 |
| 564 | Ga0501075_0084319 | 3300049591 | Bacteria | 2407 |
| 565 | Ga0501075_0173618 | 3300049591 | Bacteria | 1645 |
| 566 | Ga0501075_0186043 | 3300049591 | Bacteria | 1584 |
| 567 | Ga0501075_0409261 | 3300049591 | Bacteria | 1034 |
| 568 | Ga0501075_0411787 | 3300049591 | Bacteria | 1031 |
| 569 | Ga0501076_0006149 | 3300049592 | Bacteria | 8689 |
| 570 | Ga0501076_0105343 | 3300049592 | Bacteria | 2276 |
| 571 | Ga0501076_0298920 | 3300049592 | Bacteria | 1320 |
| 572 | Ga0501076_0454797 | 3300049592 | Bacteria | 1054 |
| 573 | Ga0501076_0673820 | 3300049592 | Bacteria | 854 |
| 574 | Ga0501077_0007337 | 3300049593 | Bacteria | 6802 |
| 575 | Ga0501077_0313502 | 3300049593 | Bacteria | 1000 |
| 576 | Ga0501079_0000244 | 3300049741 | Bacteria | 32943 |
| 577 | Ga0501079_0797715 | 3300049741 | Bacteria | 743 |
| 578 | Ga0501079_1021324 | 3300049741 | Bacteria | 651 |
| 579 | Ga0501080_0000129 | 3300049742 | Bacteria | 53483 |
| 580 | Ga0501080_0382058 | 3300049742 | Bacteria | 1269 |
| 581 | Ga0501080_0500089 | 3300049742 | Bacteria | 1086 |
| 582 | Ga0501080_1102565 | 3300049742 | Unclassified | 685 |
| 583 | Ga0501083_0037364 | 3300049744 | Bacteria | 3308 |
| 584 | Ga0501083_0512628 | 3300049744 | Bacteria | 781 |
| 585 | Ga0501035_0052081 | 3300049822 | Bacteria | 3663 |
| 586 | Ga0501035_0119264 | 3300049822 | Bacteria | 2308 |
| 587 | Ga0501035_1182013 | 3300049822 | Unclassified | 594 |
| 588 | Ga0501044_0041952 | 3300049823 | Bacteria | 4762 |
| 589 | Ga0501044_1007827 | 3300049823 | Bacteria | 704 |
| 590 | Ga0501045_0033353 | 3300049824 | Bacteria | 3733 |
| 591 | Ga0501045_0118514 | 3300049824 | Bacteria | 1965 |
| 592 | Ga0501045_0208356 | 3300049824 | Bacteria | 1456 |
| 593 | Ga0501045_0449807 | 3300049824 | Bacteria | 958 |
| 594 | Ga0501045_0834959 | 3300049824 | Bacteria | 678 |
| 595 | nmdc:mga09592_109009_c1 | 3300050508 | Bacteria | 2375 |
| 596 | nmdc:mga0qj67_38961_c1 | 3300050509 | Bacteria | 3730 |
| 597 | nmdc:mga06r32_63646_c1 | 3300050510 | Bacteria | 3556 |
| 598 | nmdc:mga08y16_1120898_c1 | 3300050511 | Bacteria | 761 |
| 599 | nmdc:mga08y16_1186842_c1 | 3300050511 | Bacteria | 734 |
| 600 | nmdc:mga0rr50_790294_c1 | 3300050513 | Unclassified | 810 |
| 601 | nmdc:mga08x19_881152_c1 | 3300050514 | Unclassified | 636 |
| 602 | nmdc:mga0a205_1558951_c1 | 3300050515 | Bacteria | 509 |
| 603 | nmdc:mga0a205_36056_c2 | 3300050515 | Bacteria | 3757 |
| 604 | Ga0495601_0924123 | 3300053077 | Bacteria | 550 |
| 605 | Ga0495595_0348323 | 3300053084 | Archaea | 747 |
| 606 | Ga0495619_0190405 | 3300053085 | Bacteria | 1420 |
| 607 | Ga0495619_0933686 | 3300053085 | Unclassified | 583 |
| 608 | Ga0500583_0023469 | 3300053092 | Bacteria | 2600 |
| 609 | Ga0500641_0220567 | 3300053096 | Bacteria | 804 |
| 610 | Ga0500568_0002490 | 3300053139 | Bacteria | 10795 |
| 611 | Ga0500568_0046068 | 3300053139 | Bacteria | 1733 |
| 612 | Ga0500633_0336789 | 3300053160 | Bacteria | 551 |
| 613 | Ga0501084_0003862 | 3300054114 | Bacteria | 12197 |
| 614 | Ga0501084_0190081 | 3300054114 | Bacteria | 1732 |
| 615 | Ga0501082_0027313 | 3300060353 | Bacteria | 4914 |
| 616 | Ga0501082_0176809 | 3300060353 | Bacteria | 1856 |
| 617 | Ga0501082_0249533 | 3300060353 | Bacteria | 1545 |
| 618 | Ga0501082_0592588 | 3300060353 | Bacteria | 970 |
| 619 | Ga0530510_0084351 | 3300061734 | Bacteria | 2314 |
| 620 | Ga0530510_0121732 | 3300061734 | Bacteria | 1916 |
| 621 | Ga0530510_0665915 | 3300061734 | Archaea | 793 |
| 622 | Ga0530510_1038684 | 3300061734 | Unclassified | 627 |
| 623 | Ga0530510_1134746 | 3300061734 | Bacteria | 599 |
| 624 | Ga0070690_101248346 | |||
| 625 | rootH1_10061034 | |||
| 626 | Ga0065714_10445553 | |||
| 627 | Ga0065712_10029910 | |||
| 628 | Ga0065715_10737414 | |||
| 629 | Ga0070683_100085009 | |||
| 630 | Ga0070683_100153085 | |||
| 631 | Ga0070683_100172755 | |||
| 632 | Ga0070690_101425027 | |||
| 633 | Ga0070690_101506621 | |||
| 634 | Ga0068869_100654984 | |||
| 635 | Ga0068869_100796552 | |||
| 636 | Ga0070666_10002588 | |||
| 637 | Ga0070680_100043677 | |||
| 638 | Ga0070680_100327735 | |||
| 639 | Ga0070680_101068321 | |||
| 640 | Ga0070682_101394396 | |||
| 641 | Ga0068868_100685153 | |||
| 642 | Ga0068868_101048903 | |||
| 643 | Ga0070660_100594859 | |||
| 644 | Ga0070689_100056685 | |||
| 645 | Ga0070689_100810008 | |||
| 646 | Ga0070689_101515570 | |||
| 647 | Ga0070689_102163570 | |||
| 648 | Ga0070691_10259116 | |||
| 649 | Ga0070687_101006215 | |||
| 650 | Ga0070661_100636796 | |||
| 651 | Ga0070692_10108356 | |||
| 652 | Ga0070692_10843919 | |||
| 653 | Ga0070669_101061070 | |||
| 654 | Ga0070674_100445112 | |||
| 655 | Ga0070688_100110555 | |||
| 656 | Ga0070667_101296150 | |||
| 657 | Ga0070703_10117670 | |||
| 658 | Ga0070709_10129474 | |||
| 659 | Ga0070709_10591074 | |||
| 660 | Ga0070709_11142047 | |||
| 661 | Ga0070714_100304687 | |||
| 662 | Ga0070713_100035103 | |||
| 663 | Ga0070713_101655167 | |||
| 664 | Ga0070710_10646834 | |||
| 665 | Ga0070701_10004174 | |||
| 666 | Ga0070711_100363166 | |||
| 667 | Ga0070705_100050376 | |||
| 668 | Ga0070705_100698059 | |||
| 669 | Ga0070705_100810437 | |||
| 670 | Ga0070705_101580987 | |||
| 671 | Ga0070700_100066358 | |||
| 672 | Ga0070694_100409152 | |||
| 673 | Ga0070694_100803964 | |||
| 674 | Ga0070681_10049531 | |||
| 675 | Ga0070681_10202479 | |||
| 676 | Ga0068867_100187691 | |||
| 677 | Ga0068867_102295859 | |||
| 678 | Ga0070706_100782380 | |||
| 679 | Ga0070707_100008321 | |||
| 680 | Ga0070707_100070336 | |||
| 681 | Ga0070698_100011424 | |||
| 682 | Ga0070699_100088570 | |||
| 683 | Ga0070699_102057724 | |||
| 684 | Ga0070679_100297459 | |||
| 685 | Ga0070679_100374049 | |||
| 686 | Ga0070679_100552958 | |||
| 687 | Ga0070684_100063137 | |||
| 688 | Ga0070684_100087577 | |||
| 689 | Ga0070684_100692493 | |||
| 690 | Ga0070697_100385824 | |||
| 691 | Ga0070697_100652243 | |||
| 692 | Ga0070697_101184271 | |||
| 693 | Ga0068853_100075517 | |||
| 694 | Ga0068853_100351216 | |||
| 695 | Ga0068853_100393178 | |||
| 696 | Ga0070672_101237413 | |||
| 697 | Ga0070686_100308323 | |||
| 698 | Ga0070695_100303085 | |||
| 699 | Ga0070695_100417804 | |||
| 700 | Ga0070696_100508598 | |||
| 701 | Ga0070696_100510108 | |||
| 702 | Ga0070693_100088966 | |||
| 703 | Ga0070693_100135831 | |||
| 704 | Ga0070693_101310959 | |||
| 705 | Ga0070665_100043320 | |||
| 706 | Ga0070665_102112399 | |||
| 707 | Ga0070704_100037953 | |||
| 708 | Ga0070704_100167470 | |||
| 709 | Ga0070704_100181822 | |||
| 710 | Ga0070704_100931483 | |||
| 711 | Ga0068855_100027852 | |||
| 712 | Ga0070664_100626405 | |||
| 713 | Ga0070664_101161990 | |||
| 714 | Ga0068857_100003138 | |||
| 715 | Ga0068857_101533563 | |||
| 716 | Ga0068854_101364682 | |||
| 717 | Ga0068856_100060941 | |||
| 718 | Ga0068856_100093928 | |||
| 719 | Ga0068852_100165566 | |||
| 720 | Ga0068852_100802611 | |||
| 721 | Ga0068859_100185648 | |||
| 722 | Ga0068859_100605384 | |||
| 723 | Ga0068859_101331433 | |||
| 724 | Ga0068861_100286927 | |||
| 725 | Ga0068861_101266412 | |||
| 726 | Ga0068870_10451764 | |||
| 727 | Ga0068870_10600464 | |||
| 728 | Ga0068863_100025272 | |||
| 729 | Ga0068863_101424533 | |||
| 730 | Ga0068858_100153960 | |||
| 731 | Ga0068858_100176886 | |||
| 732 | Ga0068858_101497454 | |||
| 733 | Ga0068860_102615557 | |||
| 734 | Ga0068862_100070739 | |||
| 735 | Ga0068862_101256395 | |||
| 736 | Ga0068862_102421582 | |||
| 737 | Ga0081540_1040597 | |||
| 738 | Ga0070717_10006427 | |||
| 739 | Ga0070717_10475384 | |||
| 740 | Ga0070715_10769041 | |||
| 741 | Ga0070712_100800317 | |||
| 742 | Ga0070712_101511376 | |||
| 743 | Ga0097621_100063115 | |||
| 744 | Ga0097621_100105483 | |||
| 745 | Ga0097621_100467175 | |||
| 746 | Ga0097621_101935548 | |||
| 747 | Ga0068871_100016154 | |||
| 748 | Ga0068871_100362546 | |||
| 749 | Ga0068871_100362720 | |||
| 750 | Ga0068871_100611627 | |||
| 751 | Ga0075428_102078164 | |||
| 752 | Ga0075430_100026446 | |||
| 753 | Ga0075431_100029249 | |||
| 754 | Ga0075433_10117111 | |||
| 755 | Ga0075429_100112856 | |||
| 756 | Ga0068865_100047930 | |||
| 757 | Ga0068865_101163567 | |||
| 758 | Ga0068865_101787402 | |||
| 759 | Ga0075436_100148030 | |||
| 760 | Ga0075436_100967950 | |||
| 761 | Ga0097620_100185660 | |||
| 762 | Ga0097620_100605419 | |||
| 763 | Ga0097620_101331568 | |||
| 764 | Ga0075435_100234612 | |||
| 765 | Ga0105250_10000023 | |||
| 766 | Ga0105240_10082039 | |||
| 767 | Ga0105240_10138099 | |||
| 768 | Ga0105240_11571579 | |||
| 769 | Ga0105240_11928791 | |||
| 770 | Ga0111539_10540222 | |||
| 771 | Ga0111539_11355800 | |||
| 772 | Ga0105245_10120023 | |||
| 773 | Ga0105245_10375455 | |||
| 774 | Ga0105245_11057978 | |||
| 775 | Ga0105247_10608462 | |||
| 776 | Ga0105243_10141367 | |||
| 777 | Ga0105243_10639702 | |||
| 778 | Ga0105243_12337691 | |||
| 779 | Ga0105241_10033993 | |||
| 780 | Ga0105241_10505202 | |||
| 781 | Ga0105241_12242040 | |||
| 782 | Ga0105242_10204335 | |||
| 783 | Ga0105242_11039728 | |||
| 784 | Ga0105248_10280305 | |||
| 785 | Ga0105248_10860228 | |||
| 786 | Ga0105248_10944338 | |||
| 787 | Ga0105248_13090241 | |||
| 788 | Ga0105237_10150041 | |||
| 789 | Ga0105237_10164766 | |||
| 790 | Ga0105237_10540165 | |||
| 791 | Ga0105238_10073701 | |||
| 792 | Ga0105238_10109536 | |||
| 793 | Ga0105238_10136968 | |||
| 794 | Ga0105238_10731332 | |||
| 795 | Ga0105238_10901169 | |||
| 796 | Ga0105249_10009953 | |||
| 797 | Ga0105249_13575480 | |||
| 798 | Ga0105239_10001958 | |||
| 799 | Ga0105239_10069918 | |||
| 800 | Ga0105239_10458454 | |||
| 801 | Ga0105239_11216219 | |||
| 802 | Ga0105239_11426562 | |||
| 803 | Ga0105239_12662420 | |||
| 804 | Ga0105246_10386073 | |||
| 805 | Ga0157373_11078847 | |||
| 806 | Ga0157371_10594385 | |||
| 807 | Ga0157370_10018228 | |||
| 808 | Ga0157370_11458361 | |||
| 809 | Ga0157369_10002232 | |||
| 810 | Ga0157374_10152442 | |||
| 811 | Ga0157374_10878110 | |||
| 812 | Ga0157374_10894648 | |||
| 813 | Ga0157378_10324026 | |||
| 814 | Ga0157378_10521950 | |||
| 815 | Ga0157378_10784797 | |||
| 816 | Ga0163162_10241032 | |||
| 817 | Ga0163162_12095291 | |||
| 818 | Ga0157372_10323656 | |||
| 819 | Ga0157372_11186769 | |||
| 820 | Ga0163163_10027913 | |||
| 821 | Ga0163163_10030211 | |||
| 822 | Ga0163163_11904260 | |||
| 823 | Ga0157380_10044650 | |||
| 824 | Ga0157380_10060164 | |||
| 825 | Ga0157380_10310558 | |||
| 826 | Ga0157380_11330284 | |||
| 827 | Ga0157377_10323378 | |||
| 828 | Ga0157377_10983688 | |||
| 829 | Ga0157379_10000481 | |||
| 830 | Ga0157379_10521513 | |||
| 831 | Ga0157376_10773013 | |||
| 832 | Ga0197907_11276312 | |||
| 833 | Ga0206356_11385276 | |||
| 834 | Ga0206349_1073855 | |||
| 835 | Ga0206352_10825994 | |||
| 836 | Ga0213873_10077291 | |||
| 837 | Ga0213874_10454125 | |||
| 838 | Ga0213876_10071971 | |||
| 839 | Ga0213876_10304994 | |||
| 840 | Ga0213875_10137678 | |||
| 841 | Ga0213875_10294347 | |||
| 842 | Ga0224712_10472686 | |||
| 843 | Ga0207696_1000098 | |||
| 844 | Ga0207680_10035215 | |||
| 845 | Ga0207685_10847718 | |||
| 846 | Ga0207699_10234746 | |||
| 847 | Ga0207684_10686972 | |||
| 848 | Ga0207654_10048684 | |||
| 849 | Ga0207654_10311708 | |||
| 850 | Ga0207654_10316692 | |||
| 851 | Ga0207707_10001936 | |||
| 852 | Ga0207707_10199439 | |||
| 853 | Ga0207707_10289740 | |||
| 854 | Ga0207695_10006278 | |||
| 855 | Ga0207695_10095111 | |||
| 856 | Ga0207695_10169747 | |||
| 857 | Ga0207671_10096342 | |||
| 858 | Ga0207671_10342511 | |||
| 859 | Ga0207671_10971850 | |||
| 860 | Ga0207693_10298481 | |||
| 861 | Ga0207663_11524304 | |||
| 862 | Ga0207660_10058144 | |||
| 863 | Ga0207662_10356456 | |||
| 864 | Ga0207657_10622555 | |||
| 865 | Ga0207649_10911441 | |||
| 866 | Ga0207652_10040380 | |||
| 867 | Ga0207652_11905090 | |||
| 868 | Ga0207646_10000120 | |||
| 869 | Ga0207646_10061496 | |||
| 870 | Ga0207681_10776050 | |||
| 871 | Ga0207694_10037701 | |||
| 872 | Ga0207694_10143597 | |||
| 873 | Ga0207694_10277945 | |||
| 874 | Ga0207694_10341527 | |||
| 875 | Ga0207694_11384289 | |||
| 876 | Ga0207650_10293711 | |||
| 877 | Ga0207659_10069889 | |||
| 878 | Ga0207687_10030384 | |||
| 879 | Ga0207687_10448720 | |||
| 880 | Ga0207687_10781202 | |||
| 881 | Ga0207687_11479639 | |||
| 882 | Ga0207700_10801935 | |||
| 883 | Ga0207686_10354939 | |||
| 884 | Ga0207686_10427279 | |||
| 885 | Ga0207709_10187516 | |||
| 886 | Ga0207709_11106714 | |||
| 887 | Ga0207670_10073655 | |||
| 888 | Ga0207669_11059521 | |||
| 889 | Ga0207669_11381688 | |||
| 890 | Ga0207704_10502549 | |||
| 891 | Ga0207704_10732311 | |||
| 892 | Ga0207665_10318813 | |||
| 893 | Ga0207665_11322168 | |||
| 894 | Ga0207691_10519278 | |||
| 895 | Ga0207711_10014953 | |||
| 896 | Ga0207711_10716756 | |||
| 897 | Ga0207711_10906700 | |||
| 898 | Ga0207711_11882090 | |||
| 899 | Ga0207689_10235650 | |||
| 900 | Ga0207661_10013838 | |||
| 901 | Ga0207661_10025358 | |||
| 902 | Ga0207661_11227820 | |||
| 903 | Ga0207679_11414742 | |||
| 904 | Ga0207667_10000607 | |||
| 905 | Ga0207667_10015413 | |||
| 906 | Ga0207667_11330802 | |||
| 907 | Ga0207651_10480896 | |||
| 908 | Ga0207640_11919464 | |||
| 909 | Ga0207658_11363661 | |||
| 910 | Ga0207677_10993254 | |||
| 911 | Ga0207677_12182237 | |||
| 912 | Ga0207703_10128613 | |||
| 913 | Ga0207703_11231531 | |||
| 914 | Ga0207639_10128307 | |||
| 915 | Ga0207639_10756396 | |||
| 916 | Ga0207678_11444898 | |||
| 917 | Ga0207708_10059502 | |||
| 918 | Ga0207702_10035194 | |||
| 919 | Ga0207702_10527332 | |||
| 920 | Ga0207641_10014631 | |||
| 921 | Ga0207648_10517096 | |||
| 922 | Ga0207648_10916257 | |||
| 923 | Ga0207676_10358681 | |||
| 924 | Ga0207676_10872659 | |||
| 925 | Ga0207674_10000109 | |||
| 926 | Ga0207675_100003060 | |||
| 927 | Ga0207675_101220555 | |||
| 928 | Ga0207683_10507873 | |||
| 929 | Ga0207698_10541549 | |||
| 930 | Ga0207698_10599983 | |||
| 931 | Ga0207698_11401449 | |||
| 932 | Ga0209968_1042155 | |||
| 933 | Ga0210002_1023344 | |||
| 934 | Ga0209971_1061042 | |||
| 935 | Ga0209966_1067015 | |||
| 936 | Ga0209966_1071415 | |||
| 937 | Ga0209974_10266042 | |||
| 938 | Ga0268266_10055084 | |||
| 939 | Ga0268266_10430782 | |||
| 940 | Ga0268266_10561830 | |||
| 941 | Ga0268265_10644543 | |||
| 942 | Ga0268265_11410368 | |||
| 943 | Ga0268265_11874239 | |||
| 944 | Ga0265330_10346338 | |||
| 945 | Ga0265332_10013335 | |||
| 946 | Ga0265320_10357381 | |||
| 947 | Ga0265325_10004035 | |||
| 948 | Ga0265340_10036224 | |||
| 949 | Ga0265340_10066253 | |||
| 950 | Ga0265340_10097411 | |||
| 951 | Ga0265316_10892758 | |||
| 952 | Ga0307408_100340967 | |||
| 953 | Ga0265314_10009858 | |||
| 954 | Ga0265342_10029099 | |||
| 955 | Ga0307407_10899191 | |||
| 956 | Ga0307407_11601805 | |||
| 957 | Ga0307412_10243473 | |||
| 958 | Ga0307409_102964351 | |||
| 959 | Ga0307416_103336825 | |||
| 960 | Ga0316593_10446480 | |||
| 961 | Ga0316592_1058432 | |||
| 962 | Ga0316588_1166256 | |||
| 963 | Ga0316596_1178173 | |||
| 964 | Ga0373926_0069778 | |||
| 965 | Ga0373926_0337667 | |||
| 966 | Ga0373934_0002687 | |||
| 967 | Ga0373939_0239172 | |||
| 968 | Ga0373953_0079446 | |||
| 969 | Ga0373954_0010632 | |||
| 970 | Ga0373956_0531184 | |||
| 971 | Ga0373957_0185475 | |||
| 972 | Ga0373946_0054691 | |||
| 973 | Ga0373955_0266711 | |||
| 974 | Ga0373955_0365278 | |||
| 975 | Ga0316574_0867064 | |||
| 976 | Ga0373924_0120570 | |||
| 977 | Ga0373935_0138382 | |||
| 978 | Ga0373935_0523846 | |||
| 979 | Ga0373935_0633741 | |||
| 980 | Ga0373927_0001127 | |||
| 981 | Ga0373927_0055836 | |||
| 982 | Ga0373927_0185962 | |||
| 983 | Ga0373933_0100299 | |||
| 984 | Ga0373933_0419722 | |||
| 985 | Ga0373947_0289370 | |||
| 986 | Ga0373937_0018115 | |||
| 987 | Ga0373937_0354475 | |||
| 988 | Ga0373937_0372172 | |||
| 989 | Ga0373937_1808561 | |||
| 990 | Ga0373925_0231302 | |||
| 991 | Ga0373925_0393813 | |||
| 992 | Ga0436364_0532759 | |||
| 993 | Ga0436364_0871666 | |||
| 994 | Ga0436364_1065030 | |||
| 995 | Ga0400488_05905 | |||
| 996 | Ga0400486_32002 | |||
| 997 | Ga0436365_0743184 | |||
| 998 | Ga0436365_0747166 | |||
| 999 | Ga0436365_1289444 | |||
| 1000 | Ga0436360_1232892 | |||
| 1001 | Ga0436361_0986177 | |||
| 1002 | Ga0436363_0140569 | |||
| 1003 | Ga0436363_0623487 | |||
| 1004 | Ga0436362_0319347 | |||
| 1005 | Ga0436362_0438712 | |||
| 1006 | Ga0436362_0817548 | |||
| 1007 | Ga0436362_1273971 | |||
| 1008 | Ga0451807_0367934 | |||
| 1009 | Ga0451833_0310160 | |||
| 1010 | Ga0451839_1296729 | |||
| 1011 | Ga0451841_0816638 | |||
| 1012 | Ga0451847_1013959 | |||
| 1013 | Ga0451849_0884513 | |||
| 1014 | Ga0451853_1921323 | |||
| 1015 | Ga0439449_0154953 | |||
| 1016 | Ga0450896_020267 | |||
| 1017 | Ga0451577_0005455 | |||
| 1018 | Ga0451577_0016517 | |||
| 1019 | Ga0439440_0048209 | |||
| 1020 | Ga0466969_0012843 | |||
| 1021 | Ga0466972_0415574 | |||
| 1022 | Ga0466966_0021331 | |||
| 1023 | Ga0466964_0359471 | |||
| 1024 | Ga0453684_0020514 | |||
| 1025 | Ga0466971_0445247 | |||
| 1026 | Ga0466957_1346278 | |||
| 1027 | Ga0466959_0013880 | |||
| 1028 | Ga0466959_0947014 | |||
| 1029 | Ga0451576_0904733 | |||
| 1030 | Ga0466958_0479992 | |||
| 1031 | Ga0466967_1724000 | |||
| 1032 | Ga0495592_0068713 | |||
| 1033 | Ga0495592_0586007 | |||
| 1034 | Ga0495603_0333043 | |||
| 1035 | Ga0495590_0125713 | |||
| 1036 | Ga0495629_1123881 | |||
| 1037 | Ga0495638_0334192 | |||
| 1038 | Ga0495651_0152688 | |||
| 1039 | Ga0495653_0319912 | |||
| 1040 | Ga0495650_0004212 | |||
| 1041 | Ga0495650_0161683 | |||
| 1042 | Ga0495580_0049874 | |||
| 1043 | Ga0495580_0304088 | |||
| 1044 | Ga0495580_0557020 | |||
| 1045 | Ga0495582_0008035 | |||
| 1046 | Ga0495639_0034848 | |||
| 1047 | Ga0495584_0072433 | |||
| 1048 | Ga0495585_0000122 | |||
| 1049 | Ga0495585_0002270 | |||
| 1050 | Ga0495585_0066257 | |||
| 1051 | Ga0495585_0101240 | |||
| 1052 | Ga0495585_0265373 | |||
| 1053 | Ga0495596_0211431 | |||
| 1054 | Ga0495607_0441693 | |||
| 1055 | Ga0495583_0028025 | |||
| 1056 | Ga0495606_0095236 | |||
| 1057 | Ga0495616_0003528 | |||
| 1058 | Ga0495618_0873380 | |||
| 1059 | Ga0495620_0038351 | |||
| 1060 | Ga0495630_0401046 | |||
| 1061 | Ga0495630_0696932 | |||
| 1062 | Ga0495630_1225212 | |||
| 1063 | Ga0495631_0029680 | |||
| 1064 | Ga0495632_0115097 | |||
| 1065 | Ga0495643_0001229 | |||
| 1066 | Ga0495644_0123028 | |||
| 1067 | Ga0495642_0001393 | |||
| 1068 | Ga0495652_0778590 | |||
| 1069 | Ga0495665_0376221 | |||
| 1070 | Ga0495665_0549149 | |||
| 1071 | Ga0495640_0462215 | |||
| 1072 | Ga0495586_0117737 | |||
| 1073 | Ga0495587_0089628 | |||
| 1074 | Ga0495609_0023399 | |||
| 1075 | Ga0495609_0075880 | |||
| 1076 | Ga0495622_0441487 | |||
| 1077 | Ga0495633_0001928 | |||
| 1078 | Ga0495633_0004972 | |||
| 1079 | Ga0495656_0068257 | |||
| 1080 | Ga0495634_0034219 | |||
| 1081 | Ga0495634_0211050 | |||
| 1082 | Ga0495634_0319659 | |||
| 1083 | Ga0495611_0076514 | |||
| 1084 | Ga0495659_0388920 | |||
| 1085 | Ga0495588_0068161 | |||
| 1086 | Ga0495588_0233479 | |||
| 1087 | Ga0495657_0473407 | |||
| 1088 | Ga0495599_0475016 | |||
| 1089 | Ga0495623_0033773 | |||
| 1090 | Ga0495646_0475989 | |||
| 1091 | Ga0495647_0154819 | |||
| 1092 | Ga0495658_0050196 | |||
| 1093 | Ga0495658_0158986 | |||
| 1094 | Ga0495669_0053036 | |||
| 1095 | Ga0495613_0051065 | |||
| 1096 | Ga0495613_0304811 | |||
| 1097 | Ga0495670_0039199 | |||
| 1098 | Ga0495670_0327110 | |||
| 1099 | Ga0495600_0784231 | |||
| 1100 | Ga0495660_0070654 | |||
| 1101 | Ga0495581_0749618 | |||
| 1102 | Ga0495674_0039104 | |||
| 1103 | Ga0495674_0236027 | |||
| 1104 | Ga0495674_0474474 | |||
| 1105 | Ga0495683_0000079 | |||
| 1106 | Ga0495683_0332370 | |||
| 1107 | Ga0495675_0347246 | |||
| 1108 | Ga0495684_0075345 | |||
| 1109 | Ga0495684_0129416 | |||
| 1110 | Ga0495593_0487297 | |||
| 1111 | Ga0495602_0019569 | |||
| 1112 | Ga0495602_0773241 | |||
| 1113 | Ga0495615_0114722 | |||
| 1114 | Ga0496102_1482475 | |||
| 1115 | Ga0496104_0109718 | |||
| 1116 | Ga0496105_0589597 | |||
| 1117 | Ga0496107_0781044 | |||
| 1118 | Ga0496108_0532312 | |||
| 1119 | Ga0496114_0980524 | |||
| 1120 | Ga0496115_0145453 | |||
| 1121 | Ga0496124_0041793 | |||
| 1122 | Ga0501325_043572 | |||
| 1123 | Ga0501031_0027686 | |||
| 1124 | Ga0501032_0003188 | |||
| 1125 | Ga0501032_0143816 | |||
| 1126 | Ga0501033_0034573 | |||
| 1127 | Ga0501033_0633471 | |||
| 1128 | Ga0501034_0028629 | |||
| 1129 | Ga0501034_1091784 | |||
| 1130 | Ga0501036_0007019 | |||
| 1131 | Ga0501036_0117455 | |||
| 1132 | Ga0501036_0311110 | |||
| 1133 | Ga0501036_0347671 | |||
| 1134 | Ga0501036_0791168 | |||
| 1135 | Ga0501037_0037262 | |||
| 1136 | Ga0501037_0047261 | |||
| 1137 | Ga0501038_0002217 | |||
| 1138 | Ga0501038_0064232 | |||
| 1139 | Ga0501039_0000730 | |||
| 1140 | Ga0501039_0005303 | |||
| 1141 | Ga0501039_0124843 | |||
| 1142 | Ga0501039_0282074 | |||
| 1143 | Ga0501039_0462037 | |||
| 1144 | Ga0501040_0071289 | |||
| 1145 | Ga0501040_0681290 | |||
| 1146 | Ga0501041_0033096 | |||
| 1147 | Ga0501041_0124760 | |||
| 1148 | Ga0501041_0511828 | |||
| 1149 | Ga0501041_1109803 | |||
| 1150 | Ga0501042_0001503 | |||
| 1151 | Ga0501042_0114283 | |||
| 1152 | Ga0501042_0135772 | |||
| 1153 | Ga0501042_0203959 | |||
| 1154 | Ga0501043_0020158 | |||
| 1155 | Ga0501046_0004816 | |||
| 1156 | Ga0501046_0162917 | |||
| 1157 | Ga0501046_0276964 | |||
| 1158 | Ga0501046_0281662 | |||
| 1159 | Ga0501047_0019235 | |||
| 1160 | Ga0501048_0035518 | |||
| 1161 | Ga0501048_0115218 | |||
| 1162 | Ga0501048_0428190 | |||
| 1163 | Ga0501048_0543525 | |||
| 1164 | Ga0501067_0009891 | |||
| 1165 | Ga0501068_0000067 | |||
| 1166 | Ga0501069_0014715 | |||
| 1167 | Ga0501070_0271584 | |||
| 1168 | Ga0501070_0399437 | |||
| 1169 | Ga0501070_1532180 | |||
| 1170 | Ga0501070_1533184 | |||
| 1171 | Ga0501071_0009637 | |||
| 1172 | Ga0501071_0084154 | |||
| 1173 | Ga0501071_0254162 | |||
| 1174 | Ga0501071_0331723 | |||
| 1175 | Ga0501071_0537257 | |||
| 1176 | Ga0501072_0010601 | |||
| 1177 | Ga0501072_0107518 | |||
| 1178 | Ga0501072_0190876 | |||
| 1179 | Ga0501072_0426266 | |||
| 1180 | Ga0501072_0657668 | |||
| 1181 | Ga0501072_0761201 | |||
| 1182 | Ga0501073_0062034 | |||
| 1183 | Ga0501073_1023011 | |||
| 1184 | Ga0501073_1146368 | |||
| 1185 | Ga0501074_0031933 | |||
| 1186 | Ga0501075_0032599 | |||
| 1187 | Ga0501075_0084319 | |||
| 1188 | Ga0501075_0173618 | |||
| 1189 | Ga0501075_0186043 | |||
| 1190 | Ga0501075_0409261 | |||
| 1191 | Ga0501075_0411787 | |||
| 1192 | Ga0501076_0006149 | |||
| 1193 | Ga0501076_0105343 | |||
| 1194 | Ga0501076_0298920 | |||
| 1195 | Ga0501076_0454797 | |||
| 1196 | Ga0501076_0673820 | |||
| 1197 | Ga0501077_0007337 | |||
| 1198 | Ga0501077_0313502 | |||
| 1199 | Ga0501079_0000244 | |||
| 1200 | Ga0501079_0797715 | |||
| 1201 | Ga0501079_1021324 | |||
| 1202 | Ga0501080_0000129 | |||
| 1203 | Ga0501080_0382058 | |||
| 1204 | Ga0501080_0500089 | |||
| 1205 | Ga0501080_1102565 | |||
| 1206 | Ga0501083_0037364 | |||
| 1207 | Ga0501083_0512628 | |||
| 1208 | Ga0501035_0052081 | |||
| 1209 | Ga0501035_0119264 | |||
| 1210 | Ga0501035_1182013 | |||
| 1211 | Ga0501044_0041952 | |||
| 1212 | Ga0501044_1007827 | |||
| 1213 | Ga0501045_0033353 | |||
| 1214 | Ga0501045_0118514 | |||
| 1215 | Ga0501045_0208356 | |||
| 1216 | Ga0501045_0449807 | |||
| 1217 | Ga0501045_0834959 | |||
| 1218 | nmdc:mga09592_109009_c1 | |||
| 1219 | nmdc:mga0qj67_38961_c1 | |||
| 1220 | nmdc:mga06r32_63646_c1 | |||
| 1221 | nmdc:mga08y16_1120898_c1 | |||
| 1222 | nmdc:mga08y16_1186842_c1 | |||
| 1223 | nmdc:mga0rr50_790294_c1 | |||
| 1224 | nmdc:mga08x19_881152_c1 | |||
| 1225 | nmdc:mga0a205_1558951_c1 | |||
| 1226 | nmdc:mga0a205_36056_c2 | |||
| 1227 | Ga0495601_0924123 | |||
| 1228 | Ga0495595_0348323 | |||
| 1229 | Ga0495619_0190405 | |||
| 1230 | Ga0495619_0933686 | |||
| 1231 | Ga0500583_0023469 | |||
| 1232 | Ga0500641_0220567 | |||
| 1233 | Ga0500568_0002490 | |||
| 1234 | Ga0500568_0046068 | |||
| 1235 | Ga0500633_0336789 | |||
| 1236 | Ga0501084_0003862 | |||
| 1237 | Ga0501084_0190081 | |||
| 1238 | Ga0501082_0027313 | |||
| 1239 | Ga0501082_0176809 | |||
| 1240 | Ga0501082_0249533 | |||
| 1241 | Ga0501082_0592588 | |||
| 1242 | Ga0530510_0084351 | |||
| 1243 | Ga0530510_0121732 | |||
| 1244 | Ga0530510_0665915 | |||
| 1245 | Ga0530510_1038684 | |||
| 1246 | Ga0530510_1134746 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cdu-assembly1.cif.gz_O | rnase r bound to a 30s degradation intermediate (main state) | 0.9931 | 4 | 88 |
| 7qv2-assembly1.cif.gz_o | bacillus subtilis collided disome (collided 70s) | 0.9931 | 4 | 88 |
| 7p7q-assembly1.cif.gz_p | e. faecalis 70s ribosome bound by poxta-eq2, high-resolution combined volume | 0.9896 | 4 | 88 |
| 6th6-assembly1.cif.gz_Aq | cryo-em structure of t. kodakarensis 70s ribosome | 0.9891 | 29 | 74 |
| 8ova-assembly1.cif.gz_AG | cryo-em structure of trypanosoma brucei procyclic form 80s ribosome : parental strain | 0.9888 | 32 | 72 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6az1T02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9849 | 29 | 72 | 1.10.287.10 |
| 6g18N02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9798 | 32 | 72 | 1.10.287.10 |
| 1kuqA00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9789 | 4 | 87 | 1.10.287.10 |
| 4dr7O00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9784 | 3 | 89 | 1.10.287.10 |
| 4dv5O00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9783 | 3 | 88 | 1.10.287.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G0N241-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.003 | 3 | 88 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A1V5RB61-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.002 | 3 | 88 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A0G0FB87-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.002 | 3 | 83 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A2H0WLP9-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.001 | 1 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-I3ZFY2-F1-model_v4 | Small ribosomal subunit protein uS15 | 1.001 | 3 | 89 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |