F470157

General Info

Members Datasets Scaffolds Average Seq Length
622 363 1244 269

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056060235|8056064764
Length 303
Sequence DGLRKTYSGRGREVEAVRDLTFRLGEGELACLVGPSGCGKTTLLKCVSGLMRPTAGSVALDGRPVTGPPPDMAVVFQEYGRSLFPWLTVRGNVELPLKEKRLPKPRRRELVDGALEAVGLGHAGSQHPWELSGGMQQRVAIARAIAYEPRVLLMDEPFAAVDAQTRADLEDLIRGLWQRFSMTVLFVTHDIDEAVYLGQRVIVLSASPTVVQDDVSVDLPDERDQLTTRSAPRFAELRAHVYREIQNAKNGGGGPSGTGATGTGGAEGSGADGGGGAGDAEGADGEGGADGPDRAPTATGGRR

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
148 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
156 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
276 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
277 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
278 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
279 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
280 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
281 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
282 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
283 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
284 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
285 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
288 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
289 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
290 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
291 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
292 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
295 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
299 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
300 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
301 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
302 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
303 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
304 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
305 2643221575 Microbacterium sp. Root61 Isolate Unclassified
306 2643221615 Nocardioides sp. Root224 Isolate Unclassified
307 2643221647 Streptomyces sp. Root369 Isolate Unclassified
308 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
309 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
310 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
311 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
312 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
313 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
314 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
315 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
316 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
317 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
318 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
319 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
320 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
321 2808606372 Agromyces sp. 23-23 Isolate Unclassified
322 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
323 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
324 2808606448 Streptomyces sp. 193411 Isolate Unclassified
325 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
326 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
327 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
328 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
329 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
330 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
331 2867428634 Streptomyces sp. RP5T Isolate Unclassified
332 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
333 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
334 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
335 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
336 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
337 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
338 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
339 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
340 2920879853 Kocuria salina CV6 Isolate Unclassified
341 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
342 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
343 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
344 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
345 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
346 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
347 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
348 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
349 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
350 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
351 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
352 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
353 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
354 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
355 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
356 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
357 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
358 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
359 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
360 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
361 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
362 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
363 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.75
Metatranscriptomes 0.48
Isolates 10.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.07
Nodule 0.32
Rhizoplane 3.22
Rhizosphere 71.86
Stem 0
Stem Tuber 0.16
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000596 3300000549 Bacteria 5862
2 LJQas_1002741 3300000549 Bacteria 2422
3 JGI24737J22298_10030517 3300001990 Bacteria 1687
4 JGI25406J46586_10003116 3300003203 Bacteria 7793
5 JGI25406J46586_10024439 3300003203 Bacteria 2367
6 rootH1_10009897 3300003316 Bacteria 1598
7 rootH1_10025406 3300003316 Bacteria 18733
8 Ga0006562J51391_1057537 3300003578 Bacteria 3420
9 Ga0006562J51391_1057538 3300003578 Bacteria 3430
10 Ga0065714_10069984 3300005288 Bacteria 4014
11 Ga0070683_100002404 3300005329 Bacteria 14865
12 Ga0070683_100019464 3300005329 Bacteria 6030
13 Ga0070683_100041327 3300005329 Bacteria 4242
14 Ga0070683_100169285 3300005329 Bacteria 2073
15 Ga0070683_100221174 3300005329 Bacteria 1800
16 Ga0068869_100007622 3300005334 Bacteria 6928
17 Ga0068868_100002895 3300005338 Bacteria 11909
18 Ga0070660_100055353 3300005339 Bacteria 3065
19 Ga0070661_100373910 3300005344 Bacteria 1122
20 Ga0070692_10022749 3300005345 Bacteria 3065
21 Ga0070668_100009814 3300005347 Bacteria 7093
22 Ga0070668_100282237 3300005347 Bacteria 1387
23 Ga0070675_100018183 3300005354 Bacteria 5594
24 Ga0070659_100030265 3300005366 Bacteria 4189
25 Ga0070667_100165602 3300005367 Bacteria 1949
26 Ga0070709_10207447 3300005434 Bacteria 1391
27 Ga0070713_100119214 3300005436 Bacteria 2312
28 Ga0070700_100019999 3300005441 Bacteria 3872
29 Ga0070663_100001844 3300005455 Bacteria 11809
30 Ga0070678_100155273 3300005456 Bacteria 1848
31 Ga0070681_10009819 3300005458 Bacteria 9426
32 Ga0070679_100003551 3300005530 Bacteria 14289
33 Ga0070679_100085512 3300005530 Bacteria 3141
34 Ga0070679_100286906 3300005530 Bacteria 1598
35 Ga0070684_100002189 3300005535 Bacteria 14422
36 Ga0070684_100009394 3300005535 Bacteria 7699
37 Ga0070684_100340308 3300005535 Bacteria 1379
38 Ga0070684_100358972 3300005535 Bacteria 1341
39 Ga0070665_100008496 3300005548 Bacteria 10386
40 Ga0068855_100000499 3300005563 Bacteria 48513
41 Ga0068855_100916659 3300005563 Bacteria 925
42 Ga0070664_100000400 3300005564 Bacteria 32343
43 Ga0070664_100085034 3300005564 Bacteria 2732
44 Ga0070664_100263265 3300005564 Bacteria 1552
45 Ga0068857_100109796 3300005577 Bacteria 2478
46 Ga0068859_100027584 3300005617 Bacteria 5695
47 Ga0068859_100173691 3300005617 Bacteria 2237
48 Ga0068859_100392516 3300005617 Bacteria 1483
49 Ga0068859_100448301 3300005617 Bacteria 1387
50 Ga0068864_100010697 3300005618 Bacteria 7583
51 Ga0068864_100226283 3300005618 Bacteria 1728
52 Ga0068864_100401353 3300005618 Bacteria 1303
53 Ga0068861_100010616 3300005719 Bacteria 6396
54 Ga0068861_100398957 3300005719 Bacteria 1220
55 Ga0068863_100007611 3300005841 Bacteria 10592
56 Ga0068858_100169843 3300005842 Bacteria 2056
57 Ga0068860_100012412 3300005843 Bacteria 8394
58 Ga0068860_100132151 3300005843 Bacteria 2396
59 Ga0068860_100347683 3300005843 Bacteria 1459
60 Ga0068860_100579564 3300005843 Bacteria 1126
61 Ga0068860_100869192 3300005843 Bacteria 917
62 Ga0068862_100075266 3300005844 Bacteria 2920
63 Ga0068862_100314799 3300005844 Bacteria 1443
64 Ga0081539_10000420 3300005985 Bacteria 90166
65 Ga0081539_10000516 3300005985 Bacteria 80445
66 Ga0081539_10010012 3300005985 Bacteria 7807
67 Ga0075365_10014378 3300006038 Bacteria 4759
68 Ga0075365_10412779 3300006038 Bacteria 953
69 Ga0075368_10025395 3300006042 Bacteria 2274
70 Ga0075363_100013243 3300006048 Bacteria 3992
71 Ga0075363_100107799 3300006048 Bacteria 1546
72 Ga0075364_10013237 3300006051 Bacteria 5064
73 Ga0075367_10000070 3300006178 Bacteria 25863
74 Ga0075369_10006180 3300006186 Bacteria 4520
75 Ga0097621_100429015 3300006237 Bacteria 1188
76 Ga0075370_10011256 3300006353 Bacteria 4695
77 Ga0075370_10065402 3300006353 Bacteria 2074
78 Ga0075428_100000304 3300006844 Bacteria 48365
79 Ga0075428_100001025 3300006844 Bacteria 29580
80 Ga0075428_100067744 3300006844 Bacteria 3906
81 Ga0075430_100002208 3300006846 Bacteria 16135
82 Ga0075430_100002520 3300006846 Bacteria 15268
83 Ga0075430_100062717 3300006846 Bacteria 3121
84 Ga0075431_100000395 3300006847 Bacteria 35082
85 Ga0075431_100007622 3300006847 Bacteria 10777
86 Ga0075431_100029198 3300006847 Bacteria 5673
87 Ga0075429_100005006 3300006880 Bacteria 11410
88 Ga0075429_100012574 3300006880 Bacteria 7340
89 Ga0075429_100017807 3300006880 Bacteria 6144
90 Ga0075429_100203296 3300006880 Bacteria 1736
91 Ga0075429_100309522 3300006880 Bacteria 1383
92 Ga0097620_100027586 3300006931 Bacteria 5695
93 Ga0097620_100173677 3300006931 Bacteria 2237
94 Ga0097620_100392495 3300006931 Bacteria 1483
95 Ga0097620_100448299 3300006931 Bacteria 1387
96 Ga0105240_10002321 3300009093 Bacteria 30791
97 Ga0105240_10038307 3300009093 Bacteria 6150
98 Ga0111539_10014299 3300009094 Bacteria 9912
99 Ga0105245_10001349 3300009098 Bacteria 22261
100 Ga0105247_10193071 3300009101 Bacteria 1364
101 Ga0114129_10000016 3300009147 Bacteria 127415
102 Ga0114129_10034053 3300009147 Bacteria 7196
103 Ga0114129_10043514 3300009147 Bacteria 6317
104 Ga0114129_10065434 3300009147 Bacteria 5074
105 Ga0114129_10363594 3300009147 Bacteria 1914
106 Ga0114129_10734211 3300009147 Bacteria 1266
107 Ga0105243_10131274 3300009148 Bacteria 2125
108 Ga0105248_10044411 3300009177 Bacteria 4983
109 Ga0105237_10159075 3300009545 Bacteria 2256
110 Ga0105237_10362773 3300009545 Bacteria 1453
111 Ga0105237_10660427 3300009545 Bacteria 1052
112 Ga0105238_10342978 3300009551 Bacteria 1482
113 Ga0105249_10344702 3300009553 Bacteria 1508
114 Ga0105246_10064062 3300011119 Bacteria 2567
115 Ga0105246_10350723 3300011119 Bacteria 1209
116 Ga0157373_10008145 3300013100 Bacteria 7795
117 Ga0157369_10021019 3300013105 Bacteria 7296
118 Ga0157369_10297024 3300013105 Bacteria 1681
119 Ga0157372_10023772 3300013307 Bacteria 6648
120 Ga0157375_10102094 3300013308 Bacteria 2952
121 Ga0157375_10104363 3300013308 Bacteria 2923
122 Ga0163163_10071097 3300014325 Bacteria 3467
123 Ga0163163_10186313 3300014325 Bacteria 2123
124 Ga0163163_10447430 3300014325 Bacteria 1352
125 Ga0183367_1001 3300015688 Bacteria 1225545
126 Ga0206353_10788600 3300020082 Bacteria 2011
127 Ga0207655_1007260 3300025728 Bacteria 7214
128 Ga0207688_10121477 3300025901 Bacteria 1525
129 Ga0207647_10093102 3300025904 Bacteria 1796
130 Ga0207699_10082365 3300025906 Bacteria 1999
131 Ga0207699_10128407 3300025906 Bacteria 1650
132 Ga0207695_10119453 3300025913 Bacteria 2606
133 Ga0207695_10131671 3300025913 Bacteria 2458
134 Ga0207657_10226649 3300025919 Bacteria 1495
135 Ga0207649_10307711 3300025920 Bacteria 1161
136 Ga0207652_10008439 3300025921 Bacteria 8291
137 Ga0207652_10202611 3300025921 Bacteria 1786
138 Ga0207652_10551835 3300025921 Bacteria 1035
139 Ga0207681_10082984 3300025923 Bacteria 2267
140 Ga0207694_10487013 3300025924 Bacteria 1032
141 Ga0207659_10004040 3300025926 Bacteria 8854
142 Ga0207687_10020046 3300025927 Bacteria 4434
143 Ga0207690_10112880 3300025932 Bacteria 1960
144 Ga0207709_10150774 3300025935 Bacteria 1610
145 Ga0207665_10059386 3300025939 Bacteria 2588
146 Ga0207711_10018049 3300025941 Bacteria 5865
147 Ga0207689_10003886 3300025942 Bacteria 13615
148 Ga0207661_10001232 3300025944 Bacteria 17127
149 Ga0207661_10012505 3300025944 Bacteria 6169
150 Ga0207661_10381483 3300025944 Bacteria 1276
151 Ga0207661_10571779 3300025944 Bacteria 1036
152 Ga0207679_10003251 3300025945 Bacteria 10038
153 Ga0207679_10057171 3300025945 Bacteria 2884
154 Ga0207679_10173061 3300025945 Bacteria 1779
155 Ga0207667_10175535 3300025949 Bacteria 2201
156 Ga0207667_10510998 3300025949 Bacteria 1218
157 Ga0207712_10695442 3300025961 Bacteria 887
158 Ga0207668_10002369 3300025972 Bacteria 11009
159 Ga0207668_10024688 3300025972 Bacteria 3882
160 Ga0207640_10173284 3300025981 Bacteria 1610
161 Ga0207703_10114425 3300026035 Bacteria 2307
162 Ga0207639_10241696 3300026041 Bacteria 1570
163 Ga0207678_10044066 3300026067 Bacteria 3860
164 Ga0207708_10018419 3300026075 Bacteria 5259
165 Ga0207708_10207868 3300026075 Bacteria 1564
166 Ga0207702_10615431 3300026078 Bacteria 1066
167 Ga0207641_10058880 3300026088 Bacteria 3270
168 Ga0207641_10158013 3300026088 Bacteria 2059
169 Ga0207641_10187700 3300026088 Bacteria 1898
170 Ga0207641_10525006 3300026088 Bacteria 1152
171 Ga0207676_10032168 3300026095 Bacteria 3950
172 Ga0207676_10145011 3300026095 Bacteria 2038
173 Ga0207674_10051989 3300026116 Bacteria 4179
174 Ga0207674_10453398 3300026116 Bacteria 1240
175 Ga0207675_100026238 3300026118 Bacteria 5424
176 Ga0207675_100103717 3300026118 Bacteria 2680
177 Ga0207675_100215529 3300026118 Bacteria 1848
178 Ga0207683_10095674 3300026121 Bacteria 2648
179 Ga0209371_1017942 3300027312 Bacteria 1815
180 Ga0209371_1033586 3300027312 Bacteria 1094
181 Ga0209813_10023690 3300027866 Bacteria 1747
182 Ga0207428_10126712 3300027907 Bacteria 1955
183 Ga0268265_10008472 3300028380 Bacteria 6947
184 Ga0268265_10033961 3300028380 Bacteria 3714
185 Ga0268264_10012919 3300028381 Bacteria 6865
186 Ga0268264_10143491 3300028381 Bacteria 2132
187 Ga0268264_10242634 3300028381 Bacteria 1670
188 Ga0268264_10465006 3300028381 Bacteria 1228
189 Ga0268264_10511098 3300028381 Bacteria 1173
190 Ga0265334_10022298 3300028573 Bacteria 2581
191 Ga0307517_10032028 3300028786 Bacteria 6095
192 Ga0307517_10036002 3300028786 Bacteria 5582
193 Ga0307517_10071279 3300028786 Bacteria 3117
194 Ga0307515_10000032 3300028794 Bacteria 358317
195 Ga0307515_10000441 3300028794 Bacteria 99819
196 Ga0307515_10009142 3300028794 Bacteria 19211
197 Ga0307515_10034349 3300028794 Bacteria 8307
198 Ga0307515_10054535 3300028794 Bacteria 5866
199 Ga0307515_10055209 3300028794 Bacteria 5811
200 Ga0307515_10152095 3300028794 Bacteria 2412
201 Ga0268256_1037865 3300030500 Bacteria 1101
202 Ga0307511_10000078 3300030521 Bacteria 81896
203 Ga0307511_10003617 3300030521 Bacteria 15831
204 Ga0307511_10059637 3300030521 Bacteria 2932
205 Ga0307512_10003190 3300030522 Bacteria 19437
206 Ga0307512_10007424 3300030522 Bacteria 10881
207 Ga0307512_10009925 3300030522 Bacteria 9130
208 Ga0307512_10016644 3300030522 Bacteria 6779
209 Ga0307512_10065804 3300030522 Bacteria 2743
210 Ga0265331_10002601 3300031250 Bacteria 12136
211 Ga0307513_10002116 3300031456 Bacteria 27860
212 Ga0307513_10015623 3300031456 Bacteria 9190
213 Ga0307513_10022771 3300031456 Bacteria 7352
214 Ga0307513_10046533 3300031456 Bacteria 4728
215 Ga0307513_10048152 3300031456 Bacteria 4629
216 Ga0307513_10064779 3300031456 Bacteria 3848
217 Ga0307513_10119639 3300031456 Bacteria 2605
218 Ga0307513_10154756 3300031456 Bacteria 2195
219 Ga0307509_10010252 3300031507 Bacteria 11521
220 Ga0307509_10016786 3300031507 Bacteria 8455
221 Ga0307509_10017104 3300031507 Bacteria 8360
222 Ga0307509_10025362 3300031507 Bacteria 6621
223 Ga0307509_10063942 3300031507 Bacteria 3873
224 Ga0307408_100012276 3300031548 Bacteria 5673
225 Ga0307408_100015101 3300031548 Bacteria 5139
226 Ga0307408_100069856 3300031548 Bacteria 2591
227 Ga0265313_10051504 3300031595 Bacteria 1970
228 Ga0307508_10000796 3300031616 Bacteria 37211
229 Ga0307508_10002224 3300031616 Bacteria 20663
230 Ga0307508_10040146 3300031616 Bacteria 4202
231 Ga0307508_10049703 3300031616 Bacteria 3734
232 Ga0307508_10074235 3300031616 Bacteria 2977
233 Ga0307508_10115810 3300031616 Bacteria 2282
234 Ga0307508_10301898 3300031616 Bacteria 1194
235 Ga0307514_10054613 3300031649 Bacteria 3076
236 Ga0316575_10000001 3300031665 Bacteria 151281
237 Ga0307516_10003173 3300031730 Bacteria 21387
238 Ga0307516_10015617 3300031730 Bacteria 7982
239 Ga0307516_10102541 3300031730 Bacteria 2676
240 Ga0307516_10250173 3300031730 Bacteria 1467
241 Ga0307405_10002186 3300031731 Bacteria 8544
242 Ga0307405_10005453 3300031731 Bacteria 6135
243 Ga0307405_10143400 3300031731 Bacteria 1669
244 Ga0307405_10386162 3300031731 Bacteria 1092
245 Ga0307413_10003427 3300031824 Bacteria 6671
246 Ga0307413_10030807 3300031824 Bacteria 3018
247 Ga0307413_10109309 3300031824 Bacteria 1847
248 Ga0307413_10111556 3300031824 Bacteria 1832
249 Ga0307413_10237552 3300031824 Bacteria 1343
250 Ga0307518_10096433 3300031838 Bacteria 2121
251 Ga0307410_10000399 3300031852 Bacteria 17113
252 Ga0307410_10004241 3300031852 Bacteria 7375
253 Ga0307410_10010375 3300031852 Bacteria 5272
254 Ga0307410_10294144 3300031852 Bacteria 1279
255 Ga0307410_10476588 3300031852 Bacteria 1023
256 Ga0307410_10571119 3300031852 Bacteria 940
257 Ga0326468_10001021 3300031889 Bacteria 2666
258 Ga0307406_10025262 3300031901 Bacteria 3555
259 Ga0307406_10030467 3300031901 Bacteria 3277
260 Ga0307406_10045010 3300031901 Bacteria 2768
261 Ga0307406_10050998 3300031901 Bacteria 2625
262 Ga0307406_10109483 3300031901 Bacteria 1899
263 Ga0307406_10149326 3300031901 Bacteria 1665
264 Ga0307406_10226751 3300031901 Bacteria 1392
265 Ga0307406_10285747 3300031901 Bacteria 1260
266 Ga0307407_10041171 3300031903 Bacteria 2581
267 Ga0307407_10053227 3300031903 Bacteria 2328
268 Ga0307407_10088395 3300031903 Bacteria 1893
269 Ga0307412_10010417 3300031911 Bacteria 5354
270 Ga0307412_10026493 3300031911 Bacteria 3604
271 Ga0307412_10125264 3300031911 Bacteria 1857
272 Ga0307412_10246029 3300031911 Bacteria 1386
273 Ga0307409_100000621 3300031995 Bacteria 15525
274 Ga0307409_100000970 3300031995 Bacteria 13388
275 Ga0307409_100007886 3300031995 Bacteria 6411
276 Ga0307409_100060288 3300031995 Bacteria 2958
277 Ga0307409_100154738 3300031995 Bacteria 1996
278 Ga0307409_100460129 3300031995 Bacteria 1230
279 Ga0307416_100002324 3300032002 Bacteria 10874
280 Ga0307416_100033988 3300032002 Bacteria 3874
281 Ga0307416_100139659 3300032002 Bacteria 2199
282 Ga0307416_100166763 3300032002 Bacteria 2044
283 Ga0307416_100198657 3300032002 Bacteria 1900
284 Ga0307416_100281839 3300032002 Bacteria 1639
285 Ga0307416_100335253 3300032002 Bacteria 1522
286 Ga0307414_10049260 3300032004 Bacteria 2912
287 Ga0307414_10697310 3300032004 Bacteria 919
288 Ga0307414_10725012 3300032004 Bacteria 902
289 Ga0307411_10209875 3300032005 Bacteria 1503
290 Ga0307415_100000024 3300032126 Bacteria 64415
291 Ga0307415_100015422 3300032126 Bacteria 4525
292 Ga0307415_100040823 3300032126 Bacteria 3077
293 Ga0307415_100151983 3300032126 Bacteria 1783
294 Ga0307415_100181398 3300032126 Bacteria 1652
295 Ga0307415_100368483 3300032126 Bacteria 1215
296 Ga0307507_10000498 3300033179 Bacteria 82993
297 Ga0307507_10023205 3300033179 Bacteria 6818
298 Ga0307510_10006665 3300033180 Bacteria 13778
299 Ga0307510_10048757 3300033180 Bacteria 4515
300 Ga0307510_10087821 3300033180 Bacteria 2972
301 Ga0307510_10166918 3300033180 Bacteria 1787
302 Ga0373950_0004470 3300034818 Bacteria 2050
303 Ga0373932_0009754 3300035112 Bacteria 2315
304 Ga0373939_0023958 3300035114 Bacteria 1696
305 Ga0373941_0010371 3300035115 Bacteria 2379
306 Ga0373942_0000741 3300035207 Bacteria 8997
307 Ga0395899_0005360 3300037312 Bacteria 9965
308 Ga0395900_0006186 3300037418 Bacteria 12506
309 Ga0395898_0062908 3300037466 Bacteria 3602
310 Ga0395905_0001876 3300037471 Bacteria 24211
311 Ga0395901_0064706 3300038443 Bacteria 3806
312 Ga0439465_0014658 3300041413 Bacteria 2444
313 Ga0451795_1403164 3300041456 Bacteria 2333
314 Ga0451833_0490481 3300041491 Bacteria 1759
315 Ga0451841_0962967 3300041498 Bacteria 1384
316 Ga0451849_1086887 3300041505 Bacteria 833
317 Ga0451853_0206235 3300041512 Bacteria 5974
318 Ga0451853_1049431 3300041512 Bacteria 4810
319 Ga0451853_2797035 3300041512 Bacteria 2131
320 Ga0439448_0021322 3300042005 Bacteria 2008
321 Ga0439449_0010854 3300042007 Bacteria 3437
322 Ga0439455_0015245 3300042012 Bacteria 1765
323 Ga0450903_000253 3300042138 Bacteria 11811
324 Ga0439458_0001694 3300042157 Bacteria 5505
325 Ga0466965_0068159 3300044683 Bacteria 1786
326 Ga0466966_0003323 3300044684 Bacteria 10596
327 Ga0466961_0001341 3300044693 Bacteria 15161
328 Ga0466963_0240304 3300044694 Bacteria 1270
329 Ga0466964_0032917 3300044706 Bacteria 2062
330 Ga0453684_0025919 3300044712 Bacteria 8490
331 Ga0466971_0001347 3300044719 Bacteria 10293
332 Ga0466968_0051355 3300044735 Bacteria 1761
333 Ga0466970_0000284 3300044765 Bacteria 24793
334 Ga0466970_0123665 3300044765 Bacteria 1418
335 Ga0466959_0018165 3300045049 Bacteria 5161
336 Ga0466958_0130375 3300045836 Bacteria 1579
337 Ga0466967_0047748 3300045976 Bacteria 3734
338 Ga0466967_0623122 3300045976 Bacteria 1066
339 Ga0495592_0005513 3300046454 Bacteria 9357
340 Ga0495603_0002970 3300046455 Bacteria 10027
341 Ga0495603_0003705 3300046455 Bacteria 9098
342 Ga0495603_0021949 3300046455 Bacteria 3864
343 Ga0495629_0014353 3300046459 Bacteria 5698
344 Ga0495629_0156996 3300046459 Bacteria 1580
345 Ga0495629_0157188 3300046459 Bacteria 1579
346 Ga0495638_0014154 3300046460 Bacteria 5401
347 Ga0495651_0014030 3300046462 Bacteria 6197
348 Ga0495580_0031921 3300046472 Bacteria 3803
349 Ga0495582_0065341 3300046473 Bacteria 2010
350 Ga0495639_0006002 3300046475 Bacteria 5223
351 Ga0495662_0000340 3300046476 Bacteria 20432
352 Ga0495584_0142959 3300046491 Bacteria 1215
353 Ga0495594_0007399 3300046499 Bacteria 5650
354 Ga0495594_0018993 3300046499 Bacteria 3649
355 Ga0495594_0102846 3300046499 Bacteria 1607
356 Ga0495610_0067027 3300046512 Bacteria 1688
357 Ga0495620_0049943 3300046515 Bacteria 1787
358 Ga0495628_0015474 3300046516 Bacteria 6371
359 Ga0495630_0185572 3300046517 Bacteria 1586
360 Ga0495630_0190674 3300046517 Bacteria 1564
361 Ga0495632_0039701 3300046519 Bacteria 2374
362 Ga0495632_0056082 3300046519 Bacteria 1927
363 Ga0495643_0003447 3300046522 Bacteria 11567
364 Ga0495643_0040447 3300046522 Bacteria 2547
365 Ga0495666_0048739 3300046526 Bacteria 2039
366 Ga0495666_0155649 3300046526 Bacteria 1061
367 Ga0495652_0022647 3300046529 Bacteria 5574
368 Ga0495587_0010746 3300046536 Bacteria 5812
369 Ga0495597_0053801 3300046542 Bacteria 1769
370 Ga0495645_0024367 3300046543 Bacteria 4390
371 Ga0495622_0036238 3300046557 Bacteria 2300
372 Ga0495633_0084522 3300046558 Bacteria 1476
373 Ga0495667_0100981 3300046559 Bacteria 1867
374 Ga0495656_0063475 3300046615 Bacteria 1619
375 Ga0495625_0006946 3300046660 Bacteria 9986
376 Ga0495625_0190496 3300046660 Bacteria 1359
377 Ga0495635_0005290 3300046663 Bacteria 8978
378 Ga0495635_0229453 3300046663 Bacteria 1254
379 Ga0495588_0006190 3300046674 Bacteria 5376
380 Ga0495588_0018163 3300046674 Bacteria 3425
381 Ga0495588_0053015 3300046674 Bacteria 2091
382 Ga0495657_0002749 3300046675 Bacteria 14671
383 Ga0495657_0013325 3300046675 Bacteria 6072
384 Ga0495646_0005170 3300046680 Bacteria 8231
385 Ga0495658_0008051 3300046683 Bacteria 5219
386 Ga0495613_0001493 3300046689 Bacteria 17818
387 Ga0495613_0013127 3300046689 Bacteria 6154
388 Ga0495613_0017134 3300046689 Bacteria 5394
389 Ga0495670_0012888 3300046691 Bacteria 4109
390 Ga0495649_0102434 3300046694 Bacteria 1521
391 Ga0495589_0032176 3300046794 Bacteria 2638
392 Ga0495600_0012419 3300046809 Bacteria 5325
393 Ga0495660_0030811 3300046810 Bacteria 3020
394 Ga0495660_0099679 3300046810 Bacteria 1497
395 Ga0495581_0003700 3300047315 Bacteria 8807
396 Ga0495581_0053998 3300047315 Bacteria 2319
397 Ga0495581_0071855 3300047315 Bacteria 2002
398 Ga0495581_0075998 3300047315 Bacteria 1943
399 Ga0495604_0006801 3300047317 Bacteria 9065
400 Ga0495636_0002681 3300047318 Bacteria 6873
401 Ga0495636_0006582 3300047318 Bacteria 4568
402 Ga0495672_0021587 3300047320 Bacteria 4198
403 Ga0495676_0015259 3300047321 Bacteria 6846
404 Ga0495676_0025841 3300047321 Bacteria 5061
405 Ga0495676_0161689 3300047321 Bacteria 1584
406 Ga0495676_0341410 3300047321 Bacteria 1002
407 Ga0495687_001186 3300047443 Bacteria 25042
408 Ga0495687_001678 3300047443 Bacteria 19766
409 Ga0495687_011739 3300047443 Bacteria 4685
410 Ga0495687_029296 3300047443 Bacteria 2550
411 Ga0495679_034334 3300047446 Bacteria 1615
412 Ga0495685_003040 3300047447 Bacteria 5315
413 Ga0495685_008653 3300047447 Bacteria 3386
414 Ga0495685_012587 3300047447 Bacteria 2866
415 Ga0495681_0015822 3300047470 Bacteria 4256
416 Ga0495686_0135892 3300047472 Bacteria 1454
417 Ga0495593_0002309 3300047673 Bacteria 11440
418 Ga0495593_0045393 3300047673 Bacteria 2345
419 Ga0495602_0036952 3300048088 Bacteria 4539
420 Ga0495614_0005297 3300048089 Bacteria 5819
421 Ga0495614_0034686 3300048089 Bacteria 2168
422 Ga0495614_0058209 3300048089 Bacteria 1659
423 Ga0496103_0035876 3300048906 Bacteria 3036
424 Ga0496104_0027496 3300048907 Bacteria 5264
425 Ga0496104_0127743 3300048907 Bacteria 2441
426 Ga0496105_0005572 3300048908 Bacteria 9561
427 Ga0496106_0130103 3300048909 Bacteria 1973
428 Ga0496107_0016888 3300048910 Bacteria 5130
429 Ga0496108_0000084 3300048911 Bacteria 101818
430 Ga0496108_0014073 3300048911 Bacteria 6528
431 Ga0496108_0043528 3300048911 Bacteria 3750
432 Ga0496108_0178026 3300048911 Bacteria 1841
433 Ga0496109_0023264 3300048912 Bacteria 5497
434 Ga0496109_0581187 3300048912 Bacteria 1056
435 Ga0496110_0018012 3300048913 Bacteria 5917
436 Ga0496110_0049731 3300048913 Bacteria 3679
437 Ga0496111_0027284 3300048914 Bacteria 4038
438 Ga0496112_0011851 3300048915 Bacteria 7985
439 Ga0496113_0001249 3300048916 Bacteria 13992
440 Ga0496114_0011788 3300048917 Bacteria 6994
441 Ga0496115_0273224 3300048918 Bacteria 1388
442 Ga0496116_0011065 3300048919 Bacteria 7505
443 Ga0496117_0013915 3300048920 Bacteria 6974
444 Ga0496118_0054047 3300048921 Bacteria 3046
445 Ga0496118_0074966 3300048921 Bacteria 2415
446 Ga0496119_0002946 3300048922 Bacteria 18089
447 Ga0496119_0004914 3300048922 Bacteria 13073
448 Ga0496122_0000071 3300048925 Bacteria 222537
449 Ga0496122_0102519 3300048925 Bacteria 1907
450 Ga0496123_0000006 3300048926 Bacteria 647258
451 Ga0496123_0028192 3300048926 Bacteria 4163
452 Ga0496124_0030121 3300048927 Bacteria 4822
453 Ga0496124_0051310 3300048927 Bacteria 3510
454 Ga0496125_0004539 3300048928 Bacteria 15946
455 Ga0496125_0044359 3300048928 Bacteria 3762
456 Ga0496126_0014484 3300048929 Bacteria 7969
457 Ga0496126_0023817 3300048929 Bacteria 5927
458 Ga0496126_0066200 3300048929 Bacteria 3231
459 Ga0496126_0176449 3300048929 Bacteria 1817
460 Ga0495682_0141507 3300049460 Bacteria 859
461 Ga0501032_0168351 3300049569 Bacteria 1437
462 Ga0501034_0005326 3300049571 Bacteria 14099
463 Ga0501034_0021996 3300049571 Bacteria 6497
464 Ga0501034_0054786 3300049571 Bacteria 4014
465 Ga0501034_0054902 3300049571 Bacteria 4009
466 Ga0501034_0111782 3300049571 Bacteria 2722
467 Ga0501034_0144634 3300049571 Bacteria 2355
468 Ga0501036_0004115 3300049572 Bacteria 11710
469 Ga0501036_0133490 3300049572 Bacteria 2095
470 Ga0501036_0141774 3300049572 Bacteria 2028
471 Ga0501036_0647504 3300049572 Bacteria 875
472 Ga0501037_0001766 3300049573 Bacteria 15699
473 Ga0501037_0109758 3300049573 Bacteria 1988
474 Ga0501037_0213660 3300049573 Bacteria 1359
475 Ga0501038_0000620 3300049574 Bacteria 31614
476 Ga0501038_0000951 3300049574 Bacteria 25879
477 Ga0501039_0011671 3300049575 Bacteria 6692
478 Ga0501042_0004252 3300049578 Bacteria 9113
479 Ga0501043_0006624 3300049579 Bacteria 9266
480 Ga0501043_0010933 3300049579 Bacteria 7110
481 Ga0501043_0028537 3300049579 Bacteria 4381
482 Ga0501043_0051541 3300049579 Bacteria 3234
483 Ga0501046_0006238 3300049580 Bacteria 10582
484 Ga0501047_0003730 3300049581 Bacteria 14347
485 Ga0501047_0050250 3300049581 Bacteria 4026
486 Ga0501047_0097729 3300049581 Bacteria 2814
487 Ga0501048_0009393 3300049582 Bacteria 7342
488 Ga0501048_0011121 3300049582 Bacteria 6710
489 Ga0501067_0174991 3300049583 Bacteria 1195
490 Ga0501070_0004173 3300049586 Bacteria 12436
491 Ga0501070_0033712 3300049586 Bacteria 4285
492 Ga0501070_0060840 3300049586 Bacteria 3130
493 Ga0501070_0414607 3300049586 Bacteria 1088
494 Ga0501071_0002273 3300049587 Bacteria 11570
495 Ga0501073_0000052 3300049589 Bacteria 73681
496 Ga0501074_0002345 3300049590 Bacteria 13178
497 Ga0501076_0198780 3300049592 Bacteria 1637
498 Ga0501076_0241229 3300049592 Bacteria 1479
499 Ga0501080_0037217 3300049742 Bacteria 4543
500 Ga0501035_0020528 3300049822 Bacteria 6067
501 Ga0501035_0190764 3300049822 Bacteria 1762
502 Ga0501035_0452058 3300049822 Bacteria 1062
503 Ga0501044_0002995 3300049823 Bacteria 19132
504 Ga0501044_0012264 3300049823 Bacteria 9277
505 Ga0501045_0432367 3300049824 Bacteria 979
506 nmdc:mga03n38_88177_c1 3300050490 Bacteria 1471
507 nmdc:mga00v17_64125_c1 3300050491 Bacteria 2264
508 nmdc:mga0yw44_19609_c1 3300050492 Bacteria 3733
509 nmdc:mga0yw44_23534_c1 3300050492 Bacteria 3472
510 nmdc:mga06z11_1567_c1 3300050494 Bacteria 8505
511 nmdc:mga06z11_4243_c1 3300050494 Bacteria 5621
512 nmdc:mga04h51_28016_c1 3300050495 Bacteria 1755
513 nmdc:mga05p37_155_c1 3300050507 Bacteria 65410
514 nmdc:mga05p37_247915_c1 3300050507 Bacteria 2138
515 nmdc:mga05p37_8760_c1 3300050507 Bacteria 11952
516 nmdc:mga09592_1_c1 3300050508 Bacteria 201102
517 nmdc:mga09592_333551_c1 3300050508 Bacteria 1313
518 nmdc:mga09592_34396_c1 3300050508 Bacteria 4236
519 nmdc:mga0qj67_109690_c1 3300050509 Bacteria 2227
520 nmdc:mga0qj67_12_c1 3300050509 Bacteria 76377
521 nmdc:mga0qj67_431917_c1 3300050509 Bacteria 1062
522 nmdc:mga06r32_4464_c1 3300050510 Bacteria 12530
523 nmdc:mga06r32_77719_c1 3300050510 Bacteria 3225
524 nmdc:mga06r32_7_c1 3300050510 Bacteria 117700
525 nmdc:mga06r32_849_c4 3300050510 Bacteria 2447
526 nmdc:mga08y16_11182_c1 3300050511 Bacteria 9427
527 nmdc:mga0sz30_61994_c1 3300050516 Bacteria 1599
528 Ga0500610_0049272 3300053079 Bacteria 2191
529 Ga0495655_0049460 3300053083 Bacteria 1107
530 Ga0500578_0023355 3300053086 Bacteria 3970
531 Ga0500644_0010140 3300053088 Bacteria 2542
532 Ga0500644_0060604 3300053088 Bacteria 1331
533 Ga0500646_0001103 3300053090 Bacteria 7339
534 Ga0500646_0001786 3300053090 Bacteria 5662
535 Ga0500583_0023846 3300053092 Bacteria 2586
536 Ga0500651_0122477 3300053093 Bacteria 1578
537 Ga0500566_0058459 3300053094 Bacteria 2189
538 Ga0500566_0096970 3300053094 Bacteria 1622
539 Ga0500640_002872 3300053095 Bacteria 5838
540 Ga0500650_0043608 3300053098 Bacteria 2075
541 Ga0500650_0065261 3300053098 Bacteria 1700
542 Ga0500660_134853 3300053100 Bacteria 995
543 Ga0500569_003345 3300053109 Bacteria 3268
544 Ga0500569_003754 3300053109 Bacteria 3136
545 Ga0500594_0058027 3300053118 Bacteria 1108
546 Ga0500614_008553 3300053123 Bacteria 2171
547 Ga0500652_007533 3300053131 Bacteria 3570
548 Ga0500658_0009856 3300053134 Bacteria 3523
549 Ga0500573_0021607 3300053140 Bacteria 3690
550 Ga0500579_047418 3300053143 Bacteria 2652
551 Ga0500616_0008545 3300053153 Bacteria 6345
552 Ga0500634_0010335 3300053161 Bacteria 4765
553 Ga0500587_001908 3300053739 Bacteria 2973
554 Ga0501084_0524701 3300054114 Bacteria 1001
555 Ga0466962_0000367 3300061719 Bacteria 19469
556 8056064764 8056060235 Bacteria 7259403
557 2537900237 2537561592 Bacteria 4348607
558 2585303961 2582581313 Bacteria 10042643
559 2585311918 2582581314 Bacteria 11452267
560 2616699072 2616644814 Bacteria 11555299
561 2623500963 2622736605 Bacteria 4992138
562 2623589745 2622736626 Bacteria 7181580
563 2643887865 2643221575 Bacteria 4022601
564 2644093071 2643221615 Bacteria 5487866
565 2644263741 2643221647 Bacteria 10741251
566 2644322682 2643221657 Bacteria 5490246
567 2676481100 2675903059 Bacteria 8644972
568 2676490940 2675903060 Bacteria 10051191
569 2691514935 2690315906 Bacteria 4517044
570 2753269816 2751185782 Bacteria 11227053
571 2774397709 2773857763 Bacteria 4180068
572 2784591836 2784132148 Bacteria 8627943
573 2785372856 2784746768 Bacteria 10036182
574 2786675120 2786546132 Bacteria 10419719
575 2791914230 2791354901 Bacteria 8322202
576 2793185224 2791355222 Bacteria 5898266
577 2808845201 2808606359 Bacteria 9866990
578 2808874726 2808606365 Bacteria 4301966
579 2808900372 2808606372 Bacteria 4649509
580 2808914814 2808606375 Bacteria 9466072
581 2809226063 2808606447 Bacteria 3572005
582 2809235456 2808606448 Bacteria 8656184
583 2812325020 2811994872 Bacteria 4121241
584 2852632353 2852632344 Bacteria 3463163
585 2862283171 2862281513 Bacteria 9621493
586 2862386700 2862382967 Bacteria 10317375
587 2862515153 2862507626 Bacteria 9425308
588 2863410127 2863404153 Bacteria 9672205
589 2867429089 2867428634 Bacteria 9590268
590 2877677838 2877676314 Bacteria 9512378
591 2884694981 2884693830 Bacteria 11273186
592 2895446331 2895442618 Bacteria 11027144
593 2899370935 2899370129 Bacteria 6781179
594 2905929608 2905926851 Bacteria 4423176
595 2912716108 2912715099 Bacteria 9460473
596 2919054185 2919051321 Bacteria 4210889
597 2919470991 2919468124 Bacteria 9133025
598 2920881507 2920879853 Bacteria 4216831
599 2939599009 2939598168 Bacteria 4687164
600 2945969445 2945968032 Bacteria 4111363
601 2954009063 2954002825 Bacteria 9173742
602 2954382627 2954380949 Bacteria 10050426
603 2954680255 2954673503 Bacteria 9685905
604 2954683896 2954682443 Bacteria 9862841
605 2954693449 2954691527 Bacteria 10720516
606 2954708543 2954701450 Bacteria 10834262
607 2954713120 2954711539 Bacteria 10867210
608 2954723080 2954721474 Bacteria 10456478
609 2954738750 2954731030 Bacteria 10243860
610 2954741987 2954740390 Bacteria 10229294
611 2954757607 2954749733 Bacteria 10366972
612 2954760964 2954759201 Bacteria 9358192
613 2990065484 2990059506 Bacteria 9321252
614 2990067577 2990059506 Bacteria 9321252
615 3003009533 3002998708 Bacteria 11715108
616 3006324426 3006321560 Bacteria 8247479
617 3006501722 3006493962 Bacteria 8825450
618 8008564150 8008558824 Bacteria 10610750
619 8045831339 8045830549 Bacteria 4444727
620 8046992764 8046991243 Bacteria 8497463
621 8054107355 8054107350 Bacteria 5022511
622 8055034788 8055034563 Bacteria 3562128
623 LJQas_1000596
624 LJQas_1002741
625 JGI24737J22298_10030517
626 JGI25406J46586_10003116
627 JGI25406J46586_10024439
628 rootH1_10009897
629 rootH1_10025406
630 Ga0006562J51391_1057537
631 Ga0006562J51391_1057538
632 Ga0065714_10069984
633 Ga0070683_100002404
634 Ga0070683_100019464
635 Ga0070683_100041327
636 Ga0070683_100169285
637 Ga0070683_100221174
638 Ga0068869_100007622
639 Ga0068868_100002895
640 Ga0070660_100055353
641 Ga0070661_100373910
642 Ga0070692_10022749
643 Ga0070668_100009814
644 Ga0070668_100282237
645 Ga0070675_100018183
646 Ga0070659_100030265
647 Ga0070667_100165602
648 Ga0070709_10207447
649 Ga0070713_100119214
650 Ga0070700_100019999
651 Ga0070663_100001844
652 Ga0070678_100155273
653 Ga0070681_10009819
654 Ga0070679_100003551
655 Ga0070679_100085512
656 Ga0070679_100286906
657 Ga0070684_100002189
658 Ga0070684_100009394
659 Ga0070684_100340308
660 Ga0070684_100358972
661 Ga0070665_100008496
662 Ga0068855_100000499
663 Ga0068855_100916659
664 Ga0070664_100000400
665 Ga0070664_100085034
666 Ga0070664_100263265
667 Ga0068857_100109796
668 Ga0068859_100027584
669 Ga0068859_100173691
670 Ga0068859_100392516
671 Ga0068859_100448301
672 Ga0068864_100010697
673 Ga0068864_100226283
674 Ga0068864_100401353
675 Ga0068861_100010616
676 Ga0068861_100398957
677 Ga0068863_100007611
678 Ga0068858_100169843
679 Ga0068860_100012412
680 Ga0068860_100132151
681 Ga0068860_100347683
682 Ga0068860_100579564
683 Ga0068860_100869192
684 Ga0068862_100075266
685 Ga0068862_100314799
686 Ga0081539_10000420
687 Ga0081539_10000516
688 Ga0081539_10010012
689 Ga0075365_10014378
690 Ga0075365_10412779
691 Ga0075368_10025395
692 Ga0075363_100013243
693 Ga0075363_100107799
694 Ga0075364_10013237
695 Ga0075367_10000070
696 Ga0075369_10006180
697 Ga0097621_100429015
698 Ga0075370_10011256
699 Ga0075370_10065402
700 Ga0075428_100000304
701 Ga0075428_100001025
702 Ga0075428_100067744
703 Ga0075430_100002208
704 Ga0075430_100002520
705 Ga0075430_100062717
706 Ga0075431_100000395
707 Ga0075431_100007622
708 Ga0075431_100029198
709 Ga0075429_100005006
710 Ga0075429_100012574
711 Ga0075429_100017807
712 Ga0075429_100203296
713 Ga0075429_100309522
714 Ga0097620_100027586
715 Ga0097620_100173677
716 Ga0097620_100392495
717 Ga0097620_100448299
718 Ga0105240_10002321
719 Ga0105240_10038307
720 Ga0111539_10014299
721 Ga0105245_10001349
722 Ga0105247_10193071
723 Ga0114129_10000016
724 Ga0114129_10034053
725 Ga0114129_10043514
726 Ga0114129_10065434
727 Ga0114129_10363594
728 Ga0114129_10734211
729 Ga0105243_10131274
730 Ga0105248_10044411
731 Ga0105237_10159075
732 Ga0105237_10362773
733 Ga0105237_10660427
734 Ga0105238_10342978
735 Ga0105249_10344702
736 Ga0105246_10064062
737 Ga0105246_10350723
738 Ga0157373_10008145
739 Ga0157369_10021019
740 Ga0157369_10297024
741 Ga0157372_10023772
742 Ga0157375_10102094
743 Ga0157375_10104363
744 Ga0163163_10071097
745 Ga0163163_10186313
746 Ga0163163_10447430
747 Ga0183367_1001
748 Ga0206353_10788600
749 Ga0207655_1007260
750 Ga0207688_10121477
751 Ga0207647_10093102
752 Ga0207699_10082365
753 Ga0207699_10128407
754 Ga0207695_10119453
755 Ga0207695_10131671
756 Ga0207657_10226649
757 Ga0207649_10307711
758 Ga0207652_10008439
759 Ga0207652_10202611
760 Ga0207652_10551835
761 Ga0207681_10082984
762 Ga0207694_10487013
763 Ga0207659_10004040
764 Ga0207687_10020046
765 Ga0207690_10112880
766 Ga0207709_10150774
767 Ga0207665_10059386
768 Ga0207711_10018049
769 Ga0207689_10003886
770 Ga0207661_10001232
771 Ga0207661_10012505
772 Ga0207661_10381483
773 Ga0207661_10571779
774 Ga0207679_10003251
775 Ga0207679_10057171
776 Ga0207679_10173061
777 Ga0207667_10175535
778 Ga0207667_10510998
779 Ga0207712_10695442
780 Ga0207668_10002369
781 Ga0207668_10024688
782 Ga0207640_10173284
783 Ga0207703_10114425
784 Ga0207639_10241696
785 Ga0207678_10044066
786 Ga0207708_10018419
787 Ga0207708_10207868
788 Ga0207702_10615431
789 Ga0207641_10058880
790 Ga0207641_10158013
791 Ga0207641_10187700
792 Ga0207641_10525006
793 Ga0207676_10032168
794 Ga0207676_10145011
795 Ga0207674_10051989
796 Ga0207674_10453398
797 Ga0207675_100026238
798 Ga0207675_100103717
799 Ga0207675_100215529
800 Ga0207683_10095674
801 Ga0209371_1017942
802 Ga0209371_1033586
803 Ga0209813_10023690
804 Ga0207428_10126712
805 Ga0268265_10008472
806 Ga0268265_10033961
807 Ga0268264_10012919
808 Ga0268264_10143491
809 Ga0268264_10242634
810 Ga0268264_10465006
811 Ga0268264_10511098
812 Ga0265334_10022298
813 Ga0307517_10032028
814 Ga0307517_10036002
815 Ga0307517_10071279
816 Ga0307515_10000032
817 Ga0307515_10000441
818 Ga0307515_10009142
819 Ga0307515_10034349
820 Ga0307515_10054535
821 Ga0307515_10055209
822 Ga0307515_10152095
823 Ga0268256_1037865
824 Ga0307511_10000078
825 Ga0307511_10003617
826 Ga0307511_10059637
827 Ga0307512_10003190
828 Ga0307512_10007424
829 Ga0307512_10009925
830 Ga0307512_10016644
831 Ga0307512_10065804
832 Ga0265331_10002601
833 Ga0307513_10002116
834 Ga0307513_10015623
835 Ga0307513_10022771
836 Ga0307513_10046533
837 Ga0307513_10048152
838 Ga0307513_10064779
839 Ga0307513_10119639
840 Ga0307513_10154756
841 Ga0307509_10010252
842 Ga0307509_10016786
843 Ga0307509_10017104
844 Ga0307509_10025362
845 Ga0307509_10063942
846 Ga0307408_100012276
847 Ga0307408_100015101
848 Ga0307408_100069856
849 Ga0265313_10051504
850 Ga0307508_10000796
851 Ga0307508_10002224
852 Ga0307508_10040146
853 Ga0307508_10049703
854 Ga0307508_10074235
855 Ga0307508_10115810
856 Ga0307508_10301898
857 Ga0307514_10054613
858 Ga0316575_10000001
859 Ga0307516_10003173
860 Ga0307516_10015617
861 Ga0307516_10102541
862 Ga0307516_10250173
863 Ga0307405_10002186
864 Ga0307405_10005453
865 Ga0307405_10143400
866 Ga0307405_10386162
867 Ga0307413_10003427
868 Ga0307413_10030807
869 Ga0307413_10109309
870 Ga0307413_10111556
871 Ga0307413_10237552
872 Ga0307518_10096433
873 Ga0307410_10000399
874 Ga0307410_10004241
875 Ga0307410_10010375
876 Ga0307410_10294144
877 Ga0307410_10476588
878 Ga0307410_10571119
879 Ga0326468_10001021
880 Ga0307406_10025262
881 Ga0307406_10030467
882 Ga0307406_10045010
883 Ga0307406_10050998
884 Ga0307406_10109483
885 Ga0307406_10149326
886 Ga0307406_10226751
887 Ga0307406_10285747
888 Ga0307407_10041171
889 Ga0307407_10053227
890 Ga0307407_10088395
891 Ga0307412_10010417
892 Ga0307412_10026493
893 Ga0307412_10125264
894 Ga0307412_10246029
895 Ga0307409_100000621
896 Ga0307409_100000970
897 Ga0307409_100007886
898 Ga0307409_100060288
899 Ga0307409_100154738
900 Ga0307409_100460129
901 Ga0307416_100002324
902 Ga0307416_100033988
903 Ga0307416_100139659
904 Ga0307416_100166763
905 Ga0307416_100198657
906 Ga0307416_100281839
907 Ga0307416_100335253
908 Ga0307414_10049260
909 Ga0307414_10697310
910 Ga0307414_10725012
911 Ga0307411_10209875
912 Ga0307415_100000024
913 Ga0307415_100015422
914 Ga0307415_100040823
915 Ga0307415_100151983
916 Ga0307415_100181398
917 Ga0307415_100368483
918 Ga0307507_10000498
919 Ga0307507_10023205
920 Ga0307510_10006665
921 Ga0307510_10048757
922 Ga0307510_10087821
923 Ga0307510_10166918
924 Ga0373950_0004470
925 Ga0373932_0009754
926 Ga0373939_0023958
927 Ga0373941_0010371
928 Ga0373942_0000741
929 Ga0395899_0005360
930 Ga0395900_0006186
931 Ga0395898_0062908
932 Ga0395905_0001876
933 Ga0395901_0064706
934 Ga0439465_0014658
935 Ga0451795_1403164
936 Ga0451833_0490481
937 Ga0451841_0962967
938 Ga0451849_1086887
939 Ga0451853_0206235
940 Ga0451853_1049431
941 Ga0451853_2797035
942 Ga0439448_0021322
943 Ga0439449_0010854
944 Ga0439455_0015245
945 Ga0450903_000253
946 Ga0439458_0001694
947 Ga0466965_0068159
948 Ga0466966_0003323
949 Ga0466961_0001341
950 Ga0466963_0240304
951 Ga0466964_0032917
952 Ga0453684_0025919
953 Ga0466971_0001347
954 Ga0466968_0051355
955 Ga0466970_0000284
956 Ga0466970_0123665
957 Ga0466959_0018165
958 Ga0466958_0130375
959 Ga0466967_0047748
960 Ga0466967_0623122
961 Ga0495592_0005513
962 Ga0495603_0002970
963 Ga0495603_0003705
964 Ga0495603_0021949
965 Ga0495629_0014353
966 Ga0495629_0156996
967 Ga0495629_0157188
968 Ga0495638_0014154
969 Ga0495651_0014030
970 Ga0495580_0031921
971 Ga0495582_0065341
972 Ga0495639_0006002
973 Ga0495662_0000340
974 Ga0495584_0142959
975 Ga0495594_0007399
976 Ga0495594_0018993
977 Ga0495594_0102846
978 Ga0495610_0067027
979 Ga0495620_0049943
980 Ga0495628_0015474
981 Ga0495630_0185572
982 Ga0495630_0190674
983 Ga0495632_0039701
984 Ga0495632_0056082
985 Ga0495643_0003447
986 Ga0495643_0040447
987 Ga0495666_0048739
988 Ga0495666_0155649
989 Ga0495652_0022647
990 Ga0495587_0010746
991 Ga0495597_0053801
992 Ga0495645_0024367
993 Ga0495622_0036238
994 Ga0495633_0084522
995 Ga0495667_0100981
996 Ga0495656_0063475
997 Ga0495625_0006946
998 Ga0495625_0190496
999 Ga0495635_0005290
1000 Ga0495635_0229453
1001 Ga0495588_0006190
1002 Ga0495588_0018163
1003 Ga0495588_0053015
1004 Ga0495657_0002749
1005 Ga0495657_0013325
1006 Ga0495646_0005170
1007 Ga0495658_0008051
1008 Ga0495613_0001493
1009 Ga0495613_0013127
1010 Ga0495613_0017134
1011 Ga0495670_0012888
1012 Ga0495649_0102434
1013 Ga0495589_0032176
1014 Ga0495600_0012419
1015 Ga0495660_0030811
1016 Ga0495660_0099679
1017 Ga0495581_0003700
1018 Ga0495581_0053998
1019 Ga0495581_0071855
1020 Ga0495581_0075998
1021 Ga0495604_0006801
1022 Ga0495636_0002681
1023 Ga0495636_0006582
1024 Ga0495672_0021587
1025 Ga0495676_0015259
1026 Ga0495676_0025841
1027 Ga0495676_0161689
1028 Ga0495676_0341410
1029 Ga0495687_001186
1030 Ga0495687_001678
1031 Ga0495687_011739
1032 Ga0495687_029296
1033 Ga0495679_034334
1034 Ga0495685_003040
1035 Ga0495685_008653
1036 Ga0495685_012587
1037 Ga0495681_0015822
1038 Ga0495686_0135892
1039 Ga0495593_0002309
1040 Ga0495593_0045393
1041 Ga0495602_0036952
1042 Ga0495614_0005297
1043 Ga0495614_0034686
1044 Ga0495614_0058209
1045 Ga0496103_0035876
1046 Ga0496104_0027496
1047 Ga0496104_0127743
1048 Ga0496105_0005572
1049 Ga0496106_0130103
1050 Ga0496107_0016888
1051 Ga0496108_0000084
1052 Ga0496108_0014073
1053 Ga0496108_0043528
1054 Ga0496108_0178026
1055 Ga0496109_0023264
1056 Ga0496109_0581187
1057 Ga0496110_0018012
1058 Ga0496110_0049731
1059 Ga0496111_0027284
1060 Ga0496112_0011851
1061 Ga0496113_0001249
1062 Ga0496114_0011788
1063 Ga0496115_0273224
1064 Ga0496116_0011065
1065 Ga0496117_0013915
1066 Ga0496118_0054047
1067 Ga0496118_0074966
1068 Ga0496119_0002946
1069 Ga0496119_0004914
1070 Ga0496122_0000071
1071 Ga0496122_0102519
1072 Ga0496123_0000006
1073 Ga0496123_0028192
1074 Ga0496124_0030121
1075 Ga0496124_0051310
1076 Ga0496125_0004539
1077 Ga0496125_0044359
1078 Ga0496126_0014484
1079 Ga0496126_0023817
1080 Ga0496126_0066200
1081 Ga0496126_0176449
1082 Ga0495682_0141507
1083 Ga0501032_0168351
1084 Ga0501034_0005326
1085 Ga0501034_0021996
1086 Ga0501034_0054786
1087 Ga0501034_0054902
1088 Ga0501034_0111782
1089 Ga0501034_0144634
1090 Ga0501036_0004115
1091 Ga0501036_0133490
1092 Ga0501036_0141774
1093 Ga0501036_0647504
1094 Ga0501037_0001766
1095 Ga0501037_0109758
1096 Ga0501037_0213660
1097 Ga0501038_0000620
1098 Ga0501038_0000951
1099 Ga0501039_0011671
1100 Ga0501042_0004252
1101 Ga0501043_0006624
1102 Ga0501043_0010933
1103 Ga0501043_0028537
1104 Ga0501043_0051541
1105 Ga0501046_0006238
1106 Ga0501047_0003730
1107 Ga0501047_0050250
1108 Ga0501047_0097729
1109 Ga0501048_0009393
1110 Ga0501048_0011121
1111 Ga0501067_0174991
1112 Ga0501070_0004173
1113 Ga0501070_0033712
1114 Ga0501070_0060840
1115 Ga0501070_0414607
1116 Ga0501071_0002273
1117 Ga0501073_0000052
1118 Ga0501074_0002345
1119 Ga0501076_0198780
1120 Ga0501076_0241229
1121 Ga0501080_0037217
1122 Ga0501035_0020528
1123 Ga0501035_0190764
1124 Ga0501035_0452058
1125 Ga0501044_0002995
1126 Ga0501044_0012264
1127 Ga0501045_0432367
1128 nmdc:mga03n38_88177_c1
1129 nmdc:mga00v17_64125_c1
1130 nmdc:mga0yw44_19609_c1
1131 nmdc:mga0yw44_23534_c1
1132 nmdc:mga06z11_1567_c1
1133 nmdc:mga06z11_4243_c1
1134 nmdc:mga04h51_28016_c1
1135 nmdc:mga05p37_155_c1
1136 nmdc:mga05p37_247915_c1
1137 nmdc:mga05p37_8760_c1
1138 nmdc:mga09592_1_c1
1139 nmdc:mga09592_333551_c1
1140 nmdc:mga09592_34396_c1
1141 nmdc:mga0qj67_109690_c1
1142 nmdc:mga0qj67_12_c1
1143 nmdc:mga0qj67_431917_c1
1144 nmdc:mga06r32_4464_c1
1145 nmdc:mga06r32_77719_c1
1146 nmdc:mga06r32_7_c1
1147 nmdc:mga06r32_849_c4
1148 nmdc:mga08y16_11182_c1
1149 nmdc:mga0sz30_61994_c1
1150 Ga0500610_0049272
1151 Ga0495655_0049460
1152 Ga0500578_0023355
1153 Ga0500644_0010140
1154 Ga0500644_0060604
1155 Ga0500646_0001103
1156 Ga0500646_0001786
1157 Ga0500583_0023846
1158 Ga0500651_0122477
1159 Ga0500566_0058459
1160 Ga0500566_0096970
1161 Ga0500640_002872
1162 Ga0500650_0043608
1163 Ga0500650_0065261
1164 Ga0500660_134853
1165 Ga0500569_003345
1166 Ga0500569_003754
1167 Ga0500594_0058027
1168 Ga0500614_008553
1169 Ga0500652_007533
1170 Ga0500658_0009856
1171 Ga0500573_0021607
1172 Ga0500579_047418
1173 Ga0500616_0008545
1174 Ga0500634_0010335
1175 Ga0500587_001908
1176 Ga0501084_0524701
1177 Ga0466962_0000367
1178 8056064764
1179 2537900237
1180 2585303961
1181 2585311918
1182 2616699072
1183 2623500963
1184 2623589745
1185 2643887865
1186 2644093071
1187 2644263741
1188 2644322682
1189 2676481100
1190 2676490940
1191 2691514935
1192 2753269816
1193 2774397709
1194 2784591836
1195 2785372856
1196 2786675120
1197 2791914230
1198 2793185224
1199 2808845201
1200 2808874726
1201 2808900372
1202 2808914814
1203 2809226063
1204 2809235456
1205 2812325020
1206 2852632353
1207 2862283171
1208 2862386700
1209 2862515153
1210 2863410127
1211 2867429089
1212 2877677838
1213 2884694981
1214 2895446331
1215 2899370935
1216 2905929608
1217 2912716108
1218 2919054185
1219 2919470991
1220 2920881507
1221 2939599009
1222 2945969445
1223 2954009063
1224 2954382627
1225 2954680255
1226 2954683896
1227 2954693449
1228 2954708543
1229 2954713120
1230 2954723080
1231 2954738750
1232 2954741987
1233 2954757607
1234 2954760964
1235 2990065484
1236 2990067577
1237 3003009533
1238 3006324426
1239 3006501722
1240 8008564150
1241 8045831339
1242 8046992764
1243 8054107355
1244 8055034788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

159

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9465 15 233
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9449 13 233
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9376 14 234
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9356 13 233
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9336 13 233
ID Description Score Start End Superfamily
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9828 15 259 3.40.50.300
af_Q57855_15_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9668 15 259 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9508 15 251 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9469 13 235 3.40.50.300
af_P77737_9_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9393 13 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Q6DVK8-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system ATPase component 0.978 13 263 GO:0005524
GO:0016887
AF-A0A2W2ERJ8-F1-model_v4 Nitrate ABC transporter ATP-binding protein 0.9728 14 269 GO:0005524
GO:0016887
AF-A0A7W0CI05-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system ATPase subunit 0.9699 11 266 GO:0005524
GO:0016887
AF-A0A534WP09-F1-model_v4 ABC transporter ATP-binding protein 0.9677 13 269 GO:0005524
GO:0016887
AF-A0A1Q6DVK8-F1-model_v4 ABC-type nitrate/sulfonate/bicarbonate transport system ATPase component 0.9663 13 263 GO:0005524
GO:0016887

Map