F469858

General Info

Members Datasets Scaffolds Average Seq Length
619 268 619 137

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0149654|Ga0501033_0149654_1055_1555
Length 166
Sequence MLAGGELRHGVHVRRERGSLRRRHETPGDTVISQPIRILIAKVGLDGHDRGAKIVARALRDGGMDVIYTGLHRTPEEVVSAAVQEDVDVIGVSILSGAHMTLLPRILELLRASDAADVLLVAGGVIPDEDVPVLRDSGVAEIFLQETPPAALVARVRDLVETRRAG

Samples

Sample ID Description Type Environment
1 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
191 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
221 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 99.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26141J51220_1001595 3300003503 Bacteria 1372
2 Ga0065712_10675061 3300005290 Bacteria 557
3 Ga0065715_10234588 3300005293 Bacteria 1201
4 Ga0070676_10000025 3300005328 Bacteria 46204
5 Ga0070676_10011704 3300005328 Bacteria 4776
6 Ga0070690_100133450 3300005330 Bacteria 1679
7 Ga0070670_100038454 3300005331 Bacteria 4114
8 Ga0068869_100000205 3300005334 Bacteria 30762
9 Ga0068869_100027452 3300005334 Bacteria 3969
10 Ga0070680_100002677 3300005336 Bacteria 13202
11 Ga0070680_100133404 3300005336 Bacteria 2079
12 Ga0070682_100000180 3300005337 Bacteria 47178
13 Ga0068868_100073761 3300005338 Bacteria 2725
14 Ga0070660_100000428 3300005339 Bacteria 27846
15 Ga0070689_100158932 3300005340 Bacteria 1826
16 Ga0070689_100434135 3300005340 Bacteria 1115
17 Ga0070691_10004798 3300005341 Bacteria 6156
18 Ga0070691_10046408 3300005341 Bacteria 2063
19 Ga0070691_10064925 3300005341 Bacteria 1762
20 Ga0070691_10709308 3300005341 Bacteria 605
21 Ga0070687_100068462 3300005343 Bacteria 1898
22 Ga0070661_100000822 3300005344 Bacteria 22322
23 Ga0070692_10000133 3300005345 Bacteria 17791
24 Ga0070668_100852858 3300005347 Bacteria 812
25 Ga0070669_100649045 3300005353 Bacteria 888
26 Ga0070671_101016125 3300005355 Bacteria 727
27 Ga0070673_100014726 3300005364 Bacteria 5463
28 Ga0070659_100003379 3300005366 Bacteria 11365
29 Ga0070703_10123293 3300005406 Bacteria 943
30 Ga0070703_10156042 3300005406 Bacteria 862
31 Ga0070713_102330400 3300005436 Bacteria 518
32 Ga0070701_10061719 3300005438 Bacteria 1977
33 Ga0070701_10279822 3300005438 Bacteria 1018
34 Ga0070701_10409444 3300005438 Bacteria 861
35 Ga0070705_100000078 3300005440 Bacteria 53383
36 Ga0070705_100279900 3300005440 Bacteria 1185
37 Ga0070705_100570729 3300005440 Bacteria 870
38 Ga0070700_100020317 3300005441 Bacteria 3845
39 Ga0070694_100000656 3300005444 Bacteria 19138
40 Ga0070694_100002729 3300005444 Bacteria 10474
41 Ga0070694_100023706 3300005444 Bacteria 3951
42 Ga0070694_100092985 3300005444 Bacteria 2119
43 Ga0070694_100514161 3300005444 Bacteria 954
44 Ga0070708_100011090 3300005445 Bacteria 7322
45 Ga0070708_100056325 3300005445 Bacteria 3497
46 Ga0070708_100091473 3300005445 Bacteria 2771
47 Ga0070708_100131402 3300005445 Bacteria 2317
48 Ga0070708_100207098 3300005445 Bacteria 1837
49 Ga0070708_100235322 3300005445 Bacteria 1719
50 Ga0070708_100754913 3300005445 Bacteria 915
51 Ga0070663_100152558 3300005455 Bacteria 1773
52 Ga0070663_100990800 3300005455 Bacteria 730
53 Ga0070662_100753808 3300005457 Bacteria 826
54 Ga0070681_10061725 3300005458 Bacteria 3722
55 Ga0070681_10192940 3300005458 Bacteria 1956
56 Ga0070681_10504015 3300005458 Bacteria 1124
57 Ga0068867_100004170 3300005459 Bacteria 10169
58 Ga0068867_100010785 3300005459 Bacteria 6447
59 Ga0068867_100396359 3300005459 Bacteria 1163
60 Ga0070706_100099348 3300005467 Bacteria 2704
61 Ga0070706_100180428 3300005467 Bacteria 1971
62 Ga0070706_100427321 3300005467 Bacteria 1233
63 Ga0070706_100530460 3300005467 Bacteria 1095
64 Ga0070706_100581227 3300005467 Bacteria 1041
65 Ga0070707_100023174 3300005468 Bacteria 5873
66 Ga0070707_100057153 3300005468 Bacteria 3743
67 Ga0070707_100081846 3300005468 Bacteria 3117
68 Ga0070707_100190765 3300005468 Bacteria 1998
69 Ga0070707_101406691 3300005468 Bacteria 664
70 Ga0070707_101442829 3300005468 Bacteria 655
71 Ga0070698_100002570 3300005471 Bacteria 19982
72 Ga0070698_100013281 3300005471 Bacteria 8716
73 Ga0070698_100142353 3300005471 Bacteria 2349
74 Ga0070698_100193600 3300005471 Bacteria 1970
75 Ga0070698_100651291 3300005471 Bacteria 995
76 Ga0070699_100004138 3300005518 Bacteria 12816
77 Ga0070699_100011799 3300005518 Bacteria 7540
78 Ga0070699_100037436 3300005518 Bacteria 4198
79 Ga0070699_100039547 3300005518 Bacteria 4083
80 Ga0070699_100115835 3300005518 Bacteria 2355
81 Ga0070699_100160585 3300005518 Bacteria 1989
82 Ga0070699_100258733 3300005518 Bacteria 1556
83 Ga0070699_100319318 3300005518 Bacteria 1395
84 Ga0070699_100702458 3300005518 Bacteria 924
85 Ga0070679_100007425 3300005530 Bacteria 10242
86 Ga0070679_100487631 3300005530 Bacteria 1177
87 Ga0070684_101425606 3300005535 Bacteria 652
88 Ga0070697_100003917 3300005536 Bacteria 11435
89 Ga0070697_100040307 3300005536 Bacteria 3778
90 Ga0070697_100041574 3300005536 Bacteria 3721
91 Ga0070697_100043676 3300005536 Bacteria 3630
92 Ga0070697_100119316 3300005536 Bacteria 2205
93 Ga0070697_100206470 3300005536 Bacteria 1671
94 Ga0070697_100226327 3300005536 Bacteria 1594
95 Ga0070697_100435331 3300005536 Bacteria 1141
96 Ga0068853_100000255 3300005539 Bacteria 37353
97 Ga0070695_100001694 3300005545 Bacteria 12419
98 Ga0070695_100030093 3300005545 Bacteria 3378
99 Ga0070695_100054243 3300005545 Bacteria 2579
100 Ga0070695_100081344 3300005545 Bacteria 2143
101 Ga0070696_100001230 3300005546 Bacteria 16617
102 Ga0070696_100095963 3300005546 Bacteria 2118
103 Ga0070696_100200714 3300005546 Bacteria 1489
104 Ga0070696_100482067 3300005546 Bacteria 984
105 Ga0070693_100000163 3300005547 Bacteria 30819
106 Ga0070693_100012218 3300005547 Bacteria 4342
107 Ga0070704_100000731 3300005549 Bacteria 16084
108 Ga0070704_100221928 3300005549 Bacteria 1537
109 Ga0070704_101417181 3300005549 Bacteria 638
110 Ga0068855_100000612 3300005563 Bacteria 43896
111 Ga0070664_100094385 3300005564 Bacteria 2594
112 Ga0068857_100001797 3300005577 Bacteria 17256
113 Ga0068857_100028151 3300005577 Bacteria 4957
114 Ga0068854_100025201 3300005578 Bacteria 4081
115 Ga0068854_100133054 3300005578 Bacteria 1901
116 Ga0068854_100859549 3300005578 Bacteria 795
117 Ga0068856_100000630 3300005614 Bacteria 38381
118 Ga0070702_100040801 3300005615 Bacteria 2599
119 Ga0070702_100194263 3300005615 Bacteria 1338
120 Ga0068852_100118419 3300005616 Bacteria 2420
121 Ga0068859_100001373 3300005617 Bacteria 24750
122 Ga0068859_100565819 3300005617 Bacteria 1231
123 Ga0068859_100571901 3300005617 Bacteria 1224
124 Ga0068866_10099127 3300005718 Bacteria 1604
125 Ga0068861_100037179 3300005719 Bacteria 3619
126 Ga0068870_10000221 3300005840 Bacteria 20755
127 Ga0068870_10026265 3300005840 Bacteria 2902
128 Ga0068863_100022279 3300005841 Bacteria 6048
129 Ga0068858_101536322 3300005842 Bacteria 657
130 Ga0068860_100006069 3300005843 Bacteria 12161
131 Ga0068862_100001036 3300005844 Bacteria 26683
132 Ga0068862_100138891 3300005844 Bacteria 2156
133 Ga0068862_100186520 3300005844 Bacteria 1864
134 Ga0081455_10002783 3300005937 Bacteria 20602
135 Ga0081455_10828678 3300005937 Bacteria 579
136 Ga0070715_10080313 3300006163 Bacteria 1479
137 Ga0070716_100156778 3300006173 Bacteria 1471
138 Ga0070716_100574276 3300006173 Bacteria 844
139 Ga0068871_100300844 3300006358 Bacteria 1408
140 Ga0075428_100146981 3300006844 Bacteria 2562
141 Ga0075430_100006024 3300006846 Bacteria 10227
142 Ga0075430_100090703 3300006846 Bacteria 2556
143 Ga0075430_100097971 3300006846 Bacteria 2450
144 Ga0075431_100000545 3300006847 Bacteria 31644
145 Ga0075431_100014658 3300006847 Bacteria 7931
146 Ga0075431_100030037 3300006847 Bacteria 5596
147 Ga0075431_100037960 3300006847 Bacteria 4959
148 Ga0075431_100161543 3300006847 Bacteria 2303
149 Ga0075431_100605948 3300006847 Bacteria 1079
150 Ga0075431_101372621 3300006847 Bacteria 667
151 Ga0075433_10004845 3300006852 Bacteria 10523
152 Ga0075433_10100818 3300006852 Bacteria 2557
153 Ga0075433_10173881 3300006852 Bacteria 1916
154 Ga0075433_10416632 3300006852 Bacteria 1185
155 Ga0075433_10422885 3300006852 Bacteria 1175
156 Ga0075434_100015216 3300006871 Bacteria 7372
157 Ga0075434_100029618 3300006871 Bacteria 5387
158 Ga0075434_100082923 3300006871 Bacteria 3203
159 Ga0075434_100089103 3300006871 Bacteria 3087
160 Ga0075434_100198110 3300006871 Bacteria 2028
161 Ga0075434_100360388 3300006871 Bacteria 1475
162 Ga0075434_100698760 3300006871 Bacteria 1032
163 Ga0075434_100848119 3300006871 Archaea 929
164 Ga0075429_100052876 3300006880 Bacteria 3533
165 Ga0075429_100069650 3300006880 Bacteria 3063
166 Ga0075429_100181208 3300006880 Bacteria 1846
167 Ga0075429_100799680 3300006880 Bacteria 826
168 Ga0075436_100117044 3300006914 Bacteria 1863
169 Ga0075436_100247907 3300006914 Bacteria 1268
170 Ga0097620_100001373 3300006931 Bacteria 24750
171 Ga0097620_100565730 3300006931 Bacteria 1231
172 Ga0097620_100571910 3300006931 Bacteria 1224
173 Ga0075435_100024469 3300007076 Bacteria 4687
174 Ga0075435_100071470 3300007076 Bacteria 2834
175 Ga0075435_100071626 3300007076 Bacteria 2830
176 Ga0075435_100138485 3300007076 Bacteria 2040
177 Ga0075435_101053728 3300007076 Bacteria 710
178 Ga0099794_10002650 3300007265 Bacteria 6657
179 Ga0099794_10012752 3300007265 Bacteria 3639
180 Ga0099794_10200312 3300007265 Bacteria 1022
181 Ga0099795_10277063 3300007788 Bacteria 731
182 Ga0105245_10134667 3300009098 Bacteria 2321
183 Ga0105245_10216986 3300009098 Bacteria 1844
184 Ga0114129_10004541 3300009147 Bacteria 19592
185 Ga0114129_10014190 3300009147 Bacteria 11352
186 Ga0114129_10043463 3300009147 Bacteria 6321
187 Ga0114129_10125672 3300009147 Bacteria 3526
188 Ga0114129_10169170 3300009147 Bacteria 2981
189 Ga0114129_10349763 3300009147 Bacteria 1958
190 Ga0114129_11479981 3300009147 Bacteria 835
191 Ga0105243_10025283 3300009148 Bacteria 4535
192 Ga0105243_10162738 3300009148 Bacteria 1925
193 Ga0105243_10436877 3300009148 Bacteria 1225
194 Ga0105241_10002642 3300009174 Bacteria 13423
195 Ga0105241_10780781 3300009174 Bacteria 878
196 Ga0105242_10035280 3300009176 Bacteria 4011
197 Ga0105242_10324341 3300009176 Bacteria 1413
198 Ga0105242_10510090 3300009176 Bacteria 1145
199 Ga0105248_10244989 3300009177 Bacteria 2018
200 Ga0105237_10761955 3300009545 Bacteria 974
201 Ga0105237_11083508 3300009545 Bacteria 808
202 Ga0105249_10051030 3300009553 Bacteria 3772
203 Ga0105249_10644916 3300009553 Bacteria 1116
204 Ga0105249_12747594 3300009553 Bacteria 564
205 Ga0105239_10203855 3300010375 Bacteria 2216
206 Ga0105246_10443660 3300011119 Bacteria 1089
207 Ga0105246_10722678 3300011119 Bacteria 875
208 Ga0157373_10000727 3300013100 Bacteria 25722
209 Ga0157369_10007825 3300013105 Bacteria 12301
210 Ga0157378_10316852 3300013297 Bacteria 1514
211 Ga0157372_10009278 3300013307 Bacteria 10464
212 Ga0157372_10531290 3300013307 Bacteria 1371
213 Ga0157375_10182483 3300013308 Bacteria 2251
214 Ga0157375_11546596 3300013308 Bacteria 783
215 Ga0163163_10357266 3300014325 Bacteria 1517
216 Ga0163163_11339994 3300014325 Bacteria 778
217 Ga0157380_10063627 3300014326 Bacteria 2959
218 Ga0157380_10728842 3300014326 Bacteria 1000
219 Ga0157377_10694372 3300014745 Bacteria 738
220 Ga0207653_10009510 3300025885 Bacteria 3030
221 Ga0207653_10113617 3300025885 Bacteria 969
222 Ga0207642_10139083 3300025899 Bacteria 1278
223 Ga0207688_10085278 3300025901 Bacteria 1809
224 Ga0207647_10031474 3300025904 Bacteria 3414
225 Ga0207685_10141601 3300025905 Bacteria 1079
226 Ga0207645_10000170 3300025907 Bacteria 51882
227 Ga0207645_10043249 3300025907 Bacteria 2883
228 Ga0207643_10000051 3300025908 Bacteria 77737
229 Ga0207684_10003991 3300025910 Bacteria 14116
230 Ga0207684_10026668 3300025910 Bacteria 4925
231 Ga0207684_10057050 3300025910 Bacteria 3313
232 Ga0207684_10066495 3300025910 Bacteria 3061
233 Ga0207684_10111519 3300025910 Bacteria 2341
234 Ga0207684_10253494 3300025910 Bacteria 1518
235 Ga0207684_10522024 3300025910 Bacteria 1017
236 Ga0207684_10522523 3300025910 Bacteria 1017
237 Ga0207654_10001033 3300025911 Bacteria 15228
238 Ga0207707_10000453 3300025912 Bacteria 42710
239 Ga0207707_10097202 3300025912 Bacteria 2573
240 Ga0207707_10225065 3300025912 Bacteria 1633
241 Ga0207707_10971359 3300025912 Bacteria 698
242 Ga0207671_10167952 3300025914 Bacteria 1702
243 Ga0207663_10138435 3300025916 Bacteria 1692
244 Ga0207660_10000203 3300025917 Bacteria 38120
245 Ga0207660_10081436 3300025917 Bacteria 2379
246 Ga0207662_10066768 3300025918 Bacteria 2168
247 Ga0207657_10000357 3300025919 Bacteria 48334
248 Ga0207649_10010062 3300025920 Bacteria 5189
249 Ga0207652_10032750 3300025921 Bacteria 4372
250 Ga0207646_10001207 3300025922 Bacteria 32503
251 Ga0207646_10020502 3300025922 Bacteria 6124
252 Ga0207646_10269445 3300025922 Bacteria 1539
253 Ga0207646_10578114 3300025922 Bacteria 1009
254 Ga0207646_10878232 3300025922 Bacteria 796
255 Ga0207646_11026536 3300025922 Bacteria 728
256 Ga0207681_10033960 3300025923 Bacteria 3350
257 Ga0207650_10016809 3300025925 Bacteria 5117
258 Ga0207687_10215023 3300025927 Bacteria 1510
259 Ga0207700_10626193 3300025928 Bacteria 958
260 Ga0207644_10491855 3300025931 Bacteria 1011
261 Ga0207690_10000611 3300025932 Bacteria 23074
262 Ga0207706_10035870 3300025933 Bacteria 4406
263 Ga0207706_10259629 3300025933 Bacteria 1517
264 Ga0207706_10767628 3300025933 Bacteria 821
265 Ga0207706_10824759 3300025933 Bacteria 787
266 Ga0207686_10327696 3300025934 Bacteria 1146
267 Ga0207709_10020463 3300025935 Bacteria 3733
268 Ga0207709_10105720 3300025935 Bacteria 1871
269 Ga0207670_10392326 3300025936 Bacteria 1108
270 Ga0207670_10673712 3300025936 Bacteria 854
271 Ga0207665_10005953 3300025939 Bacteria 8114
272 Ga0207665_10344901 3300025939 Bacteria 1123
273 Ga0207711_10362074 3300025941 Bacteria 1344
274 Ga0207689_10000296 3300025942 Bacteria 45380
275 Ga0207689_10008186 3300025942 Bacteria 9109
276 Ga0207689_10261093 3300025942 Bacteria 1433
277 Ga0207679_10000233 3300025945 Bacteria 42806
278 Ga0207667_10001733 3300025949 Bacteria 27447
279 Ga0207651_10272224 3300025960 Bacteria 1395
280 Ga0207712_10419101 3300025961 Bacteria 1129
281 Ga0207712_10632541 3300025961 Bacteria 928
282 Ga0207640_10002914 3300025981 Bacteria 9190
283 Ga0207640_10232213 3300025981 Bacteria 1420
284 Ga0207677_10013536 3300026023 Bacteria 4732
285 Ga0207639_10000673 3300026041 Bacteria 23595
286 Ga0207678_10003802 3300026067 Bacteria 13577
287 Ga0207678_10428988 3300026067 Bacteria 1147
288 Ga0207708_10034237 3300026075 Bacteria 3863
289 Ga0207708_10333409 3300026075 Bacteria 1241
290 Ga0207702_10001254 3300026078 Bacteria 25608
291 Ga0207648_10003252 3300026089 Bacteria 17090
292 Ga0207648_10336460 3300026089 Bacteria 1359
293 Ga0207676_10042550 3300026095 Bacteria 3494
294 Ga0207674_10000836 3300026116 Bacteria 40167
295 Ga0207674_10009144 3300026116 Bacteria 11363
296 Ga0207675_100007334 3300026118 Bacteria 10417
297 Ga0207675_100399613 3300026118 Bacteria 1354
298 Ga0207698_10044174 3300026142 Bacteria 3346
299 Ga0209969_1006370 3300027360 Bacteria 1662
300 Ga0209967_1015516 3300027364 Bacteria 1090
301 Ga0209996_1005890 3300027395 Bacteria 1574
302 Ga0209984_1060819 3300027424 Bacteria 559
303 Ga0209995_1001622 3300027471 Bacteria 3495
304 Ga0209999_1047109 3300027543 Bacteria 812
305 Ga0209982_1005033 3300027552 Bacteria 1906
306 Ga0210002_1011346 3300027617 Bacteria 1376
307 Ga0209983_1005137 3300027665 Bacteria 2722
308 Ga0209588_1008161 3300027671 Bacteria 3100
309 Ga0209971_1000060 3300027682 Bacteria 34835
310 Ga0209966_1000312 3300027695 Bacteria 15867
311 Ga0209998_10000006 3300027717 Bacteria 101038
312 Ga0209974_10006984 3300027876 Bacteria 3908
313 Ga0209974_10094618 3300027876 Bacteria 1039
314 Ga0207428_10003162 3300027907 Bacteria 16133
315 Ga0268265_10002892 3300028380 Bacteria 12614
316 Ga0268265_10014365 3300028380 Bacteria 5394
317 Ga0268265_10032541 3300028380 Bacteria 3781
318 Ga0268265_10230034 3300028380 Bacteria 1629
319 Ga0268264_10091495 3300028381 Bacteria 2624
320 Ga0268264_10125040 3300028381 Bacteria 2272
321 Ga0307408_100126830 3300031548 Bacteria 1986
322 Ga0307408_100368521 3300031548 Bacteria 1224
323 Ga0307408_101677178 3300031548 Bacteria 605
324 Ga0307405_10294654 3300031731 Bacteria 1228
325 Ga0307405_10704157 3300031731 Bacteria 837
326 Ga0307405_11084089 3300031731 Bacteria 687
327 Ga0307410_10192193 3300031852 Bacteria 1553
328 Ga0307407_10440465 3300031903 Bacteria 943
329 Ga0307409_100208349 3300031995 Bacteria 1755
330 Ga0307409_100263467 3300031995 Bacteria 1583
331 Ga0307416_100488701 3300032002 Bacteria 1293
332 Ga0307414_11031382 3300032004 Bacteria 758
333 Ga0307414_11086952 3300032004 Bacteria 738
334 Ga0307411_10403184 3300032005 Bacteria 1131
335 Ga0373958_0063145 3300034819 Bacteria 807
336 Ga0373926_0029359 3300035083 Bacteria 1933
337 Ga0373928_0263328 3300035084 Bacteria 517
338 Ga0373940_0001445 3300035088 Bacteria 4300
339 Ga0373949_0137207 3300035090 Bacteria 698
340 Ga0373951_0026697 3300035091 Bacteria 1346
341 Ga0373952_0169007 3300035092 Bacteria 624
342 Ga0373923_0026197 3300035111 Bacteria 2318
343 Ga0373932_0043535 3300035112 Bacteria 1306
344 Ga0373932_0418697 3300035112 Bacteria 521
345 Ga0373936_0431355 3300035113 Unclassified 608
346 Ga0373941_0138085 3300035115 Bacteria 884
347 Ga0373953_0178699 3300035117 Bacteria 915
348 Ga0373954_0036560 3300035118 Unclassified 2280
349 Ga0373956_0371313 3300035119 Unclassified 682
350 Ga0373960_0385094 3300035121 Bacteria 538
351 Ga0373961_0092475 3300035241 Bacteria 968
352 Ga0373962_0017064 3300035242 Bacteria 1879
353 Ga0373931_0009986 3300035691 Bacteria 4552
354 Ga0373931_0338479 3300035691 Bacteria 939
355 Ga0373931_0649534 3300035691 Bacteria 693
356 Ga0373927_0002662 3300035695 Bacteria 13015
357 Ga0373947_0094567 3300035725 Bacteria 1869
358 Ga0373937_0107616 3300036401 Bacteria 2592
359 Ga0316582_1170762 3300036647 Bacteria 523
360 Ga0373925_0335570 3300037068 Bacteria 1225
361 Ga0242420_016627 3300038996 Bacteria 1283
362 Ga0242420_049629 3300038996 Bacteria 818
363 Ga0242420_080854 3300038996 Bacteria 671
364 Ga0439441_067715 3300042001 Bacteria 761
365 Ga0439448_0003529 3300042005 Bacteria 4339
366 Ga0450919_014539 3300042121 Bacteria 889
367 Ga0450902_018119 3300042137 Bacteria 1153
368 Ga0439458_0155110 3300042157 Bacteria 615
369 Ga0439459_0001209 3300042438 Bacteria 3772
370 Ga0439464_0006796 3300042439 Bacteria 2983
371 Ga0439460_0011704 3300042461 Bacteria 2266
372 Ga0450893_0069739 3300042532 Bacteria 682
373 Ga0451577_0001849 3300042876 Bacteria 26989
374 Ga0451577_0006203 3300042876 Bacteria 11993
375 Ga0451577_0045895 3300042876 Bacteria 3910
376 Ga0451577_0284671 3300042876 Bacteria 1498
377 Ga0451577_1208841 3300042876 Bacteria 674
378 Ga0451577_1344837 3300042876 Bacteria 634
379 Ga0453683_0016419 3300044673 Bacteria 4777
380 Ga0453683_0045587 3300044673 Bacteria 2749
381 Ga0453683_0056973 3300044673 Bacteria 2445
382 Ga0453683_0355306 3300044673 Bacteria 942
383 Ga0453684_0023282 3300044712 Bacteria 9134
384 Ga0453684_0054480 3300044712 Bacteria 5209
385 Ga0453684_0554652 3300044712 Bacteria 1265
386 Ga0466960_0003069 3300044901 Bacteria 6383
387 Ga0451576_0024592 3300045051 Bacteria 6504
388 Ga0451576_0028962 3300045051 Bacteria 5930
389 Ga0451576_0048881 3300045051 Bacteria 4440
390 Ga0451576_0113182 3300045051 Bacteria 2824
391 Ga0451576_0224813 3300045051 Bacteria 1960
392 Ga0451576_1437401 3300045051 Bacteria 717
393 Ga0495580_0014168 3300046472 Bacteria 6055
394 Ga0495580_0111626 3300046472 Bacteria 1899
395 Ga0495580_0362882 3300046472 Bacteria 980
396 Ga0495580_0748528 3300046472 Bacteria 637
397 Ga0495639_0142212 3300046475 Bacteria 1154
398 Ga0495664_0422638 3300046477 Unclassified 799
399 Ga0495584_0288423 3300046491 Bacteria 834
400 Ga0495665_0024426 3300046531 Bacteria 3247
401 Ga0495645_0467641 3300046543 Unclassified 793
402 Ga0495667_0639261 3300046559 Unclassified 661
403 Ga0495634_0617555 3300046642 Unclassified 628
404 Ga0495635_0245388 3300046663 Bacteria 1208
405 Ga0495659_0191122 3300046664 Bacteria 837
406 Ga0495674_0197269 3300047319 Bacteria 1671
407 Ga0495675_0300134 3300047444 Unclassified 954
408 Ga0495684_0141424 3300047471 Bacteria 1804
409 Ga0496102_0010781 3300048905 Bacteria 7871
410 Ga0496107_0670324 3300048910 Bacteria 764
411 Ga0496108_1234191 3300048911 Bacteria 631
412 Ga0496110_1542235 3300048913 Bacteria 574
413 Ga0496112_0170862 3300048915 Bacteria 2139
414 Ga0501292_103270 3300049515 Bacteria 567
415 Ga0501299_159711 3300049522 Bacteria 575
416 Ga0501031_0005375 3300049568 Bacteria 8342
417 Ga0501031_0101748 3300049568 Bacteria 1875
418 Ga0501031_0146869 3300049568 Bacteria 1541
419 Ga0501031_0341284 3300049568 Bacteria 970
420 Ga0501032_0850245 3300049569 Bacteria 575
421 Ga0501033_0005375 3300049570 Bacteria 10150
422 Ga0501033_0031121 3300049570 Bacteria 4012
423 Ga0501033_0149654 3300049570 Bacteria 1685
424 Ga0501033_1014260 3300049570 Bacteria 554
425 Ga0501034_0234985 3300049571 Unclassified 1781
426 Ga0501036_0000146 3300049572 Bacteria 46028
427 Ga0501036_0101892 3300049572 Bacteria 2429
428 Ga0501036_0189248 3300049572 Bacteria 1732
429 Ga0501036_0422683 3300049572 Bacteria 1111
430 Ga0501036_0464140 3300049572 Bacteria 1054
431 Ga0501036_0498789 3300049572 Bacteria 1013
432 Ga0501037_0010082 3300049573 Bacteria 6932
433 Ga0501037_0038927 3300049573 Bacteria 3502
434 Ga0501038_0000983 3300049574 Bacteria 25585
435 Ga0501038_0118241 3300049574 Bacteria 2189
436 Ga0501039_0000223 3300049575 Bacteria 41655
437 Ga0501039_0025015 3300049575 Bacteria 4585
438 Ga0501039_0251693 3300049575 Bacteria 1389
439 Ga0501039_0266358 3300049575 Bacteria 1347
440 Ga0501040_0000373 3300049576 Bacteria 26428
441 Ga0501040_0001289 3300049576 Bacteria 15954
442 Ga0501040_0150913 3300049576 Bacteria 1639
443 Ga0501040_0173671 3300049576 Bacteria 1526
444 Ga0501040_0219686 3300049576 Bacteria 1352
445 Ga0501040_0490831 3300049576 Bacteria 885
446 Ga0501040_0674163 3300049576 Bacteria 747
447 Ga0501041_0000014 3300049577 Bacteria 57214
448 Ga0501041_0002902 3300049577 Bacteria 9823
449 Ga0501041_0006533 3300049577 Bacteria 6829
450 Ga0501041_0063689 3300049577 Bacteria 2258
451 Ga0501041_0163382 3300049577 Bacteria 1392
452 Ga0501042_0000029 3300049578 Bacteria 46395
453 Ga0501042_0003204 3300049578 Bacteria 10226
454 Ga0501042_0022065 3300049578 Bacteria 4444
455 Ga0501042_0198126 3300049578 Bacteria 1448
456 Ga0501042_0201451 3300049578 Bacteria 1435
457 Ga0501042_0648134 3300049578 Bacteria 768
458 Ga0501042_0722615 3300049578 Bacteria 724
459 Ga0501043_0009232 3300049579 Bacteria 7750
460 Ga0501043_0046014 3300049579 Bacteria 3431
461 Ga0501043_0814201 3300049579 Bacteria 675
462 Ga0501043_0844840 3300049579 Bacteria 660
463 Ga0501046_0000544 3300049580 Bacteria 37450
464 Ga0501046_0001711 3300049580 Bacteria 20954
465 Ga0501046_0086321 3300049580 Bacteria 2419
466 Ga0501047_0063964 3300049581 Bacteria 3549
467 Ga0501048_0000167 3300049582 Bacteria 41216
468 Ga0501048_0004989 3300049582 Bacteria 10122
469 Ga0501048_1125911 3300049582 Bacteria 565
470 Ga0501048_1143711 3300049582 Bacteria 560
471 Ga0501068_0011732 3300049584 Bacteria 4955
472 Ga0501068_0229756 3300049584 Bacteria 1180
473 Ga0501068_0408836 3300049584 Bacteria 875
474 Ga0501069_0012731 3300049585 Bacteria 4478
475 Ga0501069_0206461 3300049585 Bacteria 1139
476 Ga0501069_0951347 3300049585 Bacteria 524
477 Ga0501070_0013294 3300049586 Bacteria 6942
478 Ga0501070_0205809 3300049586 Bacteria 1616
479 Ga0501071_0000123 3300049587 Bacteria 31110
480 Ga0501071_0053860 3300049587 Bacteria 2902
481 Ga0501071_0082326 3300049587 Bacteria 2357
482 Ga0501071_0109461 3300049587 Bacteria 2041
483 Ga0501071_0189175 3300049587 Bacteria 1543
484 Ga0501071_0199218 3300049587 Bacteria 1504
485 Ga0501071_0223076 3300049587 Bacteria 1419
486 Ga0501071_0394029 3300049587 Bacteria 1057
487 Ga0501071_0870074 3300049587 Bacteria 695
488 Ga0501072_0000091 3300049588 Bacteria 65812
489 Ga0501072_0035233 3300049588 Bacteria 3923
490 Ga0501072_0074417 3300049588 Bacteria 2686
491 Ga0501072_0093129 3300049588 Bacteria 2393
492 Ga0501072_0129735 3300049588 Bacteria 2009
493 Ga0501072_0288655 3300049588 Bacteria 1304
494 Ga0501072_0624117 3300049588 Bacteria 849
495 Ga0501073_0006844 3300049589 Bacteria 8477
496 Ga0501074_0005032 3300049590 Bacteria 9485
497 Ga0501074_0006054 3300049590 Bacteria 8730
498 Ga0501074_0358818 3300049590 Bacteria 1034
499 Ga0501074_0466311 3300049590 Bacteria 895
500 Ga0501075_0000005 3300049591 Bacteria 112003
501 Ga0501075_0006543 3300049591 Bacteria 8025
502 Ga0501075_0021176 3300049591 Bacteria 4738
503 Ga0501075_0066538 3300049591 Bacteria 2719
504 Ga0501075_0206365 3300049591 Bacteria 1499
505 Ga0501075_0374383 3300049591 Bacteria 1085
506 Ga0501076_0000024 3300049592 Bacteria 78719
507 Ga0501076_0027512 3300049592 Bacteria 4409
508 Ga0501076_0049743 3300049592 Bacteria 3316
509 Ga0501076_0060399 3300049592 Bacteria 3016
510 Ga0501076_0063233 3300049592 Bacteria 2949
511 Ga0501076_0231554 3300049592 Bacteria 1510
512 Ga0501076_0340278 3300049592 Bacteria 1231
513 Ga0501077_0000025 3300049593 Bacteria 76265
514 Ga0501077_0061153 3300049593 Bacteria 2390
515 Ga0501077_0104695 3300049593 Bacteria 1793
516 Ga0501077_0282172 3300049593 Bacteria 1057
517 Ga0501077_0331787 3300049593 Bacteria 970
518 Ga0501225_0336962 3300049705 Bacteria 519
519 Ga0501079_0000025 3300049741 Bacteria 62163
520 Ga0501079_0000760 3300049741 Bacteria 21994
521 Ga0501079_0008890 3300049741 Bacteria 7605
522 Ga0501079_0105145 3300049741 Bacteria 2190
523 Ga0501079_0141205 3300049741 Bacteria 1876
524 Ga0501079_0273270 3300049741 Bacteria 1321
525 Ga0501079_0367151 3300049741 Bacteria 1128
526 Ga0501079_0645702 3300049741 Bacteria 833
527 Ga0501079_0702303 3300049741 Bacteria 796
528 Ga0501079_0981790 3300049741 Bacteria 665
529 Ga0501080_0001141 3300049742 Bacteria 21887
530 Ga0501080_0633180 3300049742 Bacteria 947
531 Ga0501080_1223150 3300049742 Bacteria 645
532 Ga0501081_0000007 3300049743 Bacteria 73600
533 Ga0501081_0019125 3300049743 Bacteria 4556
534 Ga0501081_0020663 3300049743 Bacteria 4390
535 Ga0501081_0057687 3300049743 Bacteria 2685
536 Ga0501081_0087750 3300049743 Bacteria 2185
537 Ga0501081_0248486 3300049743 Bacteria 1298
538 Ga0501081_0297579 3300049743 Bacteria 1183
539 Ga0501081_0310626 3300049743 Bacteria 1157
540 Ga0501081_0352133 3300049743 Bacteria 1085
541 Ga0501081_0889834 3300049743 Bacteria 671
542 Ga0501083_0011123 3300049744 Bacteria 6318
543 Ga0501083_0198248 3300049744 Bacteria 1310
544 Ga0501083_0723727 3300049744 Bacteria 647
545 Ga0501035_0002582 3300049822 Bacteria 17689
546 Ga0501044_0892185 3300049823 Archaea 764
547 Ga0501044_1263924 3300049823 Bacteria 605
548 Ga0501045_0000003 3300049824 Bacteria 88725
549 Ga0501045_0000717 3300049824 Bacteria 21085
550 Ga0501045_0032051 3300049824 Bacteria 3807
551 Ga0501045_0151748 3300049824 Bacteria 1724
552 Ga0501045_0298344 3300049824 Bacteria 1199
553 nmdc:mga05p37_213226_c1 3300050507 Bacteria 2333
554 nmdc:mga05p37_219186_c1 3300050507 Bacteria 2297
555 nmdc:mga05p37_30934_c1 3300050507 Bacteria 6535
556 nmdc:mga05p37_372580_c1 3300050507 Bacteria 1675
557 nmdc:mga05p37_37320_c1 3300050507 Bacteria 5957
558 nmdc:mga05p37_506035_c1 3300050507 Bacteria 1385
559 nmdc:mga05p37_6819_c1 3300050507 Bacteria 13458
560 nmdc:mga05p37_7414_c1 3300050507 Bacteria 12942
561 nmdc:mga09592_10601_c1 3300050508 Bacteria 7504
562 nmdc:mga09592_163585_c1 3300050508 Bacteria 1923
563 nmdc:mga09592_648166_c1 3300050508 Bacteria 902
564 nmdc:mga0qj67_180393_c1 3300050509 Bacteria 1715
565 nmdc:mga0qj67_478812_c1 3300050509 Bacteria 1002
566 nmdc:mga06r32_194954_c1 3300050510 Bacteria 2013
567 nmdc:mga06r32_381000_c1 3300050510 Bacteria 1393
568 nmdc:mga06r32_44114_c1 3300050510 Bacteria 4245
569 nmdc:mga06r32_44537_c1 3300050510 Bacteria 4226
570 nmdc:mga06r32_543614_c1 3300050510 Bacteria 1136
571 nmdc:mga08y16_2190_c1 3300050511 Bacteria 20049
572 nmdc:mga0n895_1127572_c1 3300050512 Bacteria 761
573 nmdc:mga0n895_17203_c1 3300050512 Bacteria 6662
574 nmdc:mga0n895_2180639_c1 3300050512 Bacteria 510
575 nmdc:mga0n895_232505_c1 3300050512 Bacteria 1871
576 nmdc:mga0n895_295787_c1 3300050512 Bacteria 1641
577 nmdc:mga0n895_39410_c1 3300050512 Bacteria 4584
578 nmdc:mga0n895_628725_c1 3300050512 Bacteria 1074
579 nmdc:mga0n895_678508_c1 3300050512 Bacteria 1027
580 nmdc:mga0n895_855732_c1 3300050512 Bacteria 897
581 nmdc:mga0rr50_10901_c1 3300050513 Bacteria 5796
582 nmdc:mga0rr50_15502_c1 3300050513 Bacteria 5033
583 nmdc:mga0rr50_471419_c1 3300050513 Unclassified 1066
584 nmdc:mga0rr50_58883_c1 3300050513 Bacteria 2881
585 nmdc:mga08x19_1162248_c1 3300050514 Bacteria 547
586 nmdc:mga08x19_677641_c1 3300050514 Bacteria 732
587 nmdc:mga08x19_78596_c1 3300050514 Bacteria 2163
588 nmdc:mga0a205_1779_c1 3300050515 Bacteria 18627
589 nmdc:mga0a205_182435_c2 3300050515 Bacteria 1357
590 nmdc:mga0a205_262615_c1 3300050515 Bacteria 1604
591 nmdc:mga0a205_5773_c1 3300050515 Bacteria 11158
592 nmdc:mga0a205_653556_c1 3300050515 Bacteria 903
593 nmdc:mga0a205_740416_c1 3300050515 Bacteria 832
594 nmdc:mga0a205_8715_c1 3300050515 Bacteria 9238
595 Ga0501084_0000398 3300054114 Bacteria 33453
596 Ga0501084_0002865 3300054114 Bacteria 13943
597 Ga0501084_0030896 3300054114 Bacteria 4478
598 Ga0501084_0663789 3300054114 Bacteria 880
599 Ga0590071_027846 3300059421 Bacteria 1342
600 Ga0590077_068774 3300059426 Bacteria 807
601 Ga0501082_0000062 3300060353 Bacteria 77313
602 Ga0501082_0015483 3300060353 Bacteria 6564
603 Ga0501082_0024763 3300060353 Bacteria 5174
604 Ga0501082_0046990 3300060353 Bacteria 3720
605 Ga0501082_0056125 3300060353 Bacteria 3392
606 Ga0501082_0129223 3300060353 Bacteria 2192
607 Ga0501082_0246933 3300060353 Bacteria 1553
608 Ga0501082_1135048 3300060353 Bacteria 683
609 Ga0501082_1441947 3300060353 Bacteria 601
610 Ga0530510_0000062 3300061734 Bacteria 52768
611 Ga0530510_0004377 3300061734 Bacteria 9774
612 Ga0530510_0009989 3300061734 Bacteria 6659
613 Ga0530510_0014717 3300061734 Bacteria 5523
614 Ga0530510_0026226 3300061734 Bacteria 4169
615 Ga0530510_0188734 3300061734 Bacteria 1530
616 Ga0530510_0209667 3300061734 Bacteria 1448
617 Ga0530510_0457301 3300061734 Bacteria 965
618 Ga0530510_0579831 3300061734 Bacteria 853
619 Ga0530510_1004391 3300061734 Bacteria 638

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10005953 Ga0207665_100059532 123
2 3300006871 Ga0075434_100029618 Ga0075434_1000296183 132
3 3300007076 Ga0075435_100071470 Ga0075435_1000714702 132
4 3300009147 Ga0114129_10125672 Ga0114129_101256725 132
5 3300049576 Ga0501040_0150913 Ga0501040_0150913_953_1360 132
6 3300005518 Ga0070699_100160585 Ga0070699_1001605851 133
7 3300005546 Ga0070696_100200714 Ga0070696_1002007142 133
8 3300025927 Ga0207687_10215023 Ga0207687_102150232 133
9 3300046664 Ga0495659_0191122 Ga0495659_0191122_154_561 133
10 3300049587 Ga0501071_0223076 Ga0501071_0223076_106_510 133
11 3300005336 Ga0070680_100133404 Ga0070680_1001334042 134
12 3300005341 Ga0070691_10004798 Ga0070691_100047982 134
13 3300005438 Ga0070701_10061719 Ga0070701_100617192 134
14 3300005438 Ga0070701_10279822 Ga0070701_102798221 134
15 3300005441 Ga0070700_100020317 Ga0070700_1000203173 134
16 3300005444 Ga0070694_100092985 Ga0070694_1000929852 134
17 3300005445 Ga0070708_100056325 Ga0070708_1000563253 134
18 3300005445 Ga0070708_100235322 Ga0070708_1002353222 134
19 3300005459 Ga0068867_100010785 Ga0068867_1000107852 134
20 3300005467 Ga0070706_100427321 Ga0070706_1004273211 134
21 3300005468 Ga0070707_101406691 Ga0070707_1014066912 134
22 3300005471 Ga0070698_100651291 Ga0070698_1006512912 134
23 3300005518 Ga0070699_100115835 Ga0070699_1001158352 134
24 3300005518 Ga0070699_100702458 Ga0070699_1007024581 134
25 3300005536 Ga0070697_100119316 Ga0070697_1001193161 134
26 3300005536 Ga0070697_100435331 Ga0070697_1004353312 134
27 3300005546 Ga0070696_100482067 Ga0070696_1004820672 134
28 3300005577 Ga0068857_100001797 Ga0068857_1000017978 134
29 3300005578 Ga0068854_100859549 Ga0068854_1008595492 134
30 3300005615 Ga0070702_100194263 Ga0070702_1001942632 134
31 3300005617 Ga0068859_100565819 Ga0068859_1005658192 134
32 3300005718 Ga0068866_10099127 Ga0068866_100991272 134
33 3300005840 Ga0068870_10026265 Ga0068870_100262652 134
34 3300005844 Ga0068862_100186520 Ga0068862_1001865202 134
35 3300006847 Ga0075431_100605948 Ga0075431_1006059482 134
36 3300006931 Ga0097620_100565730 Ga0097620_1005657302 134
37 3300007265 Ga0099794_10012752 Ga0099794_100127522 134
38 3300009098 Ga0105245_10134667 Ga0105245_101346672 134
39 3300009148 Ga0105243_10162738 Ga0105243_101627381 134
40 3300009176 Ga0105242_10035280 Ga0105242_100352802 134
41 3300009553 Ga0105249_10051030 Ga0105249_100510302 134
42 3300011119 Ga0105246_10443660 Ga0105246_104436602 134
43 3300025899 Ga0207642_10139083 Ga0207642_101390832 134
44 3300025917 Ga0207660_10081436 Ga0207660_100814362 134
45 3300025933 Ga0207706_10259629 Ga0207706_102596291 134
46 3300025934 Ga0207686_10327696 Ga0207686_103276962 134
47 3300025942 Ga0207689_10261093 Ga0207689_102610932 134
48 3300026075 Ga0207708_10034237 Ga0207708_100342371 134
49 3300026116 Ga0207674_10009144 Ga0207674_100091442 134
50 3300026118 Ga0207675_100399613 Ga0207675_1003996132 134
51 3300027907 Ga0207428_10003162 Ga0207428_100031627 134
52 3300028380 Ga0268265_10032541 Ga0268265_100325412 134
53 3300028380 Ga0268265_10230034 Ga0268265_102300342 134
54 3300028381 Ga0268264_10125040 Ga0268264_101250402 134
55 3300031548 Ga0307408_100126830 Ga0307408_1001268302 134
56 3300031548 Ga0307408_100368521 Ga0307408_1003685213 134
57 3300031548 Ga0307408_101677178 Ga0307408_1016771782 134
58 3300031731 Ga0307405_10294654 Ga0307405_102946542 134
59 3300031731 Ga0307405_11084089 Ga0307405_110840891 134
60 3300031852 Ga0307410_10192193 Ga0307410_101921932 134
61 3300031903 Ga0307407_10440465 Ga0307407_104404652 134
62 3300031995 Ga0307409_100263467 Ga0307409_1002634672 134
63 3300032002 Ga0307416_100488701 Ga0307416_1004887012 134
64 3300032004 Ga0307414_11086952 Ga0307414_110869522 134
65 3300032005 Ga0307411_10403184 Ga0307411_104031842 134
66 3300035691 Ga0373931_0649534 Ga0373931_0649534_162_566 134
67 3300038996 Ga0242420_016627 Ga0242420_016627_735_1139 134
68 3300042001 Ga0439441_067715 Ga0439441_067715_266_670 134
69 3300042121 Ga0450919_014539 Ga0450919_014539_290_694 134
70 3300042876 Ga0451577_0001849 Ga0451577_0001849_8911_9315 134
71 3300042876 Ga0451577_0284671 Ga0451577_0284671_390_794 134
72 3300044673 Ga0453683_0016419 Ga0453683_0016419_2943_3347 134
73 3300044712 Ga0453684_0023282 Ga0453684_0023282_8271_8675 134
74 3300045051 Ga0451576_0024592 Ga0451576_0024592_5526_5930 134
75 3300049522 Ga0501299_159711 Ga0501299_159711_29_433 134
76 3300049578 Ga0501042_0201451 Ga0501042_0201451_755_1159 134
77 3300049579 Ga0501043_0814201 Ga0501043_0814201_77_484 134
78 3300049587 Ga0501071_0870074 Ga0501071_0870074_272_676 134
79 3300049588 Ga0501072_0624117 Ga0501072_0624117_166_573 134
80 3300049591 Ga0501075_0206365 Ga0501075_0206365_355_762 134
81 3300049705 Ga0501225_0336962 Ga0501225_0336962_78_482 134
82 3300049741 Ga0501079_0141205 Ga0501079_0141205_318_725 134
83 3300049742 Ga0501080_1223150 Ga0501080_1223150_198_605 134
84 3300050508 nmdc:mga09592_163585_c1 nmdc:mga09592_163585_c1_402_821 134
85 3300050510 nmdc:mga06r32_543614_c1 nmdc:mga06r32_543614_c1_317_721 134
86 3300050511 nmdc:mga08y16_2190_c1 nmdc:mga08y16_2190_c1_8452_8856 134
87 3300050512 nmdc:mga0n895_17203_c1 nmdc:mga0n895_17203_c1_2105_2509 134
88 3300050512 nmdc:mga0n895_232505_c1 nmdc:mga0n895_232505_c1_116_520 134
89 3300050513 nmdc:mga0rr50_58883_c1 nmdc:mga0rr50_58883_c1_592_996 134
90 3300050515 nmdc:mga0a205_1779_c1 nmdc:mga0a205_1779_c1_6605_7009 134
91 3300050515 nmdc:mga0a205_5773_c1 nmdc:mga0a205_5773_c1_7993_8397 134
92 3300005340 Ga0070689_100434135 Ga0070689_1004341352 135
93 3300005341 Ga0070691_10709308 Ga0070691_107093081 135
94 3300005444 Ga0070694_100514161 Ga0070694_1005141612 135
95 3300005445 Ga0070708_100011090 Ga0070708_1000110907 135
96 3300005455 Ga0070663_100990800 Ga0070663_1009908001 135
97 3300005458 Ga0070681_10504015 Ga0070681_105040152 135
98 3300005518 Ga0070699_100039547 Ga0070699_1000395473 135
99 3300005536 Ga0070697_100226327 Ga0070697_1002263272 135
100 3300005545 Ga0070695_100081344 Ga0070695_1000813442 135
101 3300005617 Ga0068859_100571901 Ga0068859_1005719012 135
102 3300006844 Ga0075428_100146981 Ga0075428_1001469811 135
103 3300006846 Ga0075430_100006024 Ga0075430_1000060244 135
104 3300006846 Ga0075430_100090703 Ga0075430_1000907032 135
105 3300006846 Ga0075430_100097971 Ga0075430_1000979711 135
106 3300006847 Ga0075431_100000545 Ga0075431_10000054525 135
107 3300006847 Ga0075431_100014658 Ga0075431_1000146583 135
108 3300006847 Ga0075431_100030037 Ga0075431_1000300372 135
109 3300006847 Ga0075431_100037960 Ga0075431_1000379603 135
110 3300006852 Ga0075433_10173881 Ga0075433_101738812 135
111 3300006852 Ga0075433_10422885 Ga0075433_104228852 135
112 3300006871 Ga0075434_100082923 Ga0075434_1000829232 135
113 3300006871 Ga0075434_100198110 Ga0075434_1001981102 135
114 3300006871 Ga0075434_100360388 Ga0075434_1003603883 135
115 3300006871 Ga0075434_100698760 Ga0075434_1006987603 135
116 3300006871 Ga0075434_100848119 Ga0075434_1008481192 135
117 3300006880 Ga0075429_100052876 Ga0075429_1000528763 135
118 3300006880 Ga0075429_100069650 Ga0075429_1000696505 135
119 3300006880 Ga0075429_100181208 Ga0075429_1001812082 135
120 3300006914 Ga0075436_100117044 Ga0075436_1001170442 135
121 3300006931 Ga0097620_100571910 Ga0097620_1005719102 135
122 3300007076 Ga0075435_100024469 Ga0075435_1000244695 135
123 3300009147 Ga0114129_10004541 Ga0114129_1000454111 135
124 3300009147 Ga0114129_10043463 Ga0114129_100434633 135
125 3300009147 Ga0114129_10169170 Ga0114129_101691702 135
126 3300009147 Ga0114129_10349763 Ga0114129_103497632 135
127 3300009174 Ga0105241_10780781 Ga0105241_107807811 135
128 3300009553 Ga0105249_12747594 Ga0105249_127475942 135
129 3300013308 Ga0157375_11546596 Ga0157375_115465961 135
130 3300014326 Ga0157380_10063627 Ga0157380_100636272 135
131 3300014745 Ga0157377_10694372 Ga0157377_106943722 135
132 3300025912 Ga0207707_10971359 Ga0207707_109713592 135
133 3300025933 Ga0207706_10035870 Ga0207706_100358705 135
134 3300025933 Ga0207706_10824759 Ga0207706_108247591 135
135 3300025936 Ga0207670_10392326 Ga0207670_103923261 135
136 3300025961 Ga0207712_10419101 Ga0207712_104191011 135
137 3300026067 Ga0207678_10428988 Ga0207678_104289882 135
138 3300026075 Ga0207708_10333409 Ga0207708_103334092 135
139 3300027876 Ga0209974_10094618 Ga0209974_100946182 135
140 3300034819 Ga0373958_0063145 Ga0373958_0063145_216_623 135
141 3300035090 Ga0373949_0137207 Ga0373949_0137207_50_457 135
142 3300038996 Ga0242420_049629 Ga0242420_049629_252_659 135
143 3300042876 Ga0451577_1208841 Ga0451577_1208841_31_438 135
144 3300044901 Ga0466960_0003069 Ga0466960_0003069_148_561 135
145 3300045051 Ga0451576_0113182 Ga0451576_0113182_397_804 135
146 3300048910 Ga0496107_0670324 Ga0496107_0670324_201_608 135
147 3300049515 Ga0501292_103270 Ga0501292_103270_82_489 135
148 3300049568 Ga0501031_0005375 Ga0501031_0005375_4618_5025 135
149 3300049568 Ga0501031_0146869 Ga0501031_0146869_727_1137 135
150 3300049570 Ga0501033_0005375 Ga0501033_0005375_3227_3634 135
151 3300049570 Ga0501033_1014260 Ga0501033_1014260_29_439 135
152 3300049571 Ga0501034_0234985 Ga0501034_0234985_644_1051 135
153 3300049572 Ga0501036_0000146 Ga0501036_0000146_3998_4405 135
154 3300049572 Ga0501036_0498789 Ga0501036_0498789_317_727 135
155 3300049573 Ga0501037_0010082 Ga0501037_0010082_857_1264 135
156 3300049574 Ga0501038_0000983 Ga0501038_0000983_1052_1459 135
157 3300049575 Ga0501039_0000223 Ga0501039_0000223_9592_9999 135
158 3300049575 Ga0501039_0251693 Ga0501039_0251693_163_570 135
159 3300049576 Ga0501040_0000373 Ga0501040_0000373_17067_17474 135
160 3300049576 Ga0501040_0490831 Ga0501040_0490831_320_727 135
161 3300049577 Ga0501041_0000014 Ga0501041_0000014_40632_41039 135
162 3300049577 Ga0501041_0006533 Ga0501041_0006533_455_862 135
163 3300049578 Ga0501042_0000029 Ga0501042_0000029_3431_3838 135
164 3300049578 Ga0501042_0198126 Ga0501042_0198126_253_663 135
165 3300049578 Ga0501042_0722615 Ga0501042_0722615_124_531 135
166 3300049579 Ga0501043_0009232 Ga0501043_0009232_3983_4390 135
167 3300049580 Ga0501046_0000544 Ga0501046_0000544_14165_14572 135
168 3300049582 Ga0501048_0000167 Ga0501048_0000167_27043_27450 135
169 3300049584 Ga0501068_0011732 Ga0501068_0011732_503_910 135
170 3300049585 Ga0501069_0012731 Ga0501069_0012731_2589_2996 135
171 3300049585 Ga0501069_0206461 Ga0501069_0206461_514_921 135
172 3300049585 Ga0501069_0951347 Ga0501069_0951347_77_484 135
173 3300049586 Ga0501070_0013294 Ga0501070_0013294_2442_2849 135
174 3300049586 Ga0501070_0205809 Ga0501070_0205809_1164_1571 135
175 3300049587 Ga0501071_0000123 Ga0501071_0000123_20258_20665 135
176 3300049587 Ga0501071_0082326 Ga0501071_0082326_1859_2266 135
177 3300049587 Ga0501071_0189175 Ga0501071_0189175_1049_1456 135
178 3300049587 Ga0501071_0199218 Ga0501071_0199218_318_728 135
179 3300049588 Ga0501072_0000091 Ga0501072_0000091_49390_49797 135
180 3300049588 Ga0501072_0035233 Ga0501072_0035233_2513_2920 135
181 3300049588 Ga0501072_0074417 Ga0501072_0074417_879_1289 135
182 3300049589 Ga0501073_0006844 Ga0501073_0006844_1717_2124 135
183 3300049590 Ga0501074_0005032 Ga0501074_0005032_6726_7133 135
184 3300049590 Ga0501074_0466311 Ga0501074_0466311_359_766 135
185 3300049591 Ga0501075_0000005 Ga0501075_0000005_41562_41969 135
186 3300049591 Ga0501075_0066538 Ga0501075_0066538_1263_1670 135
187 3300049592 Ga0501076_0000024 Ga0501076_0000024_24829_25236 135
188 3300049592 Ga0501076_0049743 Ga0501076_0049743_1027_1437 135
189 3300049592 Ga0501076_0231554 Ga0501076_0231554_406_813 135
190 3300049593 Ga0501077_0000025 Ga0501077_0000025_17141_17548 135
191 3300049593 Ga0501077_0061153 Ga0501077_0061153_1485_1892 135
192 3300049741 Ga0501079_0000025 Ga0501079_0000025_29298_29705 135
193 3300049741 Ga0501079_0645702 Ga0501079_0645702_263_670 135
194 3300049742 Ga0501080_0001141 Ga0501080_0001141_12996_13403 135
195 3300049743 Ga0501081_0000007 Ga0501081_0000007_32519_32926 135
196 3300049743 Ga0501081_0019125 Ga0501081_0019125_2636_3043 135
197 3300049743 Ga0501081_0248486 Ga0501081_0248486_213_623 135
198 3300049743 Ga0501081_0889834 Ga0501081_0889834_216_626 135
199 3300049822 Ga0501035_0002582 Ga0501035_0002582_14163_14570 135
200 3300049823 Ga0501044_0892185 Ga0501044_0892185_264_671 135
201 3300049823 Ga0501044_1263924 Ga0501044_1263924_159_566 135
202 3300049824 Ga0501045_0000003 Ga0501045_0000003_42456_42863 135
203 3300049824 Ga0501045_0032051 Ga0501045_0032051_318_725 135
204 3300049824 Ga0501045_0151748 Ga0501045_0151748_486_896 135
205 3300050507 nmdc:mga05p37_30934_c1 nmdc:mga05p37_30934_c1_5306_5713 135
206 3300050507 nmdc:mga05p37_372580_c1 nmdc:mga05p37_372580_c1_622_1029 135
207 3300050507 nmdc:mga05p37_37320_c1 nmdc:mga05p37_37320_c1_1239_1646 135
208 3300050507 nmdc:mga05p37_7414_c1 nmdc:mga05p37_7414_c1_3224_3718 135
209 3300050508 nmdc:mga09592_10601_c1 nmdc:mga09592_10601_c1_4793_5200 135
210 3300050509 nmdc:mga0qj67_180393_c1 nmdc:mga0qj67_180393_c1_641_1048 135
211 3300050509 nmdc:mga0qj67_478812_c1 nmdc:mga0qj67_478812_c1_28_435 135
212 3300050510 nmdc:mga06r32_194954_c1 nmdc:mga06r32_194954_c1_1418_1825 135
213 3300050510 nmdc:mga06r32_44114_c1 nmdc:mga06r32_44114_c1_2054_2461 135
214 3300050510 nmdc:mga06r32_44537_c1 nmdc:mga06r32_44537_c1_1901_2308 135
215 3300050512 nmdc:mga0n895_1127572_c1 nmdc:mga0n895_1127572_c1_97_504 135
216 3300050512 nmdc:mga0n895_295787_c1 nmdc:mga0n895_295787_c1_548_955 135
217 3300050512 nmdc:mga0n895_628725_c1 nmdc:mga0n895_628725_c1_168_575 135
218 3300050512 nmdc:mga0n895_855732_c1 nmdc:mga0n895_855732_c1_351_758 135
219 3300050513 nmdc:mga0rr50_15502_c1 nmdc:mga0rr50_15502_c1_25_432 135
220 3300050513 nmdc:mga0rr50_471419_c1 nmdc:mga0rr50_471419_c1_167_574 135
221 3300050514 nmdc:mga08x19_1162248_c1 nmdc:mga08x19_1162248_c1_13_420 135
222 3300050515 nmdc:mga0a205_653556_c1 nmdc:mga0a205_653556_c1_411_818 135
223 3300054114 Ga0501084_0000398 Ga0501084_0000398_19534_19941 135
224 3300060353 Ga0501082_0000062 Ga0501082_0000062_61399_61806 135
225 3300060353 Ga0501082_0056125 Ga0501082_0056125_1666_2073 135
226 3300060353 Ga0501082_1135048 Ga0501082_1135048_90_500 135
227 3300061734 Ga0530510_0000062 Ga0530510_0000062_29274_29681 135
228 3300061734 Ga0530510_0004377 Ga0530510_0004377_1935_2348 135
229 3300061734 Ga0530510_0009989 Ga0530510_0009989_2027_2437 135
230 3300061734 Ga0530510_0188734 Ga0530510_0188734_256_663 135
231 3300003503 JGI26141J51220_1001595 JGI26141J51220_10015952 136
232 3300005290 Ga0065712_10675061 Ga0065712_106750611 136
233 3300005293 Ga0065715_10234588 Ga0065715_102345882 136
234 3300005328 Ga0070676_10000025 Ga0070676_1000002530 136
235 3300005328 Ga0070676_10011704 Ga0070676_100117042 136
236 3300005330 Ga0070690_100133450 Ga0070690_1001334502 136
237 3300005331 Ga0070670_100038454 Ga0070670_1000384541 136
238 3300005334 Ga0068869_100000205 Ga0068869_10000020510 136
239 3300005334 Ga0068869_100027452 Ga0068869_1000274522 136
240 3300005336 Ga0070680_100002677 Ga0070680_10000267712 136
241 3300005337 Ga0070682_100000180 Ga0070682_10000018025 136
242 3300005338 Ga0068868_100073761 Ga0068868_1000737612 136
243 3300005339 Ga0070660_100000428 Ga0070660_1000004282 136
244 3300005340 Ga0070689_100158932 Ga0070689_1001589322 136
245 3300005341 Ga0070691_10046408 Ga0070691_100464082 136
246 3300005341 Ga0070691_10064925 Ga0070691_100649252 136
247 3300005343 Ga0070687_100068462 Ga0070687_1000684622 136
248 3300005344 Ga0070661_100000822 Ga0070661_10000082216 136
249 3300005345 Ga0070692_10000133 Ga0070692_1000013312 136
250 3300005347 Ga0070668_100852858 Ga0070668_1008528582 136
251 3300005353 Ga0070669_100649045 Ga0070669_1006490452 136
252 3300005355 Ga0070671_101016125 Ga0070671_1010161251 136
253 3300005364 Ga0070673_100014726 Ga0070673_1000147265 136
254 3300005366 Ga0070659_100003379 Ga0070659_1000033798 136
255 3300005406 Ga0070703_10123293 Ga0070703_101232931 136
256 3300005406 Ga0070703_10156042 Ga0070703_101560422 136
257 3300005436 Ga0070713_102330400 Ga0070713_1023304001 136
258 3300005438 Ga0070701_10409444 Ga0070701_104094441 136
259 3300005440 Ga0070705_100000078 Ga0070705_10000007816 136
260 3300005440 Ga0070705_100279900 Ga0070705_1002799002 136
261 3300005440 Ga0070705_100570729 Ga0070705_1005707292 136
262 3300005444 Ga0070694_100000656 Ga0070694_10000065612 136
263 3300005444 Ga0070694_100002729 Ga0070694_1000027294 136
264 3300005444 Ga0070694_100023706 Ga0070694_1000237062 136
265 3300005445 Ga0070708_100091473 Ga0070708_1000914734 136
266 3300005445 Ga0070708_100131402 Ga0070708_1001314022 136
267 3300005445 Ga0070708_100207098 Ga0070708_1002070982 136
268 3300005445 Ga0070708_100754913 Ga0070708_1007549132 136
269 3300005455 Ga0070663_100152558 Ga0070663_1001525582 136
270 3300005457 Ga0070662_100753808 Ga0070662_1007538082 136
271 3300005458 Ga0070681_10061725 Ga0070681_100617253 136
272 3300005458 Ga0070681_10192940 Ga0070681_101929402 136
273 3300005459 Ga0068867_100004170 Ga0068867_1000041708 136
274 3300005459 Ga0068867_100396359 Ga0068867_1003963592 136
275 3300005467 Ga0070706_100099348 Ga0070706_1000993482 136
276 3300005467 Ga0070706_100180428 Ga0070706_1001804282 136
277 3300005467 Ga0070706_100530460 Ga0070706_1005304602 136
278 3300005467 Ga0070706_100581227 Ga0070706_1005812272 136
279 3300005468 Ga0070707_100023174 Ga0070707_1000231742 136
280 3300005468 Ga0070707_100057153 Ga0070707_1000571532 136
281 3300005468 Ga0070707_100081846 Ga0070707_1000818463 136
282 3300005468 Ga0070707_100190765 Ga0070707_1001907652 136
283 3300005468 Ga0070707_101442829 Ga0070707_1014428291 136
284 3300005471 Ga0070698_100002570 Ga0070698_1000025706 136
285 3300005471 Ga0070698_100013281 Ga0070698_1000132812 136
286 3300005471 Ga0070698_100142353 Ga0070698_1001423532 136
287 3300005471 Ga0070698_100193600 Ga0070698_1001936002 136
288 3300005518 Ga0070699_100004138 Ga0070699_10000413810 136
289 3300005518 Ga0070699_100011799 Ga0070699_1000117993 136
290 3300005518 Ga0070699_100037436 Ga0070699_1000374362 136
291 3300005518 Ga0070699_100258733 Ga0070699_1002587332 136
292 3300005518 Ga0070699_100319318 Ga0070699_1003193182 136
293 3300005530 Ga0070679_100007425 Ga0070679_1000074253 136
294 3300005530 Ga0070679_100487631 Ga0070679_1004876312 136
295 3300005535 Ga0070684_101425606 Ga0070684_1014256061 136
296 3300005536 Ga0070697_100003917 Ga0070697_1000039172 136
297 3300005536 Ga0070697_100040307 Ga0070697_1000403072 136
298 3300005536 Ga0070697_100041574 Ga0070697_1000415743 136
299 3300005536 Ga0070697_100043676 Ga0070697_1000436762 136
300 3300005536 Ga0070697_100206470 Ga0070697_1002064702 136
301 3300005539 Ga0068853_100000255 Ga0068853_10000025524 136
302 3300005545 Ga0070695_100001694 Ga0070695_1000016944 136
303 3300005545 Ga0070695_100030093 Ga0070695_1000300932 136
304 3300005545 Ga0070695_100054243 Ga0070695_1000542431 136
305 3300005546 Ga0070696_100001230 Ga0070696_1000012302 136
306 3300005546 Ga0070696_100095963 Ga0070696_1000959632 136
307 3300005547 Ga0070693_100000163 Ga0070693_10000016330 136
308 3300005547 Ga0070693_100012218 Ga0070693_1000122182 136
309 3300005549 Ga0070704_100000731 Ga0070704_10000073111 136
310 3300005549 Ga0070704_100221928 Ga0070704_1002219282 136
311 3300005549 Ga0070704_101417181 Ga0070704_1014171811 136
312 3300005563 Ga0068855_100000612 Ga0068855_10000061232 136
313 3300005564 Ga0070664_100094385 Ga0070664_1000943852 136
314 3300005577 Ga0068857_100028151 Ga0068857_1000281512 136
315 3300005578 Ga0068854_100025201 Ga0068854_1000252012 136
316 3300005578 Ga0068854_100133054 Ga0068854_1001330542 136
317 3300005614 Ga0068856_100000630 Ga0068856_10000063031 136
318 3300005615 Ga0070702_100040801 Ga0070702_1000408012 136
319 3300005616 Ga0068852_100118419 Ga0068852_1001184192 136
320 3300005617 Ga0068859_100001373 Ga0068859_10000137314 136
321 3300005719 Ga0068861_100037179 Ga0068861_1000371792 136
322 3300005840 Ga0068870_10000221 Ga0068870_1000022115 136
323 3300005841 Ga0068863_100022279 Ga0068863_1000222797 136
324 3300005842 Ga0068858_101536322 Ga0068858_1015363221 136
325 3300005843 Ga0068860_100006069 Ga0068860_10000606911 136
326 3300005844 Ga0068862_100001036 Ga0068862_1000010364 136
327 3300005844 Ga0068862_100138891 Ga0068862_1001388912 136
328 3300005937 Ga0081455_10002783 Ga0081455_1000278317 136
329 3300005937 Ga0081455_10828678 Ga0081455_108286782 136
330 3300006163 Ga0070715_10080313 Ga0070715_100803132 136
331 3300006173 Ga0070716_100156778 Ga0070716_1001567782 136
332 3300006173 Ga0070716_100574276 Ga0070716_1005742762 136
333 3300006358 Ga0068871_100300844 Ga0068871_1003008443 136
334 3300006847 Ga0075431_100161543 Ga0075431_1001615433 136
335 3300006847 Ga0075431_101372621 Ga0075431_1013726211 136
336 3300006852 Ga0075433_10004845 Ga0075433_100048452 136
337 3300006852 Ga0075433_10100818 Ga0075433_101008182 136
338 3300006852 Ga0075433_10416632 Ga0075433_104166322 136
339 3300006871 Ga0075434_100015216 Ga0075434_1000152162 136
340 3300006871 Ga0075434_100089103 Ga0075434_1000891032 136
341 3300006880 Ga0075429_100799680 Ga0075429_1007996802 136
342 3300006914 Ga0075436_100247907 Ga0075436_1002479072 136
343 3300006931 Ga0097620_100001373 Ga0097620_10000137314 136
344 3300007076 Ga0075435_100071626 Ga0075435_1000716262 136
345 3300007076 Ga0075435_100138485 Ga0075435_1001384852 136
346 3300007076 Ga0075435_101053728 Ga0075435_1010537282 136
347 3300007265 Ga0099794_10002650 Ga0099794_100026502 136
348 3300007265 Ga0099794_10200312 Ga0099794_102003122 136
349 3300007788 Ga0099795_10277063 Ga0099795_102770632 136
350 3300009098 Ga0105245_10216986 Ga0105245_102169862 136
351 3300009147 Ga0114129_10014190 Ga0114129_1001419010 136
352 3300009147 Ga0114129_11479981 Ga0114129_114799812 136
353 3300009148 Ga0105243_10025283 Ga0105243_100252832 136
354 3300009148 Ga0105243_10436877 Ga0105243_104368772 136
355 3300009174 Ga0105241_10002642 Ga0105241_1000264213 136
356 3300009176 Ga0105242_10324341 Ga0105242_103243411 136
357 3300009176 Ga0105242_10510090 Ga0105242_105100902 136
358 3300009177 Ga0105248_10244989 Ga0105248_102449892 136
359 3300009545 Ga0105237_10761955 Ga0105237_107619552 136
360 3300009545 Ga0105237_11083508 Ga0105237_110835081 136
361 3300009553 Ga0105249_10644916 Ga0105249_106449162 136
362 3300010375 Ga0105239_10203855 Ga0105239_102038552 136
363 3300011119 Ga0105246_10722678 Ga0105246_107226782 136
364 3300013100 Ga0157373_10000727 Ga0157373_100007276 136
365 3300013105 Ga0157369_10007825 Ga0157369_100078256 136
366 3300013297 Ga0157378_10316852 Ga0157378_103168522 136
367 3300013307 Ga0157372_10009278 Ga0157372_100092788 136
368 3300013307 Ga0157372_10531290 Ga0157372_105312902 136
369 3300013308 Ga0157375_10182483 Ga0157375_101824832 136
370 3300014325 Ga0163163_10357266 Ga0163163_103572662 136
371 3300014325 Ga0163163_11339994 Ga0163163_113399941 136
372 3300014326 Ga0157380_10728842 Ga0157380_107288421 136
373 3300025885 Ga0207653_10009510 Ga0207653_100095102 136
374 3300025885 Ga0207653_10113617 Ga0207653_101136172 136
375 3300025901 Ga0207688_10085278 Ga0207688_100852782 136
376 3300025904 Ga0207647_10031474 Ga0207647_100314744 136
377 3300025905 Ga0207685_10141601 Ga0207685_101416012 136
378 3300025907 Ga0207645_10000170 Ga0207645_1000017036 136
379 3300025907 Ga0207645_10043249 Ga0207645_100432492 136
380 3300025908 Ga0207643_10000051 Ga0207643_1000005145 136
381 3300025910 Ga0207684_10003991 Ga0207684_100039914 136
382 3300025910 Ga0207684_10026668 Ga0207684_100266682 136
383 3300025910 Ga0207684_10057050 Ga0207684_100570502 136
384 3300025910 Ga0207684_10066495 Ga0207684_100664952 136
385 3300025910 Ga0207684_10111519 Ga0207684_101115192 136
386 3300025910 Ga0207684_10253494 Ga0207684_102534942 136
387 3300025910 Ga0207684_10522024 Ga0207684_105220242 136
388 3300025910 Ga0207684_10522523 Ga0207684_105225232 136
389 3300025911 Ga0207654_10001033 Ga0207654_100010338 136
390 3300025912 Ga0207707_10000453 Ga0207707_1000045343 136
391 3300025912 Ga0207707_10097202 Ga0207707_100972022 136
392 3300025912 Ga0207707_10225065 Ga0207707_102250652 136
393 3300025914 Ga0207671_10167952 Ga0207671_101679522 136
394 3300025916 Ga0207663_10138435 Ga0207663_101384352 136
395 3300025917 Ga0207660_10000203 Ga0207660_1000020334 136
396 3300025918 Ga0207662_10066768 Ga0207662_100667682 136
397 3300025919 Ga0207657_10000357 Ga0207657_1000035719 136
398 3300025920 Ga0207649_10010062 Ga0207649_100100623 136
399 3300025921 Ga0207652_10032750 Ga0207652_100327502 136
400 3300025922 Ga0207646_10001207 Ga0207646_100012073 136
401 3300025922 Ga0207646_10020502 Ga0207646_100205025 136
402 3300025922 Ga0207646_10269445 Ga0207646_102694452 136
403 3300025922 Ga0207646_10578114 Ga0207646_105781142 136
404 3300025922 Ga0207646_10878232 Ga0207646_108782322 136
405 3300025922 Ga0207646_11026536 Ga0207646_110265362 136
406 3300025923 Ga0207681_10033960 Ga0207681_100339602 136
407 3300025925 Ga0207650_10016809 Ga0207650_100168093 136
408 3300025928 Ga0207700_10626193 Ga0207700_106261931 136
409 3300025931 Ga0207644_10491855 Ga0207644_104918552 136
410 3300025932 Ga0207690_10000611 Ga0207690_1000061116 136
411 3300025933 Ga0207706_10767628 Ga0207706_107676282 136
412 3300025935 Ga0207709_10020463 Ga0207709_100204632 136
413 3300025935 Ga0207709_10105720 Ga0207709_101057203 136
414 3300025936 Ga0207670_10673712 Ga0207670_106737122 136
415 3300025939 Ga0207665_10344901 Ga0207665_103449012 136
416 3300025941 Ga0207711_10362074 Ga0207711_103620742 136
417 3300025942 Ga0207689_10000296 Ga0207689_100002969 136
418 3300025942 Ga0207689_10008186 Ga0207689_100081866 136
419 3300025945 Ga0207679_10000233 Ga0207679_1000023316 136
420 3300025949 Ga0207667_10001733 Ga0207667_100017339 136
421 3300025960 Ga0207651_10272224 Ga0207651_102722242 136
422 3300025961 Ga0207712_10632541 Ga0207712_106325412 136
423 3300025981 Ga0207640_10002914 Ga0207640_100029147 136
424 3300025981 Ga0207640_10232213 Ga0207640_102322132 136
425 3300026023 Ga0207677_10013536 Ga0207677_100135362 136
426 3300026041 Ga0207639_10000673 Ga0207639_100006733 136
427 3300026067 Ga0207678_10003802 Ga0207678_100038024 136
428 3300026078 Ga0207702_10001254 Ga0207702_100012548 136
429 3300026089 Ga0207648_10003252 Ga0207648_100032529 136
430 3300026089 Ga0207648_10336460 Ga0207648_103364602 136
431 3300026095 Ga0207676_10042550 Ga0207676_100425503 136
432 3300026116 Ga0207674_10000836 Ga0207674_1000083642 136
433 3300026118 Ga0207675_100007334 Ga0207675_10000733411 136
434 3300026142 Ga0207698_10044174 Ga0207698_100441742 136
435 3300027360 Ga0209969_1006370 Ga0209969_10063702 136
436 3300027364 Ga0209967_1015516 Ga0209967_10155161 136
437 3300027395 Ga0209996_1005890 Ga0209996_10058902 136
438 3300027424 Ga0209984_1060819 Ga0209984_10608191 136
439 3300027471 Ga0209995_1001622 Ga0209995_10016222 136
440 3300027543 Ga0209999_1047109 Ga0209999_10471092 136
441 3300027552 Ga0209982_1005033 Ga0209982_10050333 136
442 3300027617 Ga0210002_1011346 Ga0210002_10113462 136
443 3300027665 Ga0209983_1005137 Ga0209983_10051373 136
444 3300027671 Ga0209588_1008161 Ga0209588_10081612 136
445 3300027682 Ga0209971_1000060 Ga0209971_100006024 136
446 3300027695 Ga0209966_1000312 Ga0209966_10003123 136
447 3300027717 Ga0209998_10000006 Ga0209998_1000000641 136
448 3300027876 Ga0209974_10006984 Ga0209974_100069844 136
449 3300028380 Ga0268265_10002892 Ga0268265_1000289211 136
450 3300028380 Ga0268265_10014365 Ga0268265_100143654 136
451 3300028381 Ga0268264_10091495 Ga0268264_100914952 136
452 3300031731 Ga0307405_10704157 Ga0307405_107041572 136
453 3300031995 Ga0307409_100208349 Ga0307409_1002083492 136
454 3300032004 Ga0307414_11031382 Ga0307414_110313822 136
455 3300035083 Ga0373926_0029359 Ga0373926_0029359_110_550 136
456 3300035084 Ga0373928_0263328 Ga0373928_0263328_39_449 136
457 3300035088 Ga0373940_0001445 Ga0373940_0001445_37_447 136
458 3300035091 Ga0373951_0026697 Ga0373951_0026697_465_875 136
459 3300035092 Ga0373952_0169007 Ga0373952_0169007_16_426 136
460 3300035111 Ga0373923_0026197 Ga0373923_0026197_1587_2027 136
461 3300035112 Ga0373932_0043535 Ga0373932_0043535_482_892 136
462 3300035112 Ga0373932_0418697 Ga0373932_0418697_20_430 136
463 3300035113 Ga0373936_0431355 Ga0373936_0431355_85_525 136
464 3300035115 Ga0373941_0138085 Ga0373941_0138085_108_518 136
465 3300035117 Ga0373953_0178699 Ga0373953_0178699_463_903 136
466 3300035118 Ga0373954_0036560 Ga0373954_0036560_241_681 136
467 3300035119 Ga0373956_0371313 Ga0373956_0371313_32_472 136
468 3300035121 Ga0373960_0385094 Ga0373960_0385094_71_481 136
469 3300035241 Ga0373961_0092475 Ga0373961_0092475_461_871 136
470 3300035242 Ga0373962_0017064 Ga0373962_0017064_79_489 136
471 3300035691 Ga0373931_0009986 Ga0373931_0009986_1338_1748 136
472 3300035691 Ga0373931_0338479 Ga0373931_0338479_356_766 136
473 3300035695 Ga0373927_0002662 Ga0373927_0002662_7695_8135 136
474 3300035725 Ga0373947_0094567 Ga0373947_0094567_274_714 136
475 3300036401 Ga0373937_0107616 Ga0373937_0107616_1928_2368 136
476 3300036647 Ga0316582_1170762 Ga0316582_1170762_12_425 136
477 3300037068 Ga0373925_0335570 Ga0373925_0335570_614_1054 136
478 3300038996 Ga0242420_080854 Ga0242420_080854_122_532 136
479 3300042005 Ga0439448_0003529 Ga0439448_0003529_264_674 136
480 3300042137 Ga0450902_018119 Ga0450902_018119_566_976 136
481 3300042157 Ga0439458_0155110 Ga0439458_0155110_28_438 136
482 3300042438 Ga0439459_0001209 Ga0439459_0001209_688_1098 136
483 3300042439 Ga0439464_0006796 Ga0439464_0006796_2400_2810 136
484 3300042461 Ga0439460_0011704 Ga0439460_0011704_1450_1860 136
485 3300042532 Ga0450893_0069739 Ga0450893_0069739_106_516 136
486 3300042876 Ga0451577_0006203 Ga0451577_0006203_10882_11292 136
487 3300042876 Ga0451577_0045895 Ga0451577_0045895_2149_2559 136
488 3300042876 Ga0451577_1344837 Ga0451577_1344837_48_458 136
489 3300044673 Ga0453683_0045587 Ga0453683_0045587_1409_1819 136
490 3300044673 Ga0453683_0056973 Ga0453683_0056973_85_495 136
491 3300044673 Ga0453683_0355306 Ga0453683_0355306_29_439 136
492 3300044712 Ga0453684_0054480 Ga0453684_0054480_746_1156 136
493 3300044712 Ga0453684_0554652 Ga0453684_0554652_645_1055 136
494 3300045051 Ga0451576_0028962 Ga0451576_0028962_1998_2408 136
495 3300045051 Ga0451576_0048881 Ga0451576_0048881_1222_1632 136
496 3300045051 Ga0451576_0224813 Ga0451576_0224813_485_895 136
497 3300045051 Ga0451576_1437401 Ga0451576_1437401_200_610 136
498 3300046472 Ga0495580_0014168 Ga0495580_0014168_4438_4878 136
499 3300046472 Ga0495580_0111626 Ga0495580_0111626_1433_1843 136
500 3300046472 Ga0495580_0362882 Ga0495580_0362882_378_788 136
501 3300046472 Ga0495580_0748528 Ga0495580_0748528_169_579 136
502 3300046475 Ga0495639_0142212 Ga0495639_0142212_208_648 136
503 3300046477 Ga0495664_0422638 Ga0495664_0422638_45_485 136
504 3300046491 Ga0495584_0288423 Ga0495584_0288423_380_790 136
505 3300046531 Ga0495665_0024426 Ga0495665_0024426_1719_2159 136
506 3300046543 Ga0495645_0467641 Ga0495645_0467641_75_515 136
507 3300046559 Ga0495667_0639261 Ga0495667_0639261_190_630 136
508 3300046642 Ga0495634_0617555 Ga0495634_0617555_18_458 136
509 3300046663 Ga0495635_0245388 Ga0495635_0245388_717_1157 136
510 3300047319 Ga0495674_0197269 Ga0495674_0197269_695_1135 136
511 3300047444 Ga0495675_0300134 Ga0495675_0300134_125_565 136
512 3300047471 Ga0495684_0141424 Ga0495684_0141424_526_966 136
513 3300048905 Ga0496102_0010781 Ga0496102_0010781_292_702 136
514 3300048911 Ga0496108_1234191 Ga0496108_1234191_162_572 136
515 3300048913 Ga0496110_1542235 Ga0496110_1542235_55_465 136
516 3300048915 Ga0496112_0170862 Ga0496112_0170862_500_910 136
517 3300049568 Ga0501031_0101748 Ga0501031_0101748_1024_1434 136
518 3300049568 Ga0501031_0341284 Ga0501031_0341284_242_652 136
519 3300049569 Ga0501032_0850245 Ga0501032_0850245_33_443 136
520 3300049570 Ga0501033_0031121 Ga0501033_0031121_442_852 136
521 3300049570 Ga0501033_0149654 Ga0501033_0149654_1055_1555 136
522 3300049572 Ga0501036_0101892 Ga0501036_0101892_1273_1683 136
523 3300049572 Ga0501036_0189248 Ga0501036_0189248_735_1145 136
524 3300049572 Ga0501036_0422683 Ga0501036_0422683_429_839 136
525 3300049572 Ga0501036_0464140 Ga0501036_0464140_98_598 136
526 3300049573 Ga0501037_0038927 Ga0501037_0038927_373_783 136
527 3300049574 Ga0501038_0118241 Ga0501038_0118241_1544_1954 136
528 3300049575 Ga0501039_0025015 Ga0501039_0025015_1545_1955 136
529 3300049575 Ga0501039_0266358 Ga0501039_0266358_909_1319 136
530 3300049576 Ga0501040_0001289 Ga0501040_0001289_8578_8988 136
531 3300049576 Ga0501040_0173671 Ga0501040_0173671_1052_1462 136
532 3300049576 Ga0501040_0219686 Ga0501040_0219686_64_474 136
533 3300049576 Ga0501040_0674163 Ga0501040_0674163_321_731 136
534 3300049577 Ga0501041_0002902 Ga0501041_0002902_938_1348 136
535 3300049577 Ga0501041_0063689 Ga0501041_0063689_1367_1777 136
536 3300049577 Ga0501041_0163382 Ga0501041_0163382_46_456 136
537 3300049578 Ga0501042_0003204 Ga0501042_0003204_8601_9011 136
538 3300049578 Ga0501042_0022065 Ga0501042_0022065_283_693 136
539 3300049578 Ga0501042_0648134 Ga0501042_0648134_199_612 136
540 3300049579 Ga0501043_0046014 Ga0501043_0046014_1387_1797 136
541 3300049579 Ga0501043_0844840 Ga0501043_0844840_121_531 136
542 3300049580 Ga0501046_0001711 Ga0501046_0001711_4013_4423 136
543 3300049580 Ga0501046_0086321 Ga0501046_0086321_482_982 136
544 3300049581 Ga0501047_0063964 Ga0501047_0063964_669_1079 136
545 3300049582 Ga0501048_0004989 Ga0501048_0004989_8080_8490 136
546 3300049582 Ga0501048_1125911 Ga0501048_1125911_50_460 136
547 3300049582 Ga0501048_1143711 Ga0501048_1143711_40_471 136
548 3300049584 Ga0501068_0229756 Ga0501068_0229756_75_575 136
549 3300049584 Ga0501068_0408836 Ga0501068_0408836_285_695 136
550 3300049587 Ga0501071_0053860 Ga0501071_0053860_69_479 136
551 3300049587 Ga0501071_0109461 Ga0501071_0109461_656_1066 136
552 3300049587 Ga0501071_0394029 Ga0501071_0394029_533_943 136
553 3300049588 Ga0501072_0093129 Ga0501072_0093129_1635_2045 136
554 3300049588 Ga0501072_0129735 Ga0501072_0129735_955_1365 136
555 3300049588 Ga0501072_0288655 Ga0501072_0288655_711_1121 136
556 3300049590 Ga0501074_0006054 Ga0501074_0006054_610_1020 136
557 3300049590 Ga0501074_0358818 Ga0501074_0358818_128_538 136
558 3300049591 Ga0501075_0006543 Ga0501075_0006543_3733_4143 136
559 3300049591 Ga0501075_0021176 Ga0501075_0021176_1748_2158 136
560 3300049591 Ga0501075_0374383 Ga0501075_0374383_466_876 136
561 3300049592 Ga0501076_0027512 Ga0501076_0027512_2438_2848 136
562 3300049592 Ga0501076_0060399 Ga0501076_0060399_1655_2065 136
563 3300049592 Ga0501076_0063233 Ga0501076_0063233_749_1159 136
564 3300049592 Ga0501076_0340278 Ga0501076_0340278_717_1148 136
565 3300049593 Ga0501077_0104695 Ga0501077_0104695_441_851 136
566 3300049593 Ga0501077_0282172 Ga0501077_0282172_565_975 136
567 3300049593 Ga0501077_0331787 Ga0501077_0331787_210_620 136
568 3300049741 Ga0501079_0000760 Ga0501079_0000760_10631_11041 136
569 3300049741 Ga0501079_0008890 Ga0501079_0008890_4361_4771 136
570 3300049741 Ga0501079_0105145 Ga0501079_0105145_28_438 136
571 3300049741 Ga0501079_0273270 Ga0501079_0273270_534_1028 136
572 3300049741 Ga0501079_0367151 Ga0501079_0367151_520_930 136
573 3300049741 Ga0501079_0702303 Ga0501079_0702303_89_550 136
574 3300049741 Ga0501079_0981790 Ga0501079_0981790_116_526 136
575 3300049742 Ga0501080_0633180 Ga0501080_0633180_230_640 136
576 3300049743 Ga0501081_0020663 Ga0501081_0020663_2014_2424 136
577 3300049743 Ga0501081_0057687 Ga0501081_0057687_1962_2462 136
578 3300049743 Ga0501081_0087750 Ga0501081_0087750_1279_1773 136
579 3300049743 Ga0501081_0297579 Ga0501081_0297579_379_789 136
580 3300049743 Ga0501081_0310626 Ga0501081_0310626_447_857 136
581 3300049743 Ga0501081_0352133 Ga0501081_0352133_108_518 136
582 3300049744 Ga0501083_0011123 Ga0501083_0011123_348_758 136
583 3300049744 Ga0501083_0198248 Ga0501083_0198248_427_837 136
584 3300049744 Ga0501083_0723727 Ga0501083_0723727_70_480 136
585 3300049824 Ga0501045_0000717 Ga0501045_0000717_12058_12468 136
586 3300049824 Ga0501045_0298344 Ga0501045_0298344_143_643 136
587 3300050507 nmdc:mga05p37_213226_c1 nmdc:mga05p37_213226_c1_985_1395 136
588 3300050507 nmdc:mga05p37_219186_c1 nmdc:mga05p37_219186_c1_632_1042 136
589 3300050507 nmdc:mga05p37_506035_c1 nmdc:mga05p37_506035_c1_26_469 136
590 3300050507 nmdc:mga05p37_6819_c1 nmdc:mga05p37_6819_c1_40_450 136
591 3300050508 nmdc:mga09592_648166_c1 nmdc:mga09592_648166_c1_155_646 136
592 3300050510 nmdc:mga06r32_381000_c1 nmdc:mga06r32_381000_c1_576_986 136
593 3300050512 nmdc:mga0n895_2180639_c1 nmdc:mga0n895_2180639_c1_87_497 136
594 3300050512 nmdc:mga0n895_39410_c1 nmdc:mga0n895_39410_c1_151_561 136
595 3300050512 nmdc:mga0n895_678508_c1 nmdc:mga0n895_678508_c1_45_536 136
596 3300050513 nmdc:mga0rr50_10901_c1 nmdc:mga0rr50_10901_c1_3735_4145 136
597 3300050514 nmdc:mga08x19_677641_c1 nmdc:mga08x19_677641_c1_93_503 136
598 3300050514 nmdc:mga08x19_78596_c1 nmdc:mga08x19_78596_c1_951_1361 136
599 3300050515 nmdc:mga0a205_182435_c2 nmdc:mga0a205_182435_c2_541_951 136
600 3300050515 nmdc:mga0a205_262615_c1 nmdc:mga0a205_262615_c1_70_564 136
601 3300050515 nmdc:mga0a205_740416_c1 nmdc:mga0a205_740416_c1_205_693 136
602 3300050515 nmdc:mga0a205_8715_c1 nmdc:mga0a205_8715_c1_23_433 136
603 3300054114 Ga0501084_0002865 Ga0501084_0002865_3380_3790 136
604 3300054114 Ga0501084_0030896 Ga0501084_0030896_3540_3950 136
605 3300054114 Ga0501084_0663789 Ga0501084_0663789_85_579 136
606 3300059421 Ga0590071_027846 Ga0590071_027846_858_1271 136
607 3300059426 Ga0590077_068774 Ga0590077_068774_303_716 136
608 3300060353 Ga0501082_0015483 Ga0501082_0015483_4117_4527 136
609 3300060353 Ga0501082_0024763 Ga0501082_0024763_4493_4903 136
610 3300060353 Ga0501082_0046990 Ga0501082_0046990_1530_2030 136
611 3300060353 Ga0501082_0129223 Ga0501082_0129223_487_897 136
612 3300060353 Ga0501082_0246933 Ga0501082_0246933_372_782 136
613 3300060353 Ga0501082_1441947 Ga0501082_1441947_50_481 136
614 3300061734 Ga0530510_0014717 Ga0530510_0014717_1190_1600 136
615 3300061734 Ga0530510_0026226 Ga0530510_0026226_302_712 136
616 3300061734 Ga0530510_0209667 Ga0530510_0209667_78_488 136
617 3300061734 Ga0530510_0457301 Ga0530510_0457301_343_843 136
618 3300061734 Ga0530510_0579831 Ga0530510_0579831_270_701 136
619 3300061734 Ga0530510_1004391 Ga0530510_1004391_179_589 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02310

B12-binding

B12 binding domain

36

154

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.981 5 132
2xiq-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa 0.9778 6 130
8dyl-assembly1.cif.gz_B crystal structure of human methylmalonyl-coa mutase bound to aquocobalamin 0.9772 4 130
6oxc-assembly1.cif.gz_A structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin 0.966 7 130
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.9516 5 132
ID Description Score Start End Superfamily
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9794 5 131 3.40.50.280
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9786 7 132 3.40.50.280
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9571 5 131 3.40.50.280
af_A4I2L1_581_723_3.40.50.280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9078 7 132 3.40.50.280
4jgiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.8888 4 128 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A2V8I2J3-F1-model_v4 Methylmalonyl-CoA mutase 0.988 4 130 GO:0016853
GO:0031419
GO:0046872
AF-A0A7V3RWE8-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9866 3 131 GO:0016853
GO:0031419
GO:0046872
AF-A0A1Q7Y4E5-F1-model_v4 Methylmalonyl-CoA mutase 0.9859 2 135 GO:0016853
GO:0031419
GO:0046872
AF-A0A831Y7U5-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9838 6 128 GO:0016853
GO:0031419
GO:0046872
AF-A0A6N9F9N7-F1-model_v4 deleted 0.9826 1 130

Feature Viewer

pLDDT pTM Quality
93.53 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map