F469858
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 268 | 619 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0149654|Ga0501033_0149654_1055_1555 |
| Length | 166 |
| Sequence | MLAGGELRHGVHVRRERGSLRRRHETPGDTVISQPIRILIAKVGLDGHDRGAKIVARALRDGGMDVIYTGLHRTPEEVVSAAVQEDVDVIGVSILSGAHMTLLPRILELLRASDAADVLLVAGGVIPDEDVPVLRDSGVAEIFLQETPPAALVARVRDLVETRRAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 166 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 188 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 189 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 190 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 191 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 192 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 193 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 194 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 195 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 196 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 221 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.81 |
| Rhizosphere | 99.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI26141J51220_1001595 | 3300003503 | Bacteria | 1372 |
| 2 | Ga0065712_10675061 | 3300005290 | Bacteria | 557 |
| 3 | Ga0065715_10234588 | 3300005293 | Bacteria | 1201 |
| 4 | Ga0070676_10000025 | 3300005328 | Bacteria | 46204 |
| 5 | Ga0070676_10011704 | 3300005328 | Bacteria | 4776 |
| 6 | Ga0070690_100133450 | 3300005330 | Bacteria | 1679 |
| 7 | Ga0070670_100038454 | 3300005331 | Bacteria | 4114 |
| 8 | Ga0068869_100000205 | 3300005334 | Bacteria | 30762 |
| 9 | Ga0068869_100027452 | 3300005334 | Bacteria | 3969 |
| 10 | Ga0070680_100002677 | 3300005336 | Bacteria | 13202 |
| 11 | Ga0070680_100133404 | 3300005336 | Bacteria | 2079 |
| 12 | Ga0070682_100000180 | 3300005337 | Bacteria | 47178 |
| 13 | Ga0068868_100073761 | 3300005338 | Bacteria | 2725 |
| 14 | Ga0070660_100000428 | 3300005339 | Bacteria | 27846 |
| 15 | Ga0070689_100158932 | 3300005340 | Bacteria | 1826 |
| 16 | Ga0070689_100434135 | 3300005340 | Bacteria | 1115 |
| 17 | Ga0070691_10004798 | 3300005341 | Bacteria | 6156 |
| 18 | Ga0070691_10046408 | 3300005341 | Bacteria | 2063 |
| 19 | Ga0070691_10064925 | 3300005341 | Bacteria | 1762 |
| 20 | Ga0070691_10709308 | 3300005341 | Bacteria | 605 |
| 21 | Ga0070687_100068462 | 3300005343 | Bacteria | 1898 |
| 22 | Ga0070661_100000822 | 3300005344 | Bacteria | 22322 |
| 23 | Ga0070692_10000133 | 3300005345 | Bacteria | 17791 |
| 24 | Ga0070668_100852858 | 3300005347 | Bacteria | 812 |
| 25 | Ga0070669_100649045 | 3300005353 | Bacteria | 888 |
| 26 | Ga0070671_101016125 | 3300005355 | Bacteria | 727 |
| 27 | Ga0070673_100014726 | 3300005364 | Bacteria | 5463 |
| 28 | Ga0070659_100003379 | 3300005366 | Bacteria | 11365 |
| 29 | Ga0070703_10123293 | 3300005406 | Bacteria | 943 |
| 30 | Ga0070703_10156042 | 3300005406 | Bacteria | 862 |
| 31 | Ga0070713_102330400 | 3300005436 | Bacteria | 518 |
| 32 | Ga0070701_10061719 | 3300005438 | Bacteria | 1977 |
| 33 | Ga0070701_10279822 | 3300005438 | Bacteria | 1018 |
| 34 | Ga0070701_10409444 | 3300005438 | Bacteria | 861 |
| 35 | Ga0070705_100000078 | 3300005440 | Bacteria | 53383 |
| 36 | Ga0070705_100279900 | 3300005440 | Bacteria | 1185 |
| 37 | Ga0070705_100570729 | 3300005440 | Bacteria | 870 |
| 38 | Ga0070700_100020317 | 3300005441 | Bacteria | 3845 |
| 39 | Ga0070694_100000656 | 3300005444 | Bacteria | 19138 |
| 40 | Ga0070694_100002729 | 3300005444 | Bacteria | 10474 |
| 41 | Ga0070694_100023706 | 3300005444 | Bacteria | 3951 |
| 42 | Ga0070694_100092985 | 3300005444 | Bacteria | 2119 |
| 43 | Ga0070694_100514161 | 3300005444 | Bacteria | 954 |
| 44 | Ga0070708_100011090 | 3300005445 | Bacteria | 7322 |
| 45 | Ga0070708_100056325 | 3300005445 | Bacteria | 3497 |
| 46 | Ga0070708_100091473 | 3300005445 | Bacteria | 2771 |
| 47 | Ga0070708_100131402 | 3300005445 | Bacteria | 2317 |
| 48 | Ga0070708_100207098 | 3300005445 | Bacteria | 1837 |
| 49 | Ga0070708_100235322 | 3300005445 | Bacteria | 1719 |
| 50 | Ga0070708_100754913 | 3300005445 | Bacteria | 915 |
| 51 | Ga0070663_100152558 | 3300005455 | Bacteria | 1773 |
| 52 | Ga0070663_100990800 | 3300005455 | Bacteria | 730 |
| 53 | Ga0070662_100753808 | 3300005457 | Bacteria | 826 |
| 54 | Ga0070681_10061725 | 3300005458 | Bacteria | 3722 |
| 55 | Ga0070681_10192940 | 3300005458 | Bacteria | 1956 |
| 56 | Ga0070681_10504015 | 3300005458 | Bacteria | 1124 |
| 57 | Ga0068867_100004170 | 3300005459 | Bacteria | 10169 |
| 58 | Ga0068867_100010785 | 3300005459 | Bacteria | 6447 |
| 59 | Ga0068867_100396359 | 3300005459 | Bacteria | 1163 |
| 60 | Ga0070706_100099348 | 3300005467 | Bacteria | 2704 |
| 61 | Ga0070706_100180428 | 3300005467 | Bacteria | 1971 |
| 62 | Ga0070706_100427321 | 3300005467 | Bacteria | 1233 |
| 63 | Ga0070706_100530460 | 3300005467 | Bacteria | 1095 |
| 64 | Ga0070706_100581227 | 3300005467 | Bacteria | 1041 |
| 65 | Ga0070707_100023174 | 3300005468 | Bacteria | 5873 |
| 66 | Ga0070707_100057153 | 3300005468 | Bacteria | 3743 |
| 67 | Ga0070707_100081846 | 3300005468 | Bacteria | 3117 |
| 68 | Ga0070707_100190765 | 3300005468 | Bacteria | 1998 |
| 69 | Ga0070707_101406691 | 3300005468 | Bacteria | 664 |
| 70 | Ga0070707_101442829 | 3300005468 | Bacteria | 655 |
| 71 | Ga0070698_100002570 | 3300005471 | Bacteria | 19982 |
| 72 | Ga0070698_100013281 | 3300005471 | Bacteria | 8716 |
| 73 | Ga0070698_100142353 | 3300005471 | Bacteria | 2349 |
| 74 | Ga0070698_100193600 | 3300005471 | Bacteria | 1970 |
| 75 | Ga0070698_100651291 | 3300005471 | Bacteria | 995 |
| 76 | Ga0070699_100004138 | 3300005518 | Bacteria | 12816 |
| 77 | Ga0070699_100011799 | 3300005518 | Bacteria | 7540 |
| 78 | Ga0070699_100037436 | 3300005518 | Bacteria | 4198 |
| 79 | Ga0070699_100039547 | 3300005518 | Bacteria | 4083 |
| 80 | Ga0070699_100115835 | 3300005518 | Bacteria | 2355 |
| 81 | Ga0070699_100160585 | 3300005518 | Bacteria | 1989 |
| 82 | Ga0070699_100258733 | 3300005518 | Bacteria | 1556 |
| 83 | Ga0070699_100319318 | 3300005518 | Bacteria | 1395 |
| 84 | Ga0070699_100702458 | 3300005518 | Bacteria | 924 |
| 85 | Ga0070679_100007425 | 3300005530 | Bacteria | 10242 |
| 86 | Ga0070679_100487631 | 3300005530 | Bacteria | 1177 |
| 87 | Ga0070684_101425606 | 3300005535 | Bacteria | 652 |
| 88 | Ga0070697_100003917 | 3300005536 | Bacteria | 11435 |
| 89 | Ga0070697_100040307 | 3300005536 | Bacteria | 3778 |
| 90 | Ga0070697_100041574 | 3300005536 | Bacteria | 3721 |
| 91 | Ga0070697_100043676 | 3300005536 | Bacteria | 3630 |
| 92 | Ga0070697_100119316 | 3300005536 | Bacteria | 2205 |
| 93 | Ga0070697_100206470 | 3300005536 | Bacteria | 1671 |
| 94 | Ga0070697_100226327 | 3300005536 | Bacteria | 1594 |
| 95 | Ga0070697_100435331 | 3300005536 | Bacteria | 1141 |
| 96 | Ga0068853_100000255 | 3300005539 | Bacteria | 37353 |
| 97 | Ga0070695_100001694 | 3300005545 | Bacteria | 12419 |
| 98 | Ga0070695_100030093 | 3300005545 | Bacteria | 3378 |
| 99 | Ga0070695_100054243 | 3300005545 | Bacteria | 2579 |
| 100 | Ga0070695_100081344 | 3300005545 | Bacteria | 2143 |
| 101 | Ga0070696_100001230 | 3300005546 | Bacteria | 16617 |
| 102 | Ga0070696_100095963 | 3300005546 | Bacteria | 2118 |
| 103 | Ga0070696_100200714 | 3300005546 | Bacteria | 1489 |
| 104 | Ga0070696_100482067 | 3300005546 | Bacteria | 984 |
| 105 | Ga0070693_100000163 | 3300005547 | Bacteria | 30819 |
| 106 | Ga0070693_100012218 | 3300005547 | Bacteria | 4342 |
| 107 | Ga0070704_100000731 | 3300005549 | Bacteria | 16084 |
| 108 | Ga0070704_100221928 | 3300005549 | Bacteria | 1537 |
| 109 | Ga0070704_101417181 | 3300005549 | Bacteria | 638 |
| 110 | Ga0068855_100000612 | 3300005563 | Bacteria | 43896 |
| 111 | Ga0070664_100094385 | 3300005564 | Bacteria | 2594 |
| 112 | Ga0068857_100001797 | 3300005577 | Bacteria | 17256 |
| 113 | Ga0068857_100028151 | 3300005577 | Bacteria | 4957 |
| 114 | Ga0068854_100025201 | 3300005578 | Bacteria | 4081 |
| 115 | Ga0068854_100133054 | 3300005578 | Bacteria | 1901 |
| 116 | Ga0068854_100859549 | 3300005578 | Bacteria | 795 |
| 117 | Ga0068856_100000630 | 3300005614 | Bacteria | 38381 |
| 118 | Ga0070702_100040801 | 3300005615 | Bacteria | 2599 |
| 119 | Ga0070702_100194263 | 3300005615 | Bacteria | 1338 |
| 120 | Ga0068852_100118419 | 3300005616 | Bacteria | 2420 |
| 121 | Ga0068859_100001373 | 3300005617 | Bacteria | 24750 |
| 122 | Ga0068859_100565819 | 3300005617 | Bacteria | 1231 |
| 123 | Ga0068859_100571901 | 3300005617 | Bacteria | 1224 |
| 124 | Ga0068866_10099127 | 3300005718 | Bacteria | 1604 |
| 125 | Ga0068861_100037179 | 3300005719 | Bacteria | 3619 |
| 126 | Ga0068870_10000221 | 3300005840 | Bacteria | 20755 |
| 127 | Ga0068870_10026265 | 3300005840 | Bacteria | 2902 |
| 128 | Ga0068863_100022279 | 3300005841 | Bacteria | 6048 |
| 129 | Ga0068858_101536322 | 3300005842 | Bacteria | 657 |
| 130 | Ga0068860_100006069 | 3300005843 | Bacteria | 12161 |
| 131 | Ga0068862_100001036 | 3300005844 | Bacteria | 26683 |
| 132 | Ga0068862_100138891 | 3300005844 | Bacteria | 2156 |
| 133 | Ga0068862_100186520 | 3300005844 | Bacteria | 1864 |
| 134 | Ga0081455_10002783 | 3300005937 | Bacteria | 20602 |
| 135 | Ga0081455_10828678 | 3300005937 | Bacteria | 579 |
| 136 | Ga0070715_10080313 | 3300006163 | Bacteria | 1479 |
| 137 | Ga0070716_100156778 | 3300006173 | Bacteria | 1471 |
| 138 | Ga0070716_100574276 | 3300006173 | Bacteria | 844 |
| 139 | Ga0068871_100300844 | 3300006358 | Bacteria | 1408 |
| 140 | Ga0075428_100146981 | 3300006844 | Bacteria | 2562 |
| 141 | Ga0075430_100006024 | 3300006846 | Bacteria | 10227 |
| 142 | Ga0075430_100090703 | 3300006846 | Bacteria | 2556 |
| 143 | Ga0075430_100097971 | 3300006846 | Bacteria | 2450 |
| 144 | Ga0075431_100000545 | 3300006847 | Bacteria | 31644 |
| 145 | Ga0075431_100014658 | 3300006847 | Bacteria | 7931 |
| 146 | Ga0075431_100030037 | 3300006847 | Bacteria | 5596 |
| 147 | Ga0075431_100037960 | 3300006847 | Bacteria | 4959 |
| 148 | Ga0075431_100161543 | 3300006847 | Bacteria | 2303 |
| 149 | Ga0075431_100605948 | 3300006847 | Bacteria | 1079 |
| 150 | Ga0075431_101372621 | 3300006847 | Bacteria | 667 |
| 151 | Ga0075433_10004845 | 3300006852 | Bacteria | 10523 |
| 152 | Ga0075433_10100818 | 3300006852 | Bacteria | 2557 |
| 153 | Ga0075433_10173881 | 3300006852 | Bacteria | 1916 |
| 154 | Ga0075433_10416632 | 3300006852 | Bacteria | 1185 |
| 155 | Ga0075433_10422885 | 3300006852 | Bacteria | 1175 |
| 156 | Ga0075434_100015216 | 3300006871 | Bacteria | 7372 |
| 157 | Ga0075434_100029618 | 3300006871 | Bacteria | 5387 |
| 158 | Ga0075434_100082923 | 3300006871 | Bacteria | 3203 |
| 159 | Ga0075434_100089103 | 3300006871 | Bacteria | 3087 |
| 160 | Ga0075434_100198110 | 3300006871 | Bacteria | 2028 |
| 161 | Ga0075434_100360388 | 3300006871 | Bacteria | 1475 |
| 162 | Ga0075434_100698760 | 3300006871 | Bacteria | 1032 |
| 163 | Ga0075434_100848119 | 3300006871 | Archaea | 929 |
| 164 | Ga0075429_100052876 | 3300006880 | Bacteria | 3533 |
| 165 | Ga0075429_100069650 | 3300006880 | Bacteria | 3063 |
| 166 | Ga0075429_100181208 | 3300006880 | Bacteria | 1846 |
| 167 | Ga0075429_100799680 | 3300006880 | Bacteria | 826 |
| 168 | Ga0075436_100117044 | 3300006914 | Bacteria | 1863 |
| 169 | Ga0075436_100247907 | 3300006914 | Bacteria | 1268 |
| 170 | Ga0097620_100001373 | 3300006931 | Bacteria | 24750 |
| 171 | Ga0097620_100565730 | 3300006931 | Bacteria | 1231 |
| 172 | Ga0097620_100571910 | 3300006931 | Bacteria | 1224 |
| 173 | Ga0075435_100024469 | 3300007076 | Bacteria | 4687 |
| 174 | Ga0075435_100071470 | 3300007076 | Bacteria | 2834 |
| 175 | Ga0075435_100071626 | 3300007076 | Bacteria | 2830 |
| 176 | Ga0075435_100138485 | 3300007076 | Bacteria | 2040 |
| 177 | Ga0075435_101053728 | 3300007076 | Bacteria | 710 |
| 178 | Ga0099794_10002650 | 3300007265 | Bacteria | 6657 |
| 179 | Ga0099794_10012752 | 3300007265 | Bacteria | 3639 |
| 180 | Ga0099794_10200312 | 3300007265 | Bacteria | 1022 |
| 181 | Ga0099795_10277063 | 3300007788 | Bacteria | 731 |
| 182 | Ga0105245_10134667 | 3300009098 | Bacteria | 2321 |
| 183 | Ga0105245_10216986 | 3300009098 | Bacteria | 1844 |
| 184 | Ga0114129_10004541 | 3300009147 | Bacteria | 19592 |
| 185 | Ga0114129_10014190 | 3300009147 | Bacteria | 11352 |
| 186 | Ga0114129_10043463 | 3300009147 | Bacteria | 6321 |
| 187 | Ga0114129_10125672 | 3300009147 | Bacteria | 3526 |
| 188 | Ga0114129_10169170 | 3300009147 | Bacteria | 2981 |
| 189 | Ga0114129_10349763 | 3300009147 | Bacteria | 1958 |
| 190 | Ga0114129_11479981 | 3300009147 | Bacteria | 835 |
| 191 | Ga0105243_10025283 | 3300009148 | Bacteria | 4535 |
| 192 | Ga0105243_10162738 | 3300009148 | Bacteria | 1925 |
| 193 | Ga0105243_10436877 | 3300009148 | Bacteria | 1225 |
| 194 | Ga0105241_10002642 | 3300009174 | Bacteria | 13423 |
| 195 | Ga0105241_10780781 | 3300009174 | Bacteria | 878 |
| 196 | Ga0105242_10035280 | 3300009176 | Bacteria | 4011 |
| 197 | Ga0105242_10324341 | 3300009176 | Bacteria | 1413 |
| 198 | Ga0105242_10510090 | 3300009176 | Bacteria | 1145 |
| 199 | Ga0105248_10244989 | 3300009177 | Bacteria | 2018 |
| 200 | Ga0105237_10761955 | 3300009545 | Bacteria | 974 |
| 201 | Ga0105237_11083508 | 3300009545 | Bacteria | 808 |
| 202 | Ga0105249_10051030 | 3300009553 | Bacteria | 3772 |
| 203 | Ga0105249_10644916 | 3300009553 | Bacteria | 1116 |
| 204 | Ga0105249_12747594 | 3300009553 | Bacteria | 564 |
| 205 | Ga0105239_10203855 | 3300010375 | Bacteria | 2216 |
| 206 | Ga0105246_10443660 | 3300011119 | Bacteria | 1089 |
| 207 | Ga0105246_10722678 | 3300011119 | Bacteria | 875 |
| 208 | Ga0157373_10000727 | 3300013100 | Bacteria | 25722 |
| 209 | Ga0157369_10007825 | 3300013105 | Bacteria | 12301 |
| 210 | Ga0157378_10316852 | 3300013297 | Bacteria | 1514 |
| 211 | Ga0157372_10009278 | 3300013307 | Bacteria | 10464 |
| 212 | Ga0157372_10531290 | 3300013307 | Bacteria | 1371 |
| 213 | Ga0157375_10182483 | 3300013308 | Bacteria | 2251 |
| 214 | Ga0157375_11546596 | 3300013308 | Bacteria | 783 |
| 215 | Ga0163163_10357266 | 3300014325 | Bacteria | 1517 |
| 216 | Ga0163163_11339994 | 3300014325 | Bacteria | 778 |
| 217 | Ga0157380_10063627 | 3300014326 | Bacteria | 2959 |
| 218 | Ga0157380_10728842 | 3300014326 | Bacteria | 1000 |
| 219 | Ga0157377_10694372 | 3300014745 | Bacteria | 738 |
| 220 | Ga0207653_10009510 | 3300025885 | Bacteria | 3030 |
| 221 | Ga0207653_10113617 | 3300025885 | Bacteria | 969 |
| 222 | Ga0207642_10139083 | 3300025899 | Bacteria | 1278 |
| 223 | Ga0207688_10085278 | 3300025901 | Bacteria | 1809 |
| 224 | Ga0207647_10031474 | 3300025904 | Bacteria | 3414 |
| 225 | Ga0207685_10141601 | 3300025905 | Bacteria | 1079 |
| 226 | Ga0207645_10000170 | 3300025907 | Bacteria | 51882 |
| 227 | Ga0207645_10043249 | 3300025907 | Bacteria | 2883 |
| 228 | Ga0207643_10000051 | 3300025908 | Bacteria | 77737 |
| 229 | Ga0207684_10003991 | 3300025910 | Bacteria | 14116 |
| 230 | Ga0207684_10026668 | 3300025910 | Bacteria | 4925 |
| 231 | Ga0207684_10057050 | 3300025910 | Bacteria | 3313 |
| 232 | Ga0207684_10066495 | 3300025910 | Bacteria | 3061 |
| 233 | Ga0207684_10111519 | 3300025910 | Bacteria | 2341 |
| 234 | Ga0207684_10253494 | 3300025910 | Bacteria | 1518 |
| 235 | Ga0207684_10522024 | 3300025910 | Bacteria | 1017 |
| 236 | Ga0207684_10522523 | 3300025910 | Bacteria | 1017 |
| 237 | Ga0207654_10001033 | 3300025911 | Bacteria | 15228 |
| 238 | Ga0207707_10000453 | 3300025912 | Bacteria | 42710 |
| 239 | Ga0207707_10097202 | 3300025912 | Bacteria | 2573 |
| 240 | Ga0207707_10225065 | 3300025912 | Bacteria | 1633 |
| 241 | Ga0207707_10971359 | 3300025912 | Bacteria | 698 |
| 242 | Ga0207671_10167952 | 3300025914 | Bacteria | 1702 |
| 243 | Ga0207663_10138435 | 3300025916 | Bacteria | 1692 |
| 244 | Ga0207660_10000203 | 3300025917 | Bacteria | 38120 |
| 245 | Ga0207660_10081436 | 3300025917 | Bacteria | 2379 |
| 246 | Ga0207662_10066768 | 3300025918 | Bacteria | 2168 |
| 247 | Ga0207657_10000357 | 3300025919 | Bacteria | 48334 |
| 248 | Ga0207649_10010062 | 3300025920 | Bacteria | 5189 |
| 249 | Ga0207652_10032750 | 3300025921 | Bacteria | 4372 |
| 250 | Ga0207646_10001207 | 3300025922 | Bacteria | 32503 |
| 251 | Ga0207646_10020502 | 3300025922 | Bacteria | 6124 |
| 252 | Ga0207646_10269445 | 3300025922 | Bacteria | 1539 |
| 253 | Ga0207646_10578114 | 3300025922 | Bacteria | 1009 |
| 254 | Ga0207646_10878232 | 3300025922 | Bacteria | 796 |
| 255 | Ga0207646_11026536 | 3300025922 | Bacteria | 728 |
| 256 | Ga0207681_10033960 | 3300025923 | Bacteria | 3350 |
| 257 | Ga0207650_10016809 | 3300025925 | Bacteria | 5117 |
| 258 | Ga0207687_10215023 | 3300025927 | Bacteria | 1510 |
| 259 | Ga0207700_10626193 | 3300025928 | Bacteria | 958 |
| 260 | Ga0207644_10491855 | 3300025931 | Bacteria | 1011 |
| 261 | Ga0207690_10000611 | 3300025932 | Bacteria | 23074 |
| 262 | Ga0207706_10035870 | 3300025933 | Bacteria | 4406 |
| 263 | Ga0207706_10259629 | 3300025933 | Bacteria | 1517 |
| 264 | Ga0207706_10767628 | 3300025933 | Bacteria | 821 |
| 265 | Ga0207706_10824759 | 3300025933 | Bacteria | 787 |
| 266 | Ga0207686_10327696 | 3300025934 | Bacteria | 1146 |
| 267 | Ga0207709_10020463 | 3300025935 | Bacteria | 3733 |
| 268 | Ga0207709_10105720 | 3300025935 | Bacteria | 1871 |
| 269 | Ga0207670_10392326 | 3300025936 | Bacteria | 1108 |
| 270 | Ga0207670_10673712 | 3300025936 | Bacteria | 854 |
| 271 | Ga0207665_10005953 | 3300025939 | Bacteria | 8114 |
| 272 | Ga0207665_10344901 | 3300025939 | Bacteria | 1123 |
| 273 | Ga0207711_10362074 | 3300025941 | Bacteria | 1344 |
| 274 | Ga0207689_10000296 | 3300025942 | Bacteria | 45380 |
| 275 | Ga0207689_10008186 | 3300025942 | Bacteria | 9109 |
| 276 | Ga0207689_10261093 | 3300025942 | Bacteria | 1433 |
| 277 | Ga0207679_10000233 | 3300025945 | Bacteria | 42806 |
| 278 | Ga0207667_10001733 | 3300025949 | Bacteria | 27447 |
| 279 | Ga0207651_10272224 | 3300025960 | Bacteria | 1395 |
| 280 | Ga0207712_10419101 | 3300025961 | Bacteria | 1129 |
| 281 | Ga0207712_10632541 | 3300025961 | Bacteria | 928 |
| 282 | Ga0207640_10002914 | 3300025981 | Bacteria | 9190 |
| 283 | Ga0207640_10232213 | 3300025981 | Bacteria | 1420 |
| 284 | Ga0207677_10013536 | 3300026023 | Bacteria | 4732 |
| 285 | Ga0207639_10000673 | 3300026041 | Bacteria | 23595 |
| 286 | Ga0207678_10003802 | 3300026067 | Bacteria | 13577 |
| 287 | Ga0207678_10428988 | 3300026067 | Bacteria | 1147 |
| 288 | Ga0207708_10034237 | 3300026075 | Bacteria | 3863 |
| 289 | Ga0207708_10333409 | 3300026075 | Bacteria | 1241 |
| 290 | Ga0207702_10001254 | 3300026078 | Bacteria | 25608 |
| 291 | Ga0207648_10003252 | 3300026089 | Bacteria | 17090 |
| 292 | Ga0207648_10336460 | 3300026089 | Bacteria | 1359 |
| 293 | Ga0207676_10042550 | 3300026095 | Bacteria | 3494 |
| 294 | Ga0207674_10000836 | 3300026116 | Bacteria | 40167 |
| 295 | Ga0207674_10009144 | 3300026116 | Bacteria | 11363 |
| 296 | Ga0207675_100007334 | 3300026118 | Bacteria | 10417 |
| 297 | Ga0207675_100399613 | 3300026118 | Bacteria | 1354 |
| 298 | Ga0207698_10044174 | 3300026142 | Bacteria | 3346 |
| 299 | Ga0209969_1006370 | 3300027360 | Bacteria | 1662 |
| 300 | Ga0209967_1015516 | 3300027364 | Bacteria | 1090 |
| 301 | Ga0209996_1005890 | 3300027395 | Bacteria | 1574 |
| 302 | Ga0209984_1060819 | 3300027424 | Bacteria | 559 |
| 303 | Ga0209995_1001622 | 3300027471 | Bacteria | 3495 |
| 304 | Ga0209999_1047109 | 3300027543 | Bacteria | 812 |
| 305 | Ga0209982_1005033 | 3300027552 | Bacteria | 1906 |
| 306 | Ga0210002_1011346 | 3300027617 | Bacteria | 1376 |
| 307 | Ga0209983_1005137 | 3300027665 | Bacteria | 2722 |
| 308 | Ga0209588_1008161 | 3300027671 | Bacteria | 3100 |
| 309 | Ga0209971_1000060 | 3300027682 | Bacteria | 34835 |
| 310 | Ga0209966_1000312 | 3300027695 | Bacteria | 15867 |
| 311 | Ga0209998_10000006 | 3300027717 | Bacteria | 101038 |
| 312 | Ga0209974_10006984 | 3300027876 | Bacteria | 3908 |
| 313 | Ga0209974_10094618 | 3300027876 | Bacteria | 1039 |
| 314 | Ga0207428_10003162 | 3300027907 | Bacteria | 16133 |
| 315 | Ga0268265_10002892 | 3300028380 | Bacteria | 12614 |
| 316 | Ga0268265_10014365 | 3300028380 | Bacteria | 5394 |
| 317 | Ga0268265_10032541 | 3300028380 | Bacteria | 3781 |
| 318 | Ga0268265_10230034 | 3300028380 | Bacteria | 1629 |
| 319 | Ga0268264_10091495 | 3300028381 | Bacteria | 2624 |
| 320 | Ga0268264_10125040 | 3300028381 | Bacteria | 2272 |
| 321 | Ga0307408_100126830 | 3300031548 | Bacteria | 1986 |
| 322 | Ga0307408_100368521 | 3300031548 | Bacteria | 1224 |
| 323 | Ga0307408_101677178 | 3300031548 | Bacteria | 605 |
| 324 | Ga0307405_10294654 | 3300031731 | Bacteria | 1228 |
| 325 | Ga0307405_10704157 | 3300031731 | Bacteria | 837 |
| 326 | Ga0307405_11084089 | 3300031731 | Bacteria | 687 |
| 327 | Ga0307410_10192193 | 3300031852 | Bacteria | 1553 |
| 328 | Ga0307407_10440465 | 3300031903 | Bacteria | 943 |
| 329 | Ga0307409_100208349 | 3300031995 | Bacteria | 1755 |
| 330 | Ga0307409_100263467 | 3300031995 | Bacteria | 1583 |
| 331 | Ga0307416_100488701 | 3300032002 | Bacteria | 1293 |
| 332 | Ga0307414_11031382 | 3300032004 | Bacteria | 758 |
| 333 | Ga0307414_11086952 | 3300032004 | Bacteria | 738 |
| 334 | Ga0307411_10403184 | 3300032005 | Bacteria | 1131 |
| 335 | Ga0373958_0063145 | 3300034819 | Bacteria | 807 |
| 336 | Ga0373926_0029359 | 3300035083 | Bacteria | 1933 |
| 337 | Ga0373928_0263328 | 3300035084 | Bacteria | 517 |
| 338 | Ga0373940_0001445 | 3300035088 | Bacteria | 4300 |
| 339 | Ga0373949_0137207 | 3300035090 | Bacteria | 698 |
| 340 | Ga0373951_0026697 | 3300035091 | Bacteria | 1346 |
| 341 | Ga0373952_0169007 | 3300035092 | Bacteria | 624 |
| 342 | Ga0373923_0026197 | 3300035111 | Bacteria | 2318 |
| 343 | Ga0373932_0043535 | 3300035112 | Bacteria | 1306 |
| 344 | Ga0373932_0418697 | 3300035112 | Bacteria | 521 |
| 345 | Ga0373936_0431355 | 3300035113 | Unclassified | 608 |
| 346 | Ga0373941_0138085 | 3300035115 | Bacteria | 884 |
| 347 | Ga0373953_0178699 | 3300035117 | Bacteria | 915 |
| 348 | Ga0373954_0036560 | 3300035118 | Unclassified | 2280 |
| 349 | Ga0373956_0371313 | 3300035119 | Unclassified | 682 |
| 350 | Ga0373960_0385094 | 3300035121 | Bacteria | 538 |
| 351 | Ga0373961_0092475 | 3300035241 | Bacteria | 968 |
| 352 | Ga0373962_0017064 | 3300035242 | Bacteria | 1879 |
| 353 | Ga0373931_0009986 | 3300035691 | Bacteria | 4552 |
| 354 | Ga0373931_0338479 | 3300035691 | Bacteria | 939 |
| 355 | Ga0373931_0649534 | 3300035691 | Bacteria | 693 |
| 356 | Ga0373927_0002662 | 3300035695 | Bacteria | 13015 |
| 357 | Ga0373947_0094567 | 3300035725 | Bacteria | 1869 |
| 358 | Ga0373937_0107616 | 3300036401 | Bacteria | 2592 |
| 359 | Ga0316582_1170762 | 3300036647 | Bacteria | 523 |
| 360 | Ga0373925_0335570 | 3300037068 | Bacteria | 1225 |
| 361 | Ga0242420_016627 | 3300038996 | Bacteria | 1283 |
| 362 | Ga0242420_049629 | 3300038996 | Bacteria | 818 |
| 363 | Ga0242420_080854 | 3300038996 | Bacteria | 671 |
| 364 | Ga0439441_067715 | 3300042001 | Bacteria | 761 |
| 365 | Ga0439448_0003529 | 3300042005 | Bacteria | 4339 |
| 366 | Ga0450919_014539 | 3300042121 | Bacteria | 889 |
| 367 | Ga0450902_018119 | 3300042137 | Bacteria | 1153 |
| 368 | Ga0439458_0155110 | 3300042157 | Bacteria | 615 |
| 369 | Ga0439459_0001209 | 3300042438 | Bacteria | 3772 |
| 370 | Ga0439464_0006796 | 3300042439 | Bacteria | 2983 |
| 371 | Ga0439460_0011704 | 3300042461 | Bacteria | 2266 |
| 372 | Ga0450893_0069739 | 3300042532 | Bacteria | 682 |
| 373 | Ga0451577_0001849 | 3300042876 | Bacteria | 26989 |
| 374 | Ga0451577_0006203 | 3300042876 | Bacteria | 11993 |
| 375 | Ga0451577_0045895 | 3300042876 | Bacteria | 3910 |
| 376 | Ga0451577_0284671 | 3300042876 | Bacteria | 1498 |
| 377 | Ga0451577_1208841 | 3300042876 | Bacteria | 674 |
| 378 | Ga0451577_1344837 | 3300042876 | Bacteria | 634 |
| 379 | Ga0453683_0016419 | 3300044673 | Bacteria | 4777 |
| 380 | Ga0453683_0045587 | 3300044673 | Bacteria | 2749 |
| 381 | Ga0453683_0056973 | 3300044673 | Bacteria | 2445 |
| 382 | Ga0453683_0355306 | 3300044673 | Bacteria | 942 |
| 383 | Ga0453684_0023282 | 3300044712 | Bacteria | 9134 |
| 384 | Ga0453684_0054480 | 3300044712 | Bacteria | 5209 |
| 385 | Ga0453684_0554652 | 3300044712 | Bacteria | 1265 |
| 386 | Ga0466960_0003069 | 3300044901 | Bacteria | 6383 |
| 387 | Ga0451576_0024592 | 3300045051 | Bacteria | 6504 |
| 388 | Ga0451576_0028962 | 3300045051 | Bacteria | 5930 |
| 389 | Ga0451576_0048881 | 3300045051 | Bacteria | 4440 |
| 390 | Ga0451576_0113182 | 3300045051 | Bacteria | 2824 |
| 391 | Ga0451576_0224813 | 3300045051 | Bacteria | 1960 |
| 392 | Ga0451576_1437401 | 3300045051 | Bacteria | 717 |
| 393 | Ga0495580_0014168 | 3300046472 | Bacteria | 6055 |
| 394 | Ga0495580_0111626 | 3300046472 | Bacteria | 1899 |
| 395 | Ga0495580_0362882 | 3300046472 | Bacteria | 980 |
| 396 | Ga0495580_0748528 | 3300046472 | Bacteria | 637 |
| 397 | Ga0495639_0142212 | 3300046475 | Bacteria | 1154 |
| 398 | Ga0495664_0422638 | 3300046477 | Unclassified | 799 |
| 399 | Ga0495584_0288423 | 3300046491 | Bacteria | 834 |
| 400 | Ga0495665_0024426 | 3300046531 | Bacteria | 3247 |
| 401 | Ga0495645_0467641 | 3300046543 | Unclassified | 793 |
| 402 | Ga0495667_0639261 | 3300046559 | Unclassified | 661 |
| 403 | Ga0495634_0617555 | 3300046642 | Unclassified | 628 |
| 404 | Ga0495635_0245388 | 3300046663 | Bacteria | 1208 |
| 405 | Ga0495659_0191122 | 3300046664 | Bacteria | 837 |
| 406 | Ga0495674_0197269 | 3300047319 | Bacteria | 1671 |
| 407 | Ga0495675_0300134 | 3300047444 | Unclassified | 954 |
| 408 | Ga0495684_0141424 | 3300047471 | Bacteria | 1804 |
| 409 | Ga0496102_0010781 | 3300048905 | Bacteria | 7871 |
| 410 | Ga0496107_0670324 | 3300048910 | Bacteria | 764 |
| 411 | Ga0496108_1234191 | 3300048911 | Bacteria | 631 |
| 412 | Ga0496110_1542235 | 3300048913 | Bacteria | 574 |
| 413 | Ga0496112_0170862 | 3300048915 | Bacteria | 2139 |
| 414 | Ga0501292_103270 | 3300049515 | Bacteria | 567 |
| 415 | Ga0501299_159711 | 3300049522 | Bacteria | 575 |
| 416 | Ga0501031_0005375 | 3300049568 | Bacteria | 8342 |
| 417 | Ga0501031_0101748 | 3300049568 | Bacteria | 1875 |
| 418 | Ga0501031_0146869 | 3300049568 | Bacteria | 1541 |
| 419 | Ga0501031_0341284 | 3300049568 | Bacteria | 970 |
| 420 | Ga0501032_0850245 | 3300049569 | Bacteria | 575 |
| 421 | Ga0501033_0005375 | 3300049570 | Bacteria | 10150 |
| 422 | Ga0501033_0031121 | 3300049570 | Bacteria | 4012 |
| 423 | Ga0501033_0149654 | 3300049570 | Bacteria | 1685 |
| 424 | Ga0501033_1014260 | 3300049570 | Bacteria | 554 |
| 425 | Ga0501034_0234985 | 3300049571 | Unclassified | 1781 |
| 426 | Ga0501036_0000146 | 3300049572 | Bacteria | 46028 |
| 427 | Ga0501036_0101892 | 3300049572 | Bacteria | 2429 |
| 428 | Ga0501036_0189248 | 3300049572 | Bacteria | 1732 |
| 429 | Ga0501036_0422683 | 3300049572 | Bacteria | 1111 |
| 430 | Ga0501036_0464140 | 3300049572 | Bacteria | 1054 |
| 431 | Ga0501036_0498789 | 3300049572 | Bacteria | 1013 |
| 432 | Ga0501037_0010082 | 3300049573 | Bacteria | 6932 |
| 433 | Ga0501037_0038927 | 3300049573 | Bacteria | 3502 |
| 434 | Ga0501038_0000983 | 3300049574 | Bacteria | 25585 |
| 435 | Ga0501038_0118241 | 3300049574 | Bacteria | 2189 |
| 436 | Ga0501039_0000223 | 3300049575 | Bacteria | 41655 |
| 437 | Ga0501039_0025015 | 3300049575 | Bacteria | 4585 |
| 438 | Ga0501039_0251693 | 3300049575 | Bacteria | 1389 |
| 439 | Ga0501039_0266358 | 3300049575 | Bacteria | 1347 |
| 440 | Ga0501040_0000373 | 3300049576 | Bacteria | 26428 |
| 441 | Ga0501040_0001289 | 3300049576 | Bacteria | 15954 |
| 442 | Ga0501040_0150913 | 3300049576 | Bacteria | 1639 |
| 443 | Ga0501040_0173671 | 3300049576 | Bacteria | 1526 |
| 444 | Ga0501040_0219686 | 3300049576 | Bacteria | 1352 |
| 445 | Ga0501040_0490831 | 3300049576 | Bacteria | 885 |
| 446 | Ga0501040_0674163 | 3300049576 | Bacteria | 747 |
| 447 | Ga0501041_0000014 | 3300049577 | Bacteria | 57214 |
| 448 | Ga0501041_0002902 | 3300049577 | Bacteria | 9823 |
| 449 | Ga0501041_0006533 | 3300049577 | Bacteria | 6829 |
| 450 | Ga0501041_0063689 | 3300049577 | Bacteria | 2258 |
| 451 | Ga0501041_0163382 | 3300049577 | Bacteria | 1392 |
| 452 | Ga0501042_0000029 | 3300049578 | Bacteria | 46395 |
| 453 | Ga0501042_0003204 | 3300049578 | Bacteria | 10226 |
| 454 | Ga0501042_0022065 | 3300049578 | Bacteria | 4444 |
| 455 | Ga0501042_0198126 | 3300049578 | Bacteria | 1448 |
| 456 | Ga0501042_0201451 | 3300049578 | Bacteria | 1435 |
| 457 | Ga0501042_0648134 | 3300049578 | Bacteria | 768 |
| 458 | Ga0501042_0722615 | 3300049578 | Bacteria | 724 |
| 459 | Ga0501043_0009232 | 3300049579 | Bacteria | 7750 |
| 460 | Ga0501043_0046014 | 3300049579 | Bacteria | 3431 |
| 461 | Ga0501043_0814201 | 3300049579 | Bacteria | 675 |
| 462 | Ga0501043_0844840 | 3300049579 | Bacteria | 660 |
| 463 | Ga0501046_0000544 | 3300049580 | Bacteria | 37450 |
| 464 | Ga0501046_0001711 | 3300049580 | Bacteria | 20954 |
| 465 | Ga0501046_0086321 | 3300049580 | Bacteria | 2419 |
| 466 | Ga0501047_0063964 | 3300049581 | Bacteria | 3549 |
| 467 | Ga0501048_0000167 | 3300049582 | Bacteria | 41216 |
| 468 | Ga0501048_0004989 | 3300049582 | Bacteria | 10122 |
| 469 | Ga0501048_1125911 | 3300049582 | Bacteria | 565 |
| 470 | Ga0501048_1143711 | 3300049582 | Bacteria | 560 |
| 471 | Ga0501068_0011732 | 3300049584 | Bacteria | 4955 |
| 472 | Ga0501068_0229756 | 3300049584 | Bacteria | 1180 |
| 473 | Ga0501068_0408836 | 3300049584 | Bacteria | 875 |
| 474 | Ga0501069_0012731 | 3300049585 | Bacteria | 4478 |
| 475 | Ga0501069_0206461 | 3300049585 | Bacteria | 1139 |
| 476 | Ga0501069_0951347 | 3300049585 | Bacteria | 524 |
| 477 | Ga0501070_0013294 | 3300049586 | Bacteria | 6942 |
| 478 | Ga0501070_0205809 | 3300049586 | Bacteria | 1616 |
| 479 | Ga0501071_0000123 | 3300049587 | Bacteria | 31110 |
| 480 | Ga0501071_0053860 | 3300049587 | Bacteria | 2902 |
| 481 | Ga0501071_0082326 | 3300049587 | Bacteria | 2357 |
| 482 | Ga0501071_0109461 | 3300049587 | Bacteria | 2041 |
| 483 | Ga0501071_0189175 | 3300049587 | Bacteria | 1543 |
| 484 | Ga0501071_0199218 | 3300049587 | Bacteria | 1504 |
| 485 | Ga0501071_0223076 | 3300049587 | Bacteria | 1419 |
| 486 | Ga0501071_0394029 | 3300049587 | Bacteria | 1057 |
| 487 | Ga0501071_0870074 | 3300049587 | Bacteria | 695 |
| 488 | Ga0501072_0000091 | 3300049588 | Bacteria | 65812 |
| 489 | Ga0501072_0035233 | 3300049588 | Bacteria | 3923 |
| 490 | Ga0501072_0074417 | 3300049588 | Bacteria | 2686 |
| 491 | Ga0501072_0093129 | 3300049588 | Bacteria | 2393 |
| 492 | Ga0501072_0129735 | 3300049588 | Bacteria | 2009 |
| 493 | Ga0501072_0288655 | 3300049588 | Bacteria | 1304 |
| 494 | Ga0501072_0624117 | 3300049588 | Bacteria | 849 |
| 495 | Ga0501073_0006844 | 3300049589 | Bacteria | 8477 |
| 496 | Ga0501074_0005032 | 3300049590 | Bacteria | 9485 |
| 497 | Ga0501074_0006054 | 3300049590 | Bacteria | 8730 |
| 498 | Ga0501074_0358818 | 3300049590 | Bacteria | 1034 |
| 499 | Ga0501074_0466311 | 3300049590 | Bacteria | 895 |
| 500 | Ga0501075_0000005 | 3300049591 | Bacteria | 112003 |
| 501 | Ga0501075_0006543 | 3300049591 | Bacteria | 8025 |
| 502 | Ga0501075_0021176 | 3300049591 | Bacteria | 4738 |
| 503 | Ga0501075_0066538 | 3300049591 | Bacteria | 2719 |
| 504 | Ga0501075_0206365 | 3300049591 | Bacteria | 1499 |
| 505 | Ga0501075_0374383 | 3300049591 | Bacteria | 1085 |
| 506 | Ga0501076_0000024 | 3300049592 | Bacteria | 78719 |
| 507 | Ga0501076_0027512 | 3300049592 | Bacteria | 4409 |
| 508 | Ga0501076_0049743 | 3300049592 | Bacteria | 3316 |
| 509 | Ga0501076_0060399 | 3300049592 | Bacteria | 3016 |
| 510 | Ga0501076_0063233 | 3300049592 | Bacteria | 2949 |
| 511 | Ga0501076_0231554 | 3300049592 | Bacteria | 1510 |
| 512 | Ga0501076_0340278 | 3300049592 | Bacteria | 1231 |
| 513 | Ga0501077_0000025 | 3300049593 | Bacteria | 76265 |
| 514 | Ga0501077_0061153 | 3300049593 | Bacteria | 2390 |
| 515 | Ga0501077_0104695 | 3300049593 | Bacteria | 1793 |
| 516 | Ga0501077_0282172 | 3300049593 | Bacteria | 1057 |
| 517 | Ga0501077_0331787 | 3300049593 | Bacteria | 970 |
| 518 | Ga0501225_0336962 | 3300049705 | Bacteria | 519 |
| 519 | Ga0501079_0000025 | 3300049741 | Bacteria | 62163 |
| 520 | Ga0501079_0000760 | 3300049741 | Bacteria | 21994 |
| 521 | Ga0501079_0008890 | 3300049741 | Bacteria | 7605 |
| 522 | Ga0501079_0105145 | 3300049741 | Bacteria | 2190 |
| 523 | Ga0501079_0141205 | 3300049741 | Bacteria | 1876 |
| 524 | Ga0501079_0273270 | 3300049741 | Bacteria | 1321 |
| 525 | Ga0501079_0367151 | 3300049741 | Bacteria | 1128 |
| 526 | Ga0501079_0645702 | 3300049741 | Bacteria | 833 |
| 527 | Ga0501079_0702303 | 3300049741 | Bacteria | 796 |
| 528 | Ga0501079_0981790 | 3300049741 | Bacteria | 665 |
| 529 | Ga0501080_0001141 | 3300049742 | Bacteria | 21887 |
| 530 | Ga0501080_0633180 | 3300049742 | Bacteria | 947 |
| 531 | Ga0501080_1223150 | 3300049742 | Bacteria | 645 |
| 532 | Ga0501081_0000007 | 3300049743 | Bacteria | 73600 |
| 533 | Ga0501081_0019125 | 3300049743 | Bacteria | 4556 |
| 534 | Ga0501081_0020663 | 3300049743 | Bacteria | 4390 |
| 535 | Ga0501081_0057687 | 3300049743 | Bacteria | 2685 |
| 536 | Ga0501081_0087750 | 3300049743 | Bacteria | 2185 |
| 537 | Ga0501081_0248486 | 3300049743 | Bacteria | 1298 |
| 538 | Ga0501081_0297579 | 3300049743 | Bacteria | 1183 |
| 539 | Ga0501081_0310626 | 3300049743 | Bacteria | 1157 |
| 540 | Ga0501081_0352133 | 3300049743 | Bacteria | 1085 |
| 541 | Ga0501081_0889834 | 3300049743 | Bacteria | 671 |
| 542 | Ga0501083_0011123 | 3300049744 | Bacteria | 6318 |
| 543 | Ga0501083_0198248 | 3300049744 | Bacteria | 1310 |
| 544 | Ga0501083_0723727 | 3300049744 | Bacteria | 647 |
| 545 | Ga0501035_0002582 | 3300049822 | Bacteria | 17689 |
| 546 | Ga0501044_0892185 | 3300049823 | Archaea | 764 |
| 547 | Ga0501044_1263924 | 3300049823 | Bacteria | 605 |
| 548 | Ga0501045_0000003 | 3300049824 | Bacteria | 88725 |
| 549 | Ga0501045_0000717 | 3300049824 | Bacteria | 21085 |
| 550 | Ga0501045_0032051 | 3300049824 | Bacteria | 3807 |
| 551 | Ga0501045_0151748 | 3300049824 | Bacteria | 1724 |
| 552 | Ga0501045_0298344 | 3300049824 | Bacteria | 1199 |
| 553 | nmdc:mga05p37_213226_c1 | 3300050507 | Bacteria | 2333 |
| 554 | nmdc:mga05p37_219186_c1 | 3300050507 | Bacteria | 2297 |
| 555 | nmdc:mga05p37_30934_c1 | 3300050507 | Bacteria | 6535 |
| 556 | nmdc:mga05p37_372580_c1 | 3300050507 | Bacteria | 1675 |
| 557 | nmdc:mga05p37_37320_c1 | 3300050507 | Bacteria | 5957 |
| 558 | nmdc:mga05p37_506035_c1 | 3300050507 | Bacteria | 1385 |
| 559 | nmdc:mga05p37_6819_c1 | 3300050507 | Bacteria | 13458 |
| 560 | nmdc:mga05p37_7414_c1 | 3300050507 | Bacteria | 12942 |
| 561 | nmdc:mga09592_10601_c1 | 3300050508 | Bacteria | 7504 |
| 562 | nmdc:mga09592_163585_c1 | 3300050508 | Bacteria | 1923 |
| 563 | nmdc:mga09592_648166_c1 | 3300050508 | Bacteria | 902 |
| 564 | nmdc:mga0qj67_180393_c1 | 3300050509 | Bacteria | 1715 |
| 565 | nmdc:mga0qj67_478812_c1 | 3300050509 | Bacteria | 1002 |
| 566 | nmdc:mga06r32_194954_c1 | 3300050510 | Bacteria | 2013 |
| 567 | nmdc:mga06r32_381000_c1 | 3300050510 | Bacteria | 1393 |
| 568 | nmdc:mga06r32_44114_c1 | 3300050510 | Bacteria | 4245 |
| 569 | nmdc:mga06r32_44537_c1 | 3300050510 | Bacteria | 4226 |
| 570 | nmdc:mga06r32_543614_c1 | 3300050510 | Bacteria | 1136 |
| 571 | nmdc:mga08y16_2190_c1 | 3300050511 | Bacteria | 20049 |
| 572 | nmdc:mga0n895_1127572_c1 | 3300050512 | Bacteria | 761 |
| 573 | nmdc:mga0n895_17203_c1 | 3300050512 | Bacteria | 6662 |
| 574 | nmdc:mga0n895_2180639_c1 | 3300050512 | Bacteria | 510 |
| 575 | nmdc:mga0n895_232505_c1 | 3300050512 | Bacteria | 1871 |
| 576 | nmdc:mga0n895_295787_c1 | 3300050512 | Bacteria | 1641 |
| 577 | nmdc:mga0n895_39410_c1 | 3300050512 | Bacteria | 4584 |
| 578 | nmdc:mga0n895_628725_c1 | 3300050512 | Bacteria | 1074 |
| 579 | nmdc:mga0n895_678508_c1 | 3300050512 | Bacteria | 1027 |
| 580 | nmdc:mga0n895_855732_c1 | 3300050512 | Bacteria | 897 |
| 581 | nmdc:mga0rr50_10901_c1 | 3300050513 | Bacteria | 5796 |
| 582 | nmdc:mga0rr50_15502_c1 | 3300050513 | Bacteria | 5033 |
| 583 | nmdc:mga0rr50_471419_c1 | 3300050513 | Unclassified | 1066 |
| 584 | nmdc:mga0rr50_58883_c1 | 3300050513 | Bacteria | 2881 |
| 585 | nmdc:mga08x19_1162248_c1 | 3300050514 | Bacteria | 547 |
| 586 | nmdc:mga08x19_677641_c1 | 3300050514 | Bacteria | 732 |
| 587 | nmdc:mga08x19_78596_c1 | 3300050514 | Bacteria | 2163 |
| 588 | nmdc:mga0a205_1779_c1 | 3300050515 | Bacteria | 18627 |
| 589 | nmdc:mga0a205_182435_c2 | 3300050515 | Bacteria | 1357 |
| 590 | nmdc:mga0a205_262615_c1 | 3300050515 | Bacteria | 1604 |
| 591 | nmdc:mga0a205_5773_c1 | 3300050515 | Bacteria | 11158 |
| 592 | nmdc:mga0a205_653556_c1 | 3300050515 | Bacteria | 903 |
| 593 | nmdc:mga0a205_740416_c1 | 3300050515 | Bacteria | 832 |
| 594 | nmdc:mga0a205_8715_c1 | 3300050515 | Bacteria | 9238 |
| 595 | Ga0501084_0000398 | 3300054114 | Bacteria | 33453 |
| 596 | Ga0501084_0002865 | 3300054114 | Bacteria | 13943 |
| 597 | Ga0501084_0030896 | 3300054114 | Bacteria | 4478 |
| 598 | Ga0501084_0663789 | 3300054114 | Bacteria | 880 |
| 599 | Ga0590071_027846 | 3300059421 | Bacteria | 1342 |
| 600 | Ga0590077_068774 | 3300059426 | Bacteria | 807 |
| 601 | Ga0501082_0000062 | 3300060353 | Bacteria | 77313 |
| 602 | Ga0501082_0015483 | 3300060353 | Bacteria | 6564 |
| 603 | Ga0501082_0024763 | 3300060353 | Bacteria | 5174 |
| 604 | Ga0501082_0046990 | 3300060353 | Bacteria | 3720 |
| 605 | Ga0501082_0056125 | 3300060353 | Bacteria | 3392 |
| 606 | Ga0501082_0129223 | 3300060353 | Bacteria | 2192 |
| 607 | Ga0501082_0246933 | 3300060353 | Bacteria | 1553 |
| 608 | Ga0501082_1135048 | 3300060353 | Bacteria | 683 |
| 609 | Ga0501082_1441947 | 3300060353 | Bacteria | 601 |
| 610 | Ga0530510_0000062 | 3300061734 | Bacteria | 52768 |
| 611 | Ga0530510_0004377 | 3300061734 | Bacteria | 9774 |
| 612 | Ga0530510_0009989 | 3300061734 | Bacteria | 6659 |
| 613 | Ga0530510_0014717 | 3300061734 | Bacteria | 5523 |
| 614 | Ga0530510_0026226 | 3300061734 | Bacteria | 4169 |
| 615 | Ga0530510_0188734 | 3300061734 | Bacteria | 1530 |
| 616 | Ga0530510_0209667 | 3300061734 | Bacteria | 1448 |
| 617 | Ga0530510_0457301 | 3300061734 | Bacteria | 965 |
| 618 | Ga0530510_0579831 | 3300061734 | Bacteria | 853 |
| 619 | Ga0530510_1004391 | 3300061734 | Bacteria | 638 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10005953 | Ga0207665_100059532 | 123 |
| 2 | 3300006871 | Ga0075434_100029618 | Ga0075434_1000296183 | 132 |
| 3 | 3300007076 | Ga0075435_100071470 | Ga0075435_1000714702 | 132 |
| 4 | 3300009147 | Ga0114129_10125672 | Ga0114129_101256725 | 132 |
| 5 | 3300049576 | Ga0501040_0150913 | Ga0501040_0150913_953_1360 | 132 |
| 6 | 3300005518 | Ga0070699_100160585 | Ga0070699_1001605851 | 133 |
| 7 | 3300005546 | Ga0070696_100200714 | Ga0070696_1002007142 | 133 |
| 8 | 3300025927 | Ga0207687_10215023 | Ga0207687_102150232 | 133 |
| 9 | 3300046664 | Ga0495659_0191122 | Ga0495659_0191122_154_561 | 133 |
| 10 | 3300049587 | Ga0501071_0223076 | Ga0501071_0223076_106_510 | 133 |
| 11 | 3300005336 | Ga0070680_100133404 | Ga0070680_1001334042 | 134 |
| 12 | 3300005341 | Ga0070691_10004798 | Ga0070691_100047982 | 134 |
| 13 | 3300005438 | Ga0070701_10061719 | Ga0070701_100617192 | 134 |
| 14 | 3300005438 | Ga0070701_10279822 | Ga0070701_102798221 | 134 |
| 15 | 3300005441 | Ga0070700_100020317 | Ga0070700_1000203173 | 134 |
| 16 | 3300005444 | Ga0070694_100092985 | Ga0070694_1000929852 | 134 |
| 17 | 3300005445 | Ga0070708_100056325 | Ga0070708_1000563253 | 134 |
| 18 | 3300005445 | Ga0070708_100235322 | Ga0070708_1002353222 | 134 |
| 19 | 3300005459 | Ga0068867_100010785 | Ga0068867_1000107852 | 134 |
| 20 | 3300005467 | Ga0070706_100427321 | Ga0070706_1004273211 | 134 |
| 21 | 3300005468 | Ga0070707_101406691 | Ga0070707_1014066912 | 134 |
| 22 | 3300005471 | Ga0070698_100651291 | Ga0070698_1006512912 | 134 |
| 23 | 3300005518 | Ga0070699_100115835 | Ga0070699_1001158352 | 134 |
| 24 | 3300005518 | Ga0070699_100702458 | Ga0070699_1007024581 | 134 |
| 25 | 3300005536 | Ga0070697_100119316 | Ga0070697_1001193161 | 134 |
| 26 | 3300005536 | Ga0070697_100435331 | Ga0070697_1004353312 | 134 |
| 27 | 3300005546 | Ga0070696_100482067 | Ga0070696_1004820672 | 134 |
| 28 | 3300005577 | Ga0068857_100001797 | Ga0068857_1000017978 | 134 |
| 29 | 3300005578 | Ga0068854_100859549 | Ga0068854_1008595492 | 134 |
| 30 | 3300005615 | Ga0070702_100194263 | Ga0070702_1001942632 | 134 |
| 31 | 3300005617 | Ga0068859_100565819 | Ga0068859_1005658192 | 134 |
| 32 | 3300005718 | Ga0068866_10099127 | Ga0068866_100991272 | 134 |
| 33 | 3300005840 | Ga0068870_10026265 | Ga0068870_100262652 | 134 |
| 34 | 3300005844 | Ga0068862_100186520 | Ga0068862_1001865202 | 134 |
| 35 | 3300006847 | Ga0075431_100605948 | Ga0075431_1006059482 | 134 |
| 36 | 3300006931 | Ga0097620_100565730 | Ga0097620_1005657302 | 134 |
| 37 | 3300007265 | Ga0099794_10012752 | Ga0099794_100127522 | 134 |
| 38 | 3300009098 | Ga0105245_10134667 | Ga0105245_101346672 | 134 |
| 39 | 3300009148 | Ga0105243_10162738 | Ga0105243_101627381 | 134 |
| 40 | 3300009176 | Ga0105242_10035280 | Ga0105242_100352802 | 134 |
| 41 | 3300009553 | Ga0105249_10051030 | Ga0105249_100510302 | 134 |
| 42 | 3300011119 | Ga0105246_10443660 | Ga0105246_104436602 | 134 |
| 43 | 3300025899 | Ga0207642_10139083 | Ga0207642_101390832 | 134 |
| 44 | 3300025917 | Ga0207660_10081436 | Ga0207660_100814362 | 134 |
| 45 | 3300025933 | Ga0207706_10259629 | Ga0207706_102596291 | 134 |
| 46 | 3300025934 | Ga0207686_10327696 | Ga0207686_103276962 | 134 |
| 47 | 3300025942 | Ga0207689_10261093 | Ga0207689_102610932 | 134 |
| 48 | 3300026075 | Ga0207708_10034237 | Ga0207708_100342371 | 134 |
| 49 | 3300026116 | Ga0207674_10009144 | Ga0207674_100091442 | 134 |
| 50 | 3300026118 | Ga0207675_100399613 | Ga0207675_1003996132 | 134 |
| 51 | 3300027907 | Ga0207428_10003162 | Ga0207428_100031627 | 134 |
| 52 | 3300028380 | Ga0268265_10032541 | Ga0268265_100325412 | 134 |
| 53 | 3300028380 | Ga0268265_10230034 | Ga0268265_102300342 | 134 |
| 54 | 3300028381 | Ga0268264_10125040 | Ga0268264_101250402 | 134 |
| 55 | 3300031548 | Ga0307408_100126830 | Ga0307408_1001268302 | 134 |
| 56 | 3300031548 | Ga0307408_100368521 | Ga0307408_1003685213 | 134 |
| 57 | 3300031548 | Ga0307408_101677178 | Ga0307408_1016771782 | 134 |
| 58 | 3300031731 | Ga0307405_10294654 | Ga0307405_102946542 | 134 |
| 59 | 3300031731 | Ga0307405_11084089 | Ga0307405_110840891 | 134 |
| 60 | 3300031852 | Ga0307410_10192193 | Ga0307410_101921932 | 134 |
| 61 | 3300031903 | Ga0307407_10440465 | Ga0307407_104404652 | 134 |
| 62 | 3300031995 | Ga0307409_100263467 | Ga0307409_1002634672 | 134 |
| 63 | 3300032002 | Ga0307416_100488701 | Ga0307416_1004887012 | 134 |
| 64 | 3300032004 | Ga0307414_11086952 | Ga0307414_110869522 | 134 |
| 65 | 3300032005 | Ga0307411_10403184 | Ga0307411_104031842 | 134 |
| 66 | 3300035691 | Ga0373931_0649534 | Ga0373931_0649534_162_566 | 134 |
| 67 | 3300038996 | Ga0242420_016627 | Ga0242420_016627_735_1139 | 134 |
| 68 | 3300042001 | Ga0439441_067715 | Ga0439441_067715_266_670 | 134 |
| 69 | 3300042121 | Ga0450919_014539 | Ga0450919_014539_290_694 | 134 |
| 70 | 3300042876 | Ga0451577_0001849 | Ga0451577_0001849_8911_9315 | 134 |
| 71 | 3300042876 | Ga0451577_0284671 | Ga0451577_0284671_390_794 | 134 |
| 72 | 3300044673 | Ga0453683_0016419 | Ga0453683_0016419_2943_3347 | 134 |
| 73 | 3300044712 | Ga0453684_0023282 | Ga0453684_0023282_8271_8675 | 134 |
| 74 | 3300045051 | Ga0451576_0024592 | Ga0451576_0024592_5526_5930 | 134 |
| 75 | 3300049522 | Ga0501299_159711 | Ga0501299_159711_29_433 | 134 |
| 76 | 3300049578 | Ga0501042_0201451 | Ga0501042_0201451_755_1159 | 134 |
| 77 | 3300049579 | Ga0501043_0814201 | Ga0501043_0814201_77_484 | 134 |
| 78 | 3300049587 | Ga0501071_0870074 | Ga0501071_0870074_272_676 | 134 |
| 79 | 3300049588 | Ga0501072_0624117 | Ga0501072_0624117_166_573 | 134 |
| 80 | 3300049591 | Ga0501075_0206365 | Ga0501075_0206365_355_762 | 134 |
| 81 | 3300049705 | Ga0501225_0336962 | Ga0501225_0336962_78_482 | 134 |
| 82 | 3300049741 | Ga0501079_0141205 | Ga0501079_0141205_318_725 | 134 |
| 83 | 3300049742 | Ga0501080_1223150 | Ga0501080_1223150_198_605 | 134 |
| 84 | 3300050508 | nmdc:mga09592_163585_c1 | nmdc:mga09592_163585_c1_402_821 | 134 |
| 85 | 3300050510 | nmdc:mga06r32_543614_c1 | nmdc:mga06r32_543614_c1_317_721 | 134 |
| 86 | 3300050511 | nmdc:mga08y16_2190_c1 | nmdc:mga08y16_2190_c1_8452_8856 | 134 |
| 87 | 3300050512 | nmdc:mga0n895_17203_c1 | nmdc:mga0n895_17203_c1_2105_2509 | 134 |
| 88 | 3300050512 | nmdc:mga0n895_232505_c1 | nmdc:mga0n895_232505_c1_116_520 | 134 |
| 89 | 3300050513 | nmdc:mga0rr50_58883_c1 | nmdc:mga0rr50_58883_c1_592_996 | 134 |
| 90 | 3300050515 | nmdc:mga0a205_1779_c1 | nmdc:mga0a205_1779_c1_6605_7009 | 134 |
| 91 | 3300050515 | nmdc:mga0a205_5773_c1 | nmdc:mga0a205_5773_c1_7993_8397 | 134 |
| 92 | 3300005340 | Ga0070689_100434135 | Ga0070689_1004341352 | 135 |
| 93 | 3300005341 | Ga0070691_10709308 | Ga0070691_107093081 | 135 |
| 94 | 3300005444 | Ga0070694_100514161 | Ga0070694_1005141612 | 135 |
| 95 | 3300005445 | Ga0070708_100011090 | Ga0070708_1000110907 | 135 |
| 96 | 3300005455 | Ga0070663_100990800 | Ga0070663_1009908001 | 135 |
| 97 | 3300005458 | Ga0070681_10504015 | Ga0070681_105040152 | 135 |
| 98 | 3300005518 | Ga0070699_100039547 | Ga0070699_1000395473 | 135 |
| 99 | 3300005536 | Ga0070697_100226327 | Ga0070697_1002263272 | 135 |
| 100 | 3300005545 | Ga0070695_100081344 | Ga0070695_1000813442 | 135 |
| 101 | 3300005617 | Ga0068859_100571901 | Ga0068859_1005719012 | 135 |
| 102 | 3300006844 | Ga0075428_100146981 | Ga0075428_1001469811 | 135 |
| 103 | 3300006846 | Ga0075430_100006024 | Ga0075430_1000060244 | 135 |
| 104 | 3300006846 | Ga0075430_100090703 | Ga0075430_1000907032 | 135 |
| 105 | 3300006846 | Ga0075430_100097971 | Ga0075430_1000979711 | 135 |
| 106 | 3300006847 | Ga0075431_100000545 | Ga0075431_10000054525 | 135 |
| 107 | 3300006847 | Ga0075431_100014658 | Ga0075431_1000146583 | 135 |
| 108 | 3300006847 | Ga0075431_100030037 | Ga0075431_1000300372 | 135 |
| 109 | 3300006847 | Ga0075431_100037960 | Ga0075431_1000379603 | 135 |
| 110 | 3300006852 | Ga0075433_10173881 | Ga0075433_101738812 | 135 |
| 111 | 3300006852 | Ga0075433_10422885 | Ga0075433_104228852 | 135 |
| 112 | 3300006871 | Ga0075434_100082923 | Ga0075434_1000829232 | 135 |
| 113 | 3300006871 | Ga0075434_100198110 | Ga0075434_1001981102 | 135 |
| 114 | 3300006871 | Ga0075434_100360388 | Ga0075434_1003603883 | 135 |
| 115 | 3300006871 | Ga0075434_100698760 | Ga0075434_1006987603 | 135 |
| 116 | 3300006871 | Ga0075434_100848119 | Ga0075434_1008481192 | 135 |
| 117 | 3300006880 | Ga0075429_100052876 | Ga0075429_1000528763 | 135 |
| 118 | 3300006880 | Ga0075429_100069650 | Ga0075429_1000696505 | 135 |
| 119 | 3300006880 | Ga0075429_100181208 | Ga0075429_1001812082 | 135 |
| 120 | 3300006914 | Ga0075436_100117044 | Ga0075436_1001170442 | 135 |
| 121 | 3300006931 | Ga0097620_100571910 | Ga0097620_1005719102 | 135 |
| 122 | 3300007076 | Ga0075435_100024469 | Ga0075435_1000244695 | 135 |
| 123 | 3300009147 | Ga0114129_10004541 | Ga0114129_1000454111 | 135 |
| 124 | 3300009147 | Ga0114129_10043463 | Ga0114129_100434633 | 135 |
| 125 | 3300009147 | Ga0114129_10169170 | Ga0114129_101691702 | 135 |
| 126 | 3300009147 | Ga0114129_10349763 | Ga0114129_103497632 | 135 |
| 127 | 3300009174 | Ga0105241_10780781 | Ga0105241_107807811 | 135 |
| 128 | 3300009553 | Ga0105249_12747594 | Ga0105249_127475942 | 135 |
| 129 | 3300013308 | Ga0157375_11546596 | Ga0157375_115465961 | 135 |
| 130 | 3300014326 | Ga0157380_10063627 | Ga0157380_100636272 | 135 |
| 131 | 3300014745 | Ga0157377_10694372 | Ga0157377_106943722 | 135 |
| 132 | 3300025912 | Ga0207707_10971359 | Ga0207707_109713592 | 135 |
| 133 | 3300025933 | Ga0207706_10035870 | Ga0207706_100358705 | 135 |
| 134 | 3300025933 | Ga0207706_10824759 | Ga0207706_108247591 | 135 |
| 135 | 3300025936 | Ga0207670_10392326 | Ga0207670_103923261 | 135 |
| 136 | 3300025961 | Ga0207712_10419101 | Ga0207712_104191011 | 135 |
| 137 | 3300026067 | Ga0207678_10428988 | Ga0207678_104289882 | 135 |
| 138 | 3300026075 | Ga0207708_10333409 | Ga0207708_103334092 | 135 |
| 139 | 3300027876 | Ga0209974_10094618 | Ga0209974_100946182 | 135 |
| 140 | 3300034819 | Ga0373958_0063145 | Ga0373958_0063145_216_623 | 135 |
| 141 | 3300035090 | Ga0373949_0137207 | Ga0373949_0137207_50_457 | 135 |
| 142 | 3300038996 | Ga0242420_049629 | Ga0242420_049629_252_659 | 135 |
| 143 | 3300042876 | Ga0451577_1208841 | Ga0451577_1208841_31_438 | 135 |
| 144 | 3300044901 | Ga0466960_0003069 | Ga0466960_0003069_148_561 | 135 |
| 145 | 3300045051 | Ga0451576_0113182 | Ga0451576_0113182_397_804 | 135 |
| 146 | 3300048910 | Ga0496107_0670324 | Ga0496107_0670324_201_608 | 135 |
| 147 | 3300049515 | Ga0501292_103270 | Ga0501292_103270_82_489 | 135 |
| 148 | 3300049568 | Ga0501031_0005375 | Ga0501031_0005375_4618_5025 | 135 |
| 149 | 3300049568 | Ga0501031_0146869 | Ga0501031_0146869_727_1137 | 135 |
| 150 | 3300049570 | Ga0501033_0005375 | Ga0501033_0005375_3227_3634 | 135 |
| 151 | 3300049570 | Ga0501033_1014260 | Ga0501033_1014260_29_439 | 135 |
| 152 | 3300049571 | Ga0501034_0234985 | Ga0501034_0234985_644_1051 | 135 |
| 153 | 3300049572 | Ga0501036_0000146 | Ga0501036_0000146_3998_4405 | 135 |
| 154 | 3300049572 | Ga0501036_0498789 | Ga0501036_0498789_317_727 | 135 |
| 155 | 3300049573 | Ga0501037_0010082 | Ga0501037_0010082_857_1264 | 135 |
| 156 | 3300049574 | Ga0501038_0000983 | Ga0501038_0000983_1052_1459 | 135 |
| 157 | 3300049575 | Ga0501039_0000223 | Ga0501039_0000223_9592_9999 | 135 |
| 158 | 3300049575 | Ga0501039_0251693 | Ga0501039_0251693_163_570 | 135 |
| 159 | 3300049576 | Ga0501040_0000373 | Ga0501040_0000373_17067_17474 | 135 |
| 160 | 3300049576 | Ga0501040_0490831 | Ga0501040_0490831_320_727 | 135 |
| 161 | 3300049577 | Ga0501041_0000014 | Ga0501041_0000014_40632_41039 | 135 |
| 162 | 3300049577 | Ga0501041_0006533 | Ga0501041_0006533_455_862 | 135 |
| 163 | 3300049578 | Ga0501042_0000029 | Ga0501042_0000029_3431_3838 | 135 |
| 164 | 3300049578 | Ga0501042_0198126 | Ga0501042_0198126_253_663 | 135 |
| 165 | 3300049578 | Ga0501042_0722615 | Ga0501042_0722615_124_531 | 135 |
| 166 | 3300049579 | Ga0501043_0009232 | Ga0501043_0009232_3983_4390 | 135 |
| 167 | 3300049580 | Ga0501046_0000544 | Ga0501046_0000544_14165_14572 | 135 |
| 168 | 3300049582 | Ga0501048_0000167 | Ga0501048_0000167_27043_27450 | 135 |
| 169 | 3300049584 | Ga0501068_0011732 | Ga0501068_0011732_503_910 | 135 |
| 170 | 3300049585 | Ga0501069_0012731 | Ga0501069_0012731_2589_2996 | 135 |
| 171 | 3300049585 | Ga0501069_0206461 | Ga0501069_0206461_514_921 | 135 |
| 172 | 3300049585 | Ga0501069_0951347 | Ga0501069_0951347_77_484 | 135 |
| 173 | 3300049586 | Ga0501070_0013294 | Ga0501070_0013294_2442_2849 | 135 |
| 174 | 3300049586 | Ga0501070_0205809 | Ga0501070_0205809_1164_1571 | 135 |
| 175 | 3300049587 | Ga0501071_0000123 | Ga0501071_0000123_20258_20665 | 135 |
| 176 | 3300049587 | Ga0501071_0082326 | Ga0501071_0082326_1859_2266 | 135 |
| 177 | 3300049587 | Ga0501071_0189175 | Ga0501071_0189175_1049_1456 | 135 |
| 178 | 3300049587 | Ga0501071_0199218 | Ga0501071_0199218_318_728 | 135 |
| 179 | 3300049588 | Ga0501072_0000091 | Ga0501072_0000091_49390_49797 | 135 |
| 180 | 3300049588 | Ga0501072_0035233 | Ga0501072_0035233_2513_2920 | 135 |
| 181 | 3300049588 | Ga0501072_0074417 | Ga0501072_0074417_879_1289 | 135 |
| 182 | 3300049589 | Ga0501073_0006844 | Ga0501073_0006844_1717_2124 | 135 |
| 183 | 3300049590 | Ga0501074_0005032 | Ga0501074_0005032_6726_7133 | 135 |
| 184 | 3300049590 | Ga0501074_0466311 | Ga0501074_0466311_359_766 | 135 |
| 185 | 3300049591 | Ga0501075_0000005 | Ga0501075_0000005_41562_41969 | 135 |
| 186 | 3300049591 | Ga0501075_0066538 | Ga0501075_0066538_1263_1670 | 135 |
| 187 | 3300049592 | Ga0501076_0000024 | Ga0501076_0000024_24829_25236 | 135 |
| 188 | 3300049592 | Ga0501076_0049743 | Ga0501076_0049743_1027_1437 | 135 |
| 189 | 3300049592 | Ga0501076_0231554 | Ga0501076_0231554_406_813 | 135 |
| 190 | 3300049593 | Ga0501077_0000025 | Ga0501077_0000025_17141_17548 | 135 |
| 191 | 3300049593 | Ga0501077_0061153 | Ga0501077_0061153_1485_1892 | 135 |
| 192 | 3300049741 | Ga0501079_0000025 | Ga0501079_0000025_29298_29705 | 135 |
| 193 | 3300049741 | Ga0501079_0645702 | Ga0501079_0645702_263_670 | 135 |
| 194 | 3300049742 | Ga0501080_0001141 | Ga0501080_0001141_12996_13403 | 135 |
| 195 | 3300049743 | Ga0501081_0000007 | Ga0501081_0000007_32519_32926 | 135 |
| 196 | 3300049743 | Ga0501081_0019125 | Ga0501081_0019125_2636_3043 | 135 |
| 197 | 3300049743 | Ga0501081_0248486 | Ga0501081_0248486_213_623 | 135 |
| 198 | 3300049743 | Ga0501081_0889834 | Ga0501081_0889834_216_626 | 135 |
| 199 | 3300049822 | Ga0501035_0002582 | Ga0501035_0002582_14163_14570 | 135 |
| 200 | 3300049823 | Ga0501044_0892185 | Ga0501044_0892185_264_671 | 135 |
| 201 | 3300049823 | Ga0501044_1263924 | Ga0501044_1263924_159_566 | 135 |
| 202 | 3300049824 | Ga0501045_0000003 | Ga0501045_0000003_42456_42863 | 135 |
| 203 | 3300049824 | Ga0501045_0032051 | Ga0501045_0032051_318_725 | 135 |
| 204 | 3300049824 | Ga0501045_0151748 | Ga0501045_0151748_486_896 | 135 |
| 205 | 3300050507 | nmdc:mga05p37_30934_c1 | nmdc:mga05p37_30934_c1_5306_5713 | 135 |
| 206 | 3300050507 | nmdc:mga05p37_372580_c1 | nmdc:mga05p37_372580_c1_622_1029 | 135 |
| 207 | 3300050507 | nmdc:mga05p37_37320_c1 | nmdc:mga05p37_37320_c1_1239_1646 | 135 |
| 208 | 3300050507 | nmdc:mga05p37_7414_c1 | nmdc:mga05p37_7414_c1_3224_3718 | 135 |
| 209 | 3300050508 | nmdc:mga09592_10601_c1 | nmdc:mga09592_10601_c1_4793_5200 | 135 |
| 210 | 3300050509 | nmdc:mga0qj67_180393_c1 | nmdc:mga0qj67_180393_c1_641_1048 | 135 |
| 211 | 3300050509 | nmdc:mga0qj67_478812_c1 | nmdc:mga0qj67_478812_c1_28_435 | 135 |
| 212 | 3300050510 | nmdc:mga06r32_194954_c1 | nmdc:mga06r32_194954_c1_1418_1825 | 135 |
| 213 | 3300050510 | nmdc:mga06r32_44114_c1 | nmdc:mga06r32_44114_c1_2054_2461 | 135 |
| 214 | 3300050510 | nmdc:mga06r32_44537_c1 | nmdc:mga06r32_44537_c1_1901_2308 | 135 |
| 215 | 3300050512 | nmdc:mga0n895_1127572_c1 | nmdc:mga0n895_1127572_c1_97_504 | 135 |
| 216 | 3300050512 | nmdc:mga0n895_295787_c1 | nmdc:mga0n895_295787_c1_548_955 | 135 |
| 217 | 3300050512 | nmdc:mga0n895_628725_c1 | nmdc:mga0n895_628725_c1_168_575 | 135 |
| 218 | 3300050512 | nmdc:mga0n895_855732_c1 | nmdc:mga0n895_855732_c1_351_758 | 135 |
| 219 | 3300050513 | nmdc:mga0rr50_15502_c1 | nmdc:mga0rr50_15502_c1_25_432 | 135 |
| 220 | 3300050513 | nmdc:mga0rr50_471419_c1 | nmdc:mga0rr50_471419_c1_167_574 | 135 |
| 221 | 3300050514 | nmdc:mga08x19_1162248_c1 | nmdc:mga08x19_1162248_c1_13_420 | 135 |
| 222 | 3300050515 | nmdc:mga0a205_653556_c1 | nmdc:mga0a205_653556_c1_411_818 | 135 |
| 223 | 3300054114 | Ga0501084_0000398 | Ga0501084_0000398_19534_19941 | 135 |
| 224 | 3300060353 | Ga0501082_0000062 | Ga0501082_0000062_61399_61806 | 135 |
| 225 | 3300060353 | Ga0501082_0056125 | Ga0501082_0056125_1666_2073 | 135 |
| 226 | 3300060353 | Ga0501082_1135048 | Ga0501082_1135048_90_500 | 135 |
| 227 | 3300061734 | Ga0530510_0000062 | Ga0530510_0000062_29274_29681 | 135 |
| 228 | 3300061734 | Ga0530510_0004377 | Ga0530510_0004377_1935_2348 | 135 |
| 229 | 3300061734 | Ga0530510_0009989 | Ga0530510_0009989_2027_2437 | 135 |
| 230 | 3300061734 | Ga0530510_0188734 | Ga0530510_0188734_256_663 | 135 |
| 231 | 3300003503 | JGI26141J51220_1001595 | JGI26141J51220_10015952 | 136 |
| 232 | 3300005290 | Ga0065712_10675061 | Ga0065712_106750611 | 136 |
| 233 | 3300005293 | Ga0065715_10234588 | Ga0065715_102345882 | 136 |
| 234 | 3300005328 | Ga0070676_10000025 | Ga0070676_1000002530 | 136 |
| 235 | 3300005328 | Ga0070676_10011704 | Ga0070676_100117042 | 136 |
| 236 | 3300005330 | Ga0070690_100133450 | Ga0070690_1001334502 | 136 |
| 237 | 3300005331 | Ga0070670_100038454 | Ga0070670_1000384541 | 136 |
| 238 | 3300005334 | Ga0068869_100000205 | Ga0068869_10000020510 | 136 |
| 239 | 3300005334 | Ga0068869_100027452 | Ga0068869_1000274522 | 136 |
| 240 | 3300005336 | Ga0070680_100002677 | Ga0070680_10000267712 | 136 |
| 241 | 3300005337 | Ga0070682_100000180 | Ga0070682_10000018025 | 136 |
| 242 | 3300005338 | Ga0068868_100073761 | Ga0068868_1000737612 | 136 |
| 243 | 3300005339 | Ga0070660_100000428 | Ga0070660_1000004282 | 136 |
| 244 | 3300005340 | Ga0070689_100158932 | Ga0070689_1001589322 | 136 |
| 245 | 3300005341 | Ga0070691_10046408 | Ga0070691_100464082 | 136 |
| 246 | 3300005341 | Ga0070691_10064925 | Ga0070691_100649252 | 136 |
| 247 | 3300005343 | Ga0070687_100068462 | Ga0070687_1000684622 | 136 |
| 248 | 3300005344 | Ga0070661_100000822 | Ga0070661_10000082216 | 136 |
| 249 | 3300005345 | Ga0070692_10000133 | Ga0070692_1000013312 | 136 |
| 250 | 3300005347 | Ga0070668_100852858 | Ga0070668_1008528582 | 136 |
| 251 | 3300005353 | Ga0070669_100649045 | Ga0070669_1006490452 | 136 |
| 252 | 3300005355 | Ga0070671_101016125 | Ga0070671_1010161251 | 136 |
| 253 | 3300005364 | Ga0070673_100014726 | Ga0070673_1000147265 | 136 |
| 254 | 3300005366 | Ga0070659_100003379 | Ga0070659_1000033798 | 136 |
| 255 | 3300005406 | Ga0070703_10123293 | Ga0070703_101232931 | 136 |
| 256 | 3300005406 | Ga0070703_10156042 | Ga0070703_101560422 | 136 |
| 257 | 3300005436 | Ga0070713_102330400 | Ga0070713_1023304001 | 136 |
| 258 | 3300005438 | Ga0070701_10409444 | Ga0070701_104094441 | 136 |
| 259 | 3300005440 | Ga0070705_100000078 | Ga0070705_10000007816 | 136 |
| 260 | 3300005440 | Ga0070705_100279900 | Ga0070705_1002799002 | 136 |
| 261 | 3300005440 | Ga0070705_100570729 | Ga0070705_1005707292 | 136 |
| 262 | 3300005444 | Ga0070694_100000656 | Ga0070694_10000065612 | 136 |
| 263 | 3300005444 | Ga0070694_100002729 | Ga0070694_1000027294 | 136 |
| 264 | 3300005444 | Ga0070694_100023706 | Ga0070694_1000237062 | 136 |
| 265 | 3300005445 | Ga0070708_100091473 | Ga0070708_1000914734 | 136 |
| 266 | 3300005445 | Ga0070708_100131402 | Ga0070708_1001314022 | 136 |
| 267 | 3300005445 | Ga0070708_100207098 | Ga0070708_1002070982 | 136 |
| 268 | 3300005445 | Ga0070708_100754913 | Ga0070708_1007549132 | 136 |
| 269 | 3300005455 | Ga0070663_100152558 | Ga0070663_1001525582 | 136 |
| 270 | 3300005457 | Ga0070662_100753808 | Ga0070662_1007538082 | 136 |
| 271 | 3300005458 | Ga0070681_10061725 | Ga0070681_100617253 | 136 |
| 272 | 3300005458 | Ga0070681_10192940 | Ga0070681_101929402 | 136 |
| 273 | 3300005459 | Ga0068867_100004170 | Ga0068867_1000041708 | 136 |
| 274 | 3300005459 | Ga0068867_100396359 | Ga0068867_1003963592 | 136 |
| 275 | 3300005467 | Ga0070706_100099348 | Ga0070706_1000993482 | 136 |
| 276 | 3300005467 | Ga0070706_100180428 | Ga0070706_1001804282 | 136 |
| 277 | 3300005467 | Ga0070706_100530460 | Ga0070706_1005304602 | 136 |
| 278 | 3300005467 | Ga0070706_100581227 | Ga0070706_1005812272 | 136 |
| 279 | 3300005468 | Ga0070707_100023174 | Ga0070707_1000231742 | 136 |
| 280 | 3300005468 | Ga0070707_100057153 | Ga0070707_1000571532 | 136 |
| 281 | 3300005468 | Ga0070707_100081846 | Ga0070707_1000818463 | 136 |
| 282 | 3300005468 | Ga0070707_100190765 | Ga0070707_1001907652 | 136 |
| 283 | 3300005468 | Ga0070707_101442829 | Ga0070707_1014428291 | 136 |
| 284 | 3300005471 | Ga0070698_100002570 | Ga0070698_1000025706 | 136 |
| 285 | 3300005471 | Ga0070698_100013281 | Ga0070698_1000132812 | 136 |
| 286 | 3300005471 | Ga0070698_100142353 | Ga0070698_1001423532 | 136 |
| 287 | 3300005471 | Ga0070698_100193600 | Ga0070698_1001936002 | 136 |
| 288 | 3300005518 | Ga0070699_100004138 | Ga0070699_10000413810 | 136 |
| 289 | 3300005518 | Ga0070699_100011799 | Ga0070699_1000117993 | 136 |
| 290 | 3300005518 | Ga0070699_100037436 | Ga0070699_1000374362 | 136 |
| 291 | 3300005518 | Ga0070699_100258733 | Ga0070699_1002587332 | 136 |
| 292 | 3300005518 | Ga0070699_100319318 | Ga0070699_1003193182 | 136 |
| 293 | 3300005530 | Ga0070679_100007425 | Ga0070679_1000074253 | 136 |
| 294 | 3300005530 | Ga0070679_100487631 | Ga0070679_1004876312 | 136 |
| 295 | 3300005535 | Ga0070684_101425606 | Ga0070684_1014256061 | 136 |
| 296 | 3300005536 | Ga0070697_100003917 | Ga0070697_1000039172 | 136 |
| 297 | 3300005536 | Ga0070697_100040307 | Ga0070697_1000403072 | 136 |
| 298 | 3300005536 | Ga0070697_100041574 | Ga0070697_1000415743 | 136 |
| 299 | 3300005536 | Ga0070697_100043676 | Ga0070697_1000436762 | 136 |
| 300 | 3300005536 | Ga0070697_100206470 | Ga0070697_1002064702 | 136 |
| 301 | 3300005539 | Ga0068853_100000255 | Ga0068853_10000025524 | 136 |
| 302 | 3300005545 | Ga0070695_100001694 | Ga0070695_1000016944 | 136 |
| 303 | 3300005545 | Ga0070695_100030093 | Ga0070695_1000300932 | 136 |
| 304 | 3300005545 | Ga0070695_100054243 | Ga0070695_1000542431 | 136 |
| 305 | 3300005546 | Ga0070696_100001230 | Ga0070696_1000012302 | 136 |
| 306 | 3300005546 | Ga0070696_100095963 | Ga0070696_1000959632 | 136 |
| 307 | 3300005547 | Ga0070693_100000163 | Ga0070693_10000016330 | 136 |
| 308 | 3300005547 | Ga0070693_100012218 | Ga0070693_1000122182 | 136 |
| 309 | 3300005549 | Ga0070704_100000731 | Ga0070704_10000073111 | 136 |
| 310 | 3300005549 | Ga0070704_100221928 | Ga0070704_1002219282 | 136 |
| 311 | 3300005549 | Ga0070704_101417181 | Ga0070704_1014171811 | 136 |
| 312 | 3300005563 | Ga0068855_100000612 | Ga0068855_10000061232 | 136 |
| 313 | 3300005564 | Ga0070664_100094385 | Ga0070664_1000943852 | 136 |
| 314 | 3300005577 | Ga0068857_100028151 | Ga0068857_1000281512 | 136 |
| 315 | 3300005578 | Ga0068854_100025201 | Ga0068854_1000252012 | 136 |
| 316 | 3300005578 | Ga0068854_100133054 | Ga0068854_1001330542 | 136 |
| 317 | 3300005614 | Ga0068856_100000630 | Ga0068856_10000063031 | 136 |
| 318 | 3300005615 | Ga0070702_100040801 | Ga0070702_1000408012 | 136 |
| 319 | 3300005616 | Ga0068852_100118419 | Ga0068852_1001184192 | 136 |
| 320 | 3300005617 | Ga0068859_100001373 | Ga0068859_10000137314 | 136 |
| 321 | 3300005719 | Ga0068861_100037179 | Ga0068861_1000371792 | 136 |
| 322 | 3300005840 | Ga0068870_10000221 | Ga0068870_1000022115 | 136 |
| 323 | 3300005841 | Ga0068863_100022279 | Ga0068863_1000222797 | 136 |
| 324 | 3300005842 | Ga0068858_101536322 | Ga0068858_1015363221 | 136 |
| 325 | 3300005843 | Ga0068860_100006069 | Ga0068860_10000606911 | 136 |
| 326 | 3300005844 | Ga0068862_100001036 | Ga0068862_1000010364 | 136 |
| 327 | 3300005844 | Ga0068862_100138891 | Ga0068862_1001388912 | 136 |
| 328 | 3300005937 | Ga0081455_10002783 | Ga0081455_1000278317 | 136 |
| 329 | 3300005937 | Ga0081455_10828678 | Ga0081455_108286782 | 136 |
| 330 | 3300006163 | Ga0070715_10080313 | Ga0070715_100803132 | 136 |
| 331 | 3300006173 | Ga0070716_100156778 | Ga0070716_1001567782 | 136 |
| 332 | 3300006173 | Ga0070716_100574276 | Ga0070716_1005742762 | 136 |
| 333 | 3300006358 | Ga0068871_100300844 | Ga0068871_1003008443 | 136 |
| 334 | 3300006847 | Ga0075431_100161543 | Ga0075431_1001615433 | 136 |
| 335 | 3300006847 | Ga0075431_101372621 | Ga0075431_1013726211 | 136 |
| 336 | 3300006852 | Ga0075433_10004845 | Ga0075433_100048452 | 136 |
| 337 | 3300006852 | Ga0075433_10100818 | Ga0075433_101008182 | 136 |
| 338 | 3300006852 | Ga0075433_10416632 | Ga0075433_104166322 | 136 |
| 339 | 3300006871 | Ga0075434_100015216 | Ga0075434_1000152162 | 136 |
| 340 | 3300006871 | Ga0075434_100089103 | Ga0075434_1000891032 | 136 |
| 341 | 3300006880 | Ga0075429_100799680 | Ga0075429_1007996802 | 136 |
| 342 | 3300006914 | Ga0075436_100247907 | Ga0075436_1002479072 | 136 |
| 343 | 3300006931 | Ga0097620_100001373 | Ga0097620_10000137314 | 136 |
| 344 | 3300007076 | Ga0075435_100071626 | Ga0075435_1000716262 | 136 |
| 345 | 3300007076 | Ga0075435_100138485 | Ga0075435_1001384852 | 136 |
| 346 | 3300007076 | Ga0075435_101053728 | Ga0075435_1010537282 | 136 |
| 347 | 3300007265 | Ga0099794_10002650 | Ga0099794_100026502 | 136 |
| 348 | 3300007265 | Ga0099794_10200312 | Ga0099794_102003122 | 136 |
| 349 | 3300007788 | Ga0099795_10277063 | Ga0099795_102770632 | 136 |
| 350 | 3300009098 | Ga0105245_10216986 | Ga0105245_102169862 | 136 |
| 351 | 3300009147 | Ga0114129_10014190 | Ga0114129_1001419010 | 136 |
| 352 | 3300009147 | Ga0114129_11479981 | Ga0114129_114799812 | 136 |
| 353 | 3300009148 | Ga0105243_10025283 | Ga0105243_100252832 | 136 |
| 354 | 3300009148 | Ga0105243_10436877 | Ga0105243_104368772 | 136 |
| 355 | 3300009174 | Ga0105241_10002642 | Ga0105241_1000264213 | 136 |
| 356 | 3300009176 | Ga0105242_10324341 | Ga0105242_103243411 | 136 |
| 357 | 3300009176 | Ga0105242_10510090 | Ga0105242_105100902 | 136 |
| 358 | 3300009177 | Ga0105248_10244989 | Ga0105248_102449892 | 136 |
| 359 | 3300009545 | Ga0105237_10761955 | Ga0105237_107619552 | 136 |
| 360 | 3300009545 | Ga0105237_11083508 | Ga0105237_110835081 | 136 |
| 361 | 3300009553 | Ga0105249_10644916 | Ga0105249_106449162 | 136 |
| 362 | 3300010375 | Ga0105239_10203855 | Ga0105239_102038552 | 136 |
| 363 | 3300011119 | Ga0105246_10722678 | Ga0105246_107226782 | 136 |
| 364 | 3300013100 | Ga0157373_10000727 | Ga0157373_100007276 | 136 |
| 365 | 3300013105 | Ga0157369_10007825 | Ga0157369_100078256 | 136 |
| 366 | 3300013297 | Ga0157378_10316852 | Ga0157378_103168522 | 136 |
| 367 | 3300013307 | Ga0157372_10009278 | Ga0157372_100092788 | 136 |
| 368 | 3300013307 | Ga0157372_10531290 | Ga0157372_105312902 | 136 |
| 369 | 3300013308 | Ga0157375_10182483 | Ga0157375_101824832 | 136 |
| 370 | 3300014325 | Ga0163163_10357266 | Ga0163163_103572662 | 136 |
| 371 | 3300014325 | Ga0163163_11339994 | Ga0163163_113399941 | 136 |
| 372 | 3300014326 | Ga0157380_10728842 | Ga0157380_107288421 | 136 |
| 373 | 3300025885 | Ga0207653_10009510 | Ga0207653_100095102 | 136 |
| 374 | 3300025885 | Ga0207653_10113617 | Ga0207653_101136172 | 136 |
| 375 | 3300025901 | Ga0207688_10085278 | Ga0207688_100852782 | 136 |
| 376 | 3300025904 | Ga0207647_10031474 | Ga0207647_100314744 | 136 |
| 377 | 3300025905 | Ga0207685_10141601 | Ga0207685_101416012 | 136 |
| 378 | 3300025907 | Ga0207645_10000170 | Ga0207645_1000017036 | 136 |
| 379 | 3300025907 | Ga0207645_10043249 | Ga0207645_100432492 | 136 |
| 380 | 3300025908 | Ga0207643_10000051 | Ga0207643_1000005145 | 136 |
| 381 | 3300025910 | Ga0207684_10003991 | Ga0207684_100039914 | 136 |
| 382 | 3300025910 | Ga0207684_10026668 | Ga0207684_100266682 | 136 |
| 383 | 3300025910 | Ga0207684_10057050 | Ga0207684_100570502 | 136 |
| 384 | 3300025910 | Ga0207684_10066495 | Ga0207684_100664952 | 136 |
| 385 | 3300025910 | Ga0207684_10111519 | Ga0207684_101115192 | 136 |
| 386 | 3300025910 | Ga0207684_10253494 | Ga0207684_102534942 | 136 |
| 387 | 3300025910 | Ga0207684_10522024 | Ga0207684_105220242 | 136 |
| 388 | 3300025910 | Ga0207684_10522523 | Ga0207684_105225232 | 136 |
| 389 | 3300025911 | Ga0207654_10001033 | Ga0207654_100010338 | 136 |
| 390 | 3300025912 | Ga0207707_10000453 | Ga0207707_1000045343 | 136 |
| 391 | 3300025912 | Ga0207707_10097202 | Ga0207707_100972022 | 136 |
| 392 | 3300025912 | Ga0207707_10225065 | Ga0207707_102250652 | 136 |
| 393 | 3300025914 | Ga0207671_10167952 | Ga0207671_101679522 | 136 |
| 394 | 3300025916 | Ga0207663_10138435 | Ga0207663_101384352 | 136 |
| 395 | 3300025917 | Ga0207660_10000203 | Ga0207660_1000020334 | 136 |
| 396 | 3300025918 | Ga0207662_10066768 | Ga0207662_100667682 | 136 |
| 397 | 3300025919 | Ga0207657_10000357 | Ga0207657_1000035719 | 136 |
| 398 | 3300025920 | Ga0207649_10010062 | Ga0207649_100100623 | 136 |
| 399 | 3300025921 | Ga0207652_10032750 | Ga0207652_100327502 | 136 |
| 400 | 3300025922 | Ga0207646_10001207 | Ga0207646_100012073 | 136 |
| 401 | 3300025922 | Ga0207646_10020502 | Ga0207646_100205025 | 136 |
| 402 | 3300025922 | Ga0207646_10269445 | Ga0207646_102694452 | 136 |
| 403 | 3300025922 | Ga0207646_10578114 | Ga0207646_105781142 | 136 |
| 404 | 3300025922 | Ga0207646_10878232 | Ga0207646_108782322 | 136 |
| 405 | 3300025922 | Ga0207646_11026536 | Ga0207646_110265362 | 136 |
| 406 | 3300025923 | Ga0207681_10033960 | Ga0207681_100339602 | 136 |
| 407 | 3300025925 | Ga0207650_10016809 | Ga0207650_100168093 | 136 |
| 408 | 3300025928 | Ga0207700_10626193 | Ga0207700_106261931 | 136 |
| 409 | 3300025931 | Ga0207644_10491855 | Ga0207644_104918552 | 136 |
| 410 | 3300025932 | Ga0207690_10000611 | Ga0207690_1000061116 | 136 |
| 411 | 3300025933 | Ga0207706_10767628 | Ga0207706_107676282 | 136 |
| 412 | 3300025935 | Ga0207709_10020463 | Ga0207709_100204632 | 136 |
| 413 | 3300025935 | Ga0207709_10105720 | Ga0207709_101057203 | 136 |
| 414 | 3300025936 | Ga0207670_10673712 | Ga0207670_106737122 | 136 |
| 415 | 3300025939 | Ga0207665_10344901 | Ga0207665_103449012 | 136 |
| 416 | 3300025941 | Ga0207711_10362074 | Ga0207711_103620742 | 136 |
| 417 | 3300025942 | Ga0207689_10000296 | Ga0207689_100002969 | 136 |
| 418 | 3300025942 | Ga0207689_10008186 | Ga0207689_100081866 | 136 |
| 419 | 3300025945 | Ga0207679_10000233 | Ga0207679_1000023316 | 136 |
| 420 | 3300025949 | Ga0207667_10001733 | Ga0207667_100017339 | 136 |
| 421 | 3300025960 | Ga0207651_10272224 | Ga0207651_102722242 | 136 |
| 422 | 3300025961 | Ga0207712_10632541 | Ga0207712_106325412 | 136 |
| 423 | 3300025981 | Ga0207640_10002914 | Ga0207640_100029147 | 136 |
| 424 | 3300025981 | Ga0207640_10232213 | Ga0207640_102322132 | 136 |
| 425 | 3300026023 | Ga0207677_10013536 | Ga0207677_100135362 | 136 |
| 426 | 3300026041 | Ga0207639_10000673 | Ga0207639_100006733 | 136 |
| 427 | 3300026067 | Ga0207678_10003802 | Ga0207678_100038024 | 136 |
| 428 | 3300026078 | Ga0207702_10001254 | Ga0207702_100012548 | 136 |
| 429 | 3300026089 | Ga0207648_10003252 | Ga0207648_100032529 | 136 |
| 430 | 3300026089 | Ga0207648_10336460 | Ga0207648_103364602 | 136 |
| 431 | 3300026095 | Ga0207676_10042550 | Ga0207676_100425503 | 136 |
| 432 | 3300026116 | Ga0207674_10000836 | Ga0207674_1000083642 | 136 |
| 433 | 3300026118 | Ga0207675_100007334 | Ga0207675_10000733411 | 136 |
| 434 | 3300026142 | Ga0207698_10044174 | Ga0207698_100441742 | 136 |
| 435 | 3300027360 | Ga0209969_1006370 | Ga0209969_10063702 | 136 |
| 436 | 3300027364 | Ga0209967_1015516 | Ga0209967_10155161 | 136 |
| 437 | 3300027395 | Ga0209996_1005890 | Ga0209996_10058902 | 136 |
| 438 | 3300027424 | Ga0209984_1060819 | Ga0209984_10608191 | 136 |
| 439 | 3300027471 | Ga0209995_1001622 | Ga0209995_10016222 | 136 |
| 440 | 3300027543 | Ga0209999_1047109 | Ga0209999_10471092 | 136 |
| 441 | 3300027552 | Ga0209982_1005033 | Ga0209982_10050333 | 136 |
| 442 | 3300027617 | Ga0210002_1011346 | Ga0210002_10113462 | 136 |
| 443 | 3300027665 | Ga0209983_1005137 | Ga0209983_10051373 | 136 |
| 444 | 3300027671 | Ga0209588_1008161 | Ga0209588_10081612 | 136 |
| 445 | 3300027682 | Ga0209971_1000060 | Ga0209971_100006024 | 136 |
| 446 | 3300027695 | Ga0209966_1000312 | Ga0209966_10003123 | 136 |
| 447 | 3300027717 | Ga0209998_10000006 | Ga0209998_1000000641 | 136 |
| 448 | 3300027876 | Ga0209974_10006984 | Ga0209974_100069844 | 136 |
| 449 | 3300028380 | Ga0268265_10002892 | Ga0268265_1000289211 | 136 |
| 450 | 3300028380 | Ga0268265_10014365 | Ga0268265_100143654 | 136 |
| 451 | 3300028381 | Ga0268264_10091495 | Ga0268264_100914952 | 136 |
| 452 | 3300031731 | Ga0307405_10704157 | Ga0307405_107041572 | 136 |
| 453 | 3300031995 | Ga0307409_100208349 | Ga0307409_1002083492 | 136 |
| 454 | 3300032004 | Ga0307414_11031382 | Ga0307414_110313822 | 136 |
| 455 | 3300035083 | Ga0373926_0029359 | Ga0373926_0029359_110_550 | 136 |
| 456 | 3300035084 | Ga0373928_0263328 | Ga0373928_0263328_39_449 | 136 |
| 457 | 3300035088 | Ga0373940_0001445 | Ga0373940_0001445_37_447 | 136 |
| 458 | 3300035091 | Ga0373951_0026697 | Ga0373951_0026697_465_875 | 136 |
| 459 | 3300035092 | Ga0373952_0169007 | Ga0373952_0169007_16_426 | 136 |
| 460 | 3300035111 | Ga0373923_0026197 | Ga0373923_0026197_1587_2027 | 136 |
| 461 | 3300035112 | Ga0373932_0043535 | Ga0373932_0043535_482_892 | 136 |
| 462 | 3300035112 | Ga0373932_0418697 | Ga0373932_0418697_20_430 | 136 |
| 463 | 3300035113 | Ga0373936_0431355 | Ga0373936_0431355_85_525 | 136 |
| 464 | 3300035115 | Ga0373941_0138085 | Ga0373941_0138085_108_518 | 136 |
| 465 | 3300035117 | Ga0373953_0178699 | Ga0373953_0178699_463_903 | 136 |
| 466 | 3300035118 | Ga0373954_0036560 | Ga0373954_0036560_241_681 | 136 |
| 467 | 3300035119 | Ga0373956_0371313 | Ga0373956_0371313_32_472 | 136 |
| 468 | 3300035121 | Ga0373960_0385094 | Ga0373960_0385094_71_481 | 136 |
| 469 | 3300035241 | Ga0373961_0092475 | Ga0373961_0092475_461_871 | 136 |
| 470 | 3300035242 | Ga0373962_0017064 | Ga0373962_0017064_79_489 | 136 |
| 471 | 3300035691 | Ga0373931_0009986 | Ga0373931_0009986_1338_1748 | 136 |
| 472 | 3300035691 | Ga0373931_0338479 | Ga0373931_0338479_356_766 | 136 |
| 473 | 3300035695 | Ga0373927_0002662 | Ga0373927_0002662_7695_8135 | 136 |
| 474 | 3300035725 | Ga0373947_0094567 | Ga0373947_0094567_274_714 | 136 |
| 475 | 3300036401 | Ga0373937_0107616 | Ga0373937_0107616_1928_2368 | 136 |
| 476 | 3300036647 | Ga0316582_1170762 | Ga0316582_1170762_12_425 | 136 |
| 477 | 3300037068 | Ga0373925_0335570 | Ga0373925_0335570_614_1054 | 136 |
| 478 | 3300038996 | Ga0242420_080854 | Ga0242420_080854_122_532 | 136 |
| 479 | 3300042005 | Ga0439448_0003529 | Ga0439448_0003529_264_674 | 136 |
| 480 | 3300042137 | Ga0450902_018119 | Ga0450902_018119_566_976 | 136 |
| 481 | 3300042157 | Ga0439458_0155110 | Ga0439458_0155110_28_438 | 136 |
| 482 | 3300042438 | Ga0439459_0001209 | Ga0439459_0001209_688_1098 | 136 |
| 483 | 3300042439 | Ga0439464_0006796 | Ga0439464_0006796_2400_2810 | 136 |
| 484 | 3300042461 | Ga0439460_0011704 | Ga0439460_0011704_1450_1860 | 136 |
| 485 | 3300042532 | Ga0450893_0069739 | Ga0450893_0069739_106_516 | 136 |
| 486 | 3300042876 | Ga0451577_0006203 | Ga0451577_0006203_10882_11292 | 136 |
| 487 | 3300042876 | Ga0451577_0045895 | Ga0451577_0045895_2149_2559 | 136 |
| 488 | 3300042876 | Ga0451577_1344837 | Ga0451577_1344837_48_458 | 136 |
| 489 | 3300044673 | Ga0453683_0045587 | Ga0453683_0045587_1409_1819 | 136 |
| 490 | 3300044673 | Ga0453683_0056973 | Ga0453683_0056973_85_495 | 136 |
| 491 | 3300044673 | Ga0453683_0355306 | Ga0453683_0355306_29_439 | 136 |
| 492 | 3300044712 | Ga0453684_0054480 | Ga0453684_0054480_746_1156 | 136 |
| 493 | 3300044712 | Ga0453684_0554652 | Ga0453684_0554652_645_1055 | 136 |
| 494 | 3300045051 | Ga0451576_0028962 | Ga0451576_0028962_1998_2408 | 136 |
| 495 | 3300045051 | Ga0451576_0048881 | Ga0451576_0048881_1222_1632 | 136 |
| 496 | 3300045051 | Ga0451576_0224813 | Ga0451576_0224813_485_895 | 136 |
| 497 | 3300045051 | Ga0451576_1437401 | Ga0451576_1437401_200_610 | 136 |
| 498 | 3300046472 | Ga0495580_0014168 | Ga0495580_0014168_4438_4878 | 136 |
| 499 | 3300046472 | Ga0495580_0111626 | Ga0495580_0111626_1433_1843 | 136 |
| 500 | 3300046472 | Ga0495580_0362882 | Ga0495580_0362882_378_788 | 136 |
| 501 | 3300046472 | Ga0495580_0748528 | Ga0495580_0748528_169_579 | 136 |
| 502 | 3300046475 | Ga0495639_0142212 | Ga0495639_0142212_208_648 | 136 |
| 503 | 3300046477 | Ga0495664_0422638 | Ga0495664_0422638_45_485 | 136 |
| 504 | 3300046491 | Ga0495584_0288423 | Ga0495584_0288423_380_790 | 136 |
| 505 | 3300046531 | Ga0495665_0024426 | Ga0495665_0024426_1719_2159 | 136 |
| 506 | 3300046543 | Ga0495645_0467641 | Ga0495645_0467641_75_515 | 136 |
| 507 | 3300046559 | Ga0495667_0639261 | Ga0495667_0639261_190_630 | 136 |
| 508 | 3300046642 | Ga0495634_0617555 | Ga0495634_0617555_18_458 | 136 |
| 509 | 3300046663 | Ga0495635_0245388 | Ga0495635_0245388_717_1157 | 136 |
| 510 | 3300047319 | Ga0495674_0197269 | Ga0495674_0197269_695_1135 | 136 |
| 511 | 3300047444 | Ga0495675_0300134 | Ga0495675_0300134_125_565 | 136 |
| 512 | 3300047471 | Ga0495684_0141424 | Ga0495684_0141424_526_966 | 136 |
| 513 | 3300048905 | Ga0496102_0010781 | Ga0496102_0010781_292_702 | 136 |
| 514 | 3300048911 | Ga0496108_1234191 | Ga0496108_1234191_162_572 | 136 |
| 515 | 3300048913 | Ga0496110_1542235 | Ga0496110_1542235_55_465 | 136 |
| 516 | 3300048915 | Ga0496112_0170862 | Ga0496112_0170862_500_910 | 136 |
| 517 | 3300049568 | Ga0501031_0101748 | Ga0501031_0101748_1024_1434 | 136 |
| 518 | 3300049568 | Ga0501031_0341284 | Ga0501031_0341284_242_652 | 136 |
| 519 | 3300049569 | Ga0501032_0850245 | Ga0501032_0850245_33_443 | 136 |
| 520 | 3300049570 | Ga0501033_0031121 | Ga0501033_0031121_442_852 | 136 |
| 521 | 3300049570 | Ga0501033_0149654 | Ga0501033_0149654_1055_1555 | 136 |
| 522 | 3300049572 | Ga0501036_0101892 | Ga0501036_0101892_1273_1683 | 136 |
| 523 | 3300049572 | Ga0501036_0189248 | Ga0501036_0189248_735_1145 | 136 |
| 524 | 3300049572 | Ga0501036_0422683 | Ga0501036_0422683_429_839 | 136 |
| 525 | 3300049572 | Ga0501036_0464140 | Ga0501036_0464140_98_598 | 136 |
| 526 | 3300049573 | Ga0501037_0038927 | Ga0501037_0038927_373_783 | 136 |
| 527 | 3300049574 | Ga0501038_0118241 | Ga0501038_0118241_1544_1954 | 136 |
| 528 | 3300049575 | Ga0501039_0025015 | Ga0501039_0025015_1545_1955 | 136 |
| 529 | 3300049575 | Ga0501039_0266358 | Ga0501039_0266358_909_1319 | 136 |
| 530 | 3300049576 | Ga0501040_0001289 | Ga0501040_0001289_8578_8988 | 136 |
| 531 | 3300049576 | Ga0501040_0173671 | Ga0501040_0173671_1052_1462 | 136 |
| 532 | 3300049576 | Ga0501040_0219686 | Ga0501040_0219686_64_474 | 136 |
| 533 | 3300049576 | Ga0501040_0674163 | Ga0501040_0674163_321_731 | 136 |
| 534 | 3300049577 | Ga0501041_0002902 | Ga0501041_0002902_938_1348 | 136 |
| 535 | 3300049577 | Ga0501041_0063689 | Ga0501041_0063689_1367_1777 | 136 |
| 536 | 3300049577 | Ga0501041_0163382 | Ga0501041_0163382_46_456 | 136 |
| 537 | 3300049578 | Ga0501042_0003204 | Ga0501042_0003204_8601_9011 | 136 |
| 538 | 3300049578 | Ga0501042_0022065 | Ga0501042_0022065_283_693 | 136 |
| 539 | 3300049578 | Ga0501042_0648134 | Ga0501042_0648134_199_612 | 136 |
| 540 | 3300049579 | Ga0501043_0046014 | Ga0501043_0046014_1387_1797 | 136 |
| 541 | 3300049579 | Ga0501043_0844840 | Ga0501043_0844840_121_531 | 136 |
| 542 | 3300049580 | Ga0501046_0001711 | Ga0501046_0001711_4013_4423 | 136 |
| 543 | 3300049580 | Ga0501046_0086321 | Ga0501046_0086321_482_982 | 136 |
| 544 | 3300049581 | Ga0501047_0063964 | Ga0501047_0063964_669_1079 | 136 |
| 545 | 3300049582 | Ga0501048_0004989 | Ga0501048_0004989_8080_8490 | 136 |
| 546 | 3300049582 | Ga0501048_1125911 | Ga0501048_1125911_50_460 | 136 |
| 547 | 3300049582 | Ga0501048_1143711 | Ga0501048_1143711_40_471 | 136 |
| 548 | 3300049584 | Ga0501068_0229756 | Ga0501068_0229756_75_575 | 136 |
| 549 | 3300049584 | Ga0501068_0408836 | Ga0501068_0408836_285_695 | 136 |
| 550 | 3300049587 | Ga0501071_0053860 | Ga0501071_0053860_69_479 | 136 |
| 551 | 3300049587 | Ga0501071_0109461 | Ga0501071_0109461_656_1066 | 136 |
| 552 | 3300049587 | Ga0501071_0394029 | Ga0501071_0394029_533_943 | 136 |
| 553 | 3300049588 | Ga0501072_0093129 | Ga0501072_0093129_1635_2045 | 136 |
| 554 | 3300049588 | Ga0501072_0129735 | Ga0501072_0129735_955_1365 | 136 |
| 555 | 3300049588 | Ga0501072_0288655 | Ga0501072_0288655_711_1121 | 136 |
| 556 | 3300049590 | Ga0501074_0006054 | Ga0501074_0006054_610_1020 | 136 |
| 557 | 3300049590 | Ga0501074_0358818 | Ga0501074_0358818_128_538 | 136 |
| 558 | 3300049591 | Ga0501075_0006543 | Ga0501075_0006543_3733_4143 | 136 |
| 559 | 3300049591 | Ga0501075_0021176 | Ga0501075_0021176_1748_2158 | 136 |
| 560 | 3300049591 | Ga0501075_0374383 | Ga0501075_0374383_466_876 | 136 |
| 561 | 3300049592 | Ga0501076_0027512 | Ga0501076_0027512_2438_2848 | 136 |
| 562 | 3300049592 | Ga0501076_0060399 | Ga0501076_0060399_1655_2065 | 136 |
| 563 | 3300049592 | Ga0501076_0063233 | Ga0501076_0063233_749_1159 | 136 |
| 564 | 3300049592 | Ga0501076_0340278 | Ga0501076_0340278_717_1148 | 136 |
| 565 | 3300049593 | Ga0501077_0104695 | Ga0501077_0104695_441_851 | 136 |
| 566 | 3300049593 | Ga0501077_0282172 | Ga0501077_0282172_565_975 | 136 |
| 567 | 3300049593 | Ga0501077_0331787 | Ga0501077_0331787_210_620 | 136 |
| 568 | 3300049741 | Ga0501079_0000760 | Ga0501079_0000760_10631_11041 | 136 |
| 569 | 3300049741 | Ga0501079_0008890 | Ga0501079_0008890_4361_4771 | 136 |
| 570 | 3300049741 | Ga0501079_0105145 | Ga0501079_0105145_28_438 | 136 |
| 571 | 3300049741 | Ga0501079_0273270 | Ga0501079_0273270_534_1028 | 136 |
| 572 | 3300049741 | Ga0501079_0367151 | Ga0501079_0367151_520_930 | 136 |
| 573 | 3300049741 | Ga0501079_0702303 | Ga0501079_0702303_89_550 | 136 |
| 574 | 3300049741 | Ga0501079_0981790 | Ga0501079_0981790_116_526 | 136 |
| 575 | 3300049742 | Ga0501080_0633180 | Ga0501080_0633180_230_640 | 136 |
| 576 | 3300049743 | Ga0501081_0020663 | Ga0501081_0020663_2014_2424 | 136 |
| 577 | 3300049743 | Ga0501081_0057687 | Ga0501081_0057687_1962_2462 | 136 |
| 578 | 3300049743 | Ga0501081_0087750 | Ga0501081_0087750_1279_1773 | 136 |
| 579 | 3300049743 | Ga0501081_0297579 | Ga0501081_0297579_379_789 | 136 |
| 580 | 3300049743 | Ga0501081_0310626 | Ga0501081_0310626_447_857 | 136 |
| 581 | 3300049743 | Ga0501081_0352133 | Ga0501081_0352133_108_518 | 136 |
| 582 | 3300049744 | Ga0501083_0011123 | Ga0501083_0011123_348_758 | 136 |
| 583 | 3300049744 | Ga0501083_0198248 | Ga0501083_0198248_427_837 | 136 |
| 584 | 3300049744 | Ga0501083_0723727 | Ga0501083_0723727_70_480 | 136 |
| 585 | 3300049824 | Ga0501045_0000717 | Ga0501045_0000717_12058_12468 | 136 |
| 586 | 3300049824 | Ga0501045_0298344 | Ga0501045_0298344_143_643 | 136 |
| 587 | 3300050507 | nmdc:mga05p37_213226_c1 | nmdc:mga05p37_213226_c1_985_1395 | 136 |
| 588 | 3300050507 | nmdc:mga05p37_219186_c1 | nmdc:mga05p37_219186_c1_632_1042 | 136 |
| 589 | 3300050507 | nmdc:mga05p37_506035_c1 | nmdc:mga05p37_506035_c1_26_469 | 136 |
| 590 | 3300050507 | nmdc:mga05p37_6819_c1 | nmdc:mga05p37_6819_c1_40_450 | 136 |
| 591 | 3300050508 | nmdc:mga09592_648166_c1 | nmdc:mga09592_648166_c1_155_646 | 136 |
| 592 | 3300050510 | nmdc:mga06r32_381000_c1 | nmdc:mga06r32_381000_c1_576_986 | 136 |
| 593 | 3300050512 | nmdc:mga0n895_2180639_c1 | nmdc:mga0n895_2180639_c1_87_497 | 136 |
| 594 | 3300050512 | nmdc:mga0n895_39410_c1 | nmdc:mga0n895_39410_c1_151_561 | 136 |
| 595 | 3300050512 | nmdc:mga0n895_678508_c1 | nmdc:mga0n895_678508_c1_45_536 | 136 |
| 596 | 3300050513 | nmdc:mga0rr50_10901_c1 | nmdc:mga0rr50_10901_c1_3735_4145 | 136 |
| 597 | 3300050514 | nmdc:mga08x19_677641_c1 | nmdc:mga08x19_677641_c1_93_503 | 136 |
| 598 | 3300050514 | nmdc:mga08x19_78596_c1 | nmdc:mga08x19_78596_c1_951_1361 | 136 |
| 599 | 3300050515 | nmdc:mga0a205_182435_c2 | nmdc:mga0a205_182435_c2_541_951 | 136 |
| 600 | 3300050515 | nmdc:mga0a205_262615_c1 | nmdc:mga0a205_262615_c1_70_564 | 136 |
| 601 | 3300050515 | nmdc:mga0a205_740416_c1 | nmdc:mga0a205_740416_c1_205_693 | 136 |
| 602 | 3300050515 | nmdc:mga0a205_8715_c1 | nmdc:mga0a205_8715_c1_23_433 | 136 |
| 603 | 3300054114 | Ga0501084_0002865 | Ga0501084_0002865_3380_3790 | 136 |
| 604 | 3300054114 | Ga0501084_0030896 | Ga0501084_0030896_3540_3950 | 136 |
| 605 | 3300054114 | Ga0501084_0663789 | Ga0501084_0663789_85_579 | 136 |
| 606 | 3300059421 | Ga0590071_027846 | Ga0590071_027846_858_1271 | 136 |
| 607 | 3300059426 | Ga0590077_068774 | Ga0590077_068774_303_716 | 136 |
| 608 | 3300060353 | Ga0501082_0015483 | Ga0501082_0015483_4117_4527 | 136 |
| 609 | 3300060353 | Ga0501082_0024763 | Ga0501082_0024763_4493_4903 | 136 |
| 610 | 3300060353 | Ga0501082_0046990 | Ga0501082_0046990_1530_2030 | 136 |
| 611 | 3300060353 | Ga0501082_0129223 | Ga0501082_0129223_487_897 | 136 |
| 612 | 3300060353 | Ga0501082_0246933 | Ga0501082_0246933_372_782 | 136 |
| 613 | 3300060353 | Ga0501082_1441947 | Ga0501082_1441947_50_481 | 136 |
| 614 | 3300061734 | Ga0530510_0014717 | Ga0530510_0014717_1190_1600 | 136 |
| 615 | 3300061734 | Ga0530510_0026226 | Ga0530510_0026226_302_712 | 136 |
| 616 | 3300061734 | Ga0530510_0209667 | Ga0530510_0209667_78_488 | 136 |
| 617 | 3300061734 | Ga0530510_0457301 | Ga0530510_0457301_343_843 | 136 |
| 618 | 3300061734 | Ga0530510_0579831 | Ga0530510_0579831_270_701 | 136 |
| 619 | 3300061734 | Ga0530510_1004391 | Ga0530510_1004391_179_589 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r3u-assembly1.cif.gz_C | crystal structure of 2-hydroxyisobutyryl-coa mutase | 0.981 | 5 | 132 |
| 2xiq-assembly1.cif.gz_A | crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa | 0.9778 | 6 | 130 |
| 8dyl-assembly1.cif.gz_B | crystal structure of human methylmalonyl-coa mutase bound to aquocobalamin | 0.9772 | 4 | 130 |
| 6oxc-assembly1.cif.gz_A | structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin | 0.966 | 7 | 130 |
| 4r3u-assembly1.cif.gz_C | crystal structure of 2-hydroxyisobutyryl-coa mutase | 0.9516 | 5 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4r3uD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9794 | 5 | 131 | 3.40.50.280 |
| af_A4I2L1_581_723_3.40.50.280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9786 | 7 | 132 | 3.40.50.280 |
| 4r3uD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9571 | 5 | 131 | 3.40.50.280 |
| af_A4I2L1_581_723_3.40.50.280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9078 | 7 | 132 | 3.40.50.280 |
| 4jgiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.8888 | 4 | 128 | 3.40.50.280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8I2J3-F1-model_v4 | Methylmalonyl-CoA mutase | 0.988 | 4 | 130 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A7V3RWE8-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9866 | 3 | 131 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A1Q7Y4E5-F1-model_v4 | Methylmalonyl-CoA mutase | 0.9859 | 2 | 135 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A831Y7U5-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9838 | 6 | 128 |
GO:0016853
GO:0031419 GO:0046872 |
| AF-A0A6N9F9N7-F1-model_v4 | deleted | 0.9826 | 1 | 130 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar