F469718

General Info

Members Datasets Scaffolds Average Seq Length
618 264 1236 296

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100131353|Ga0070696_1001313532
Length 348
Sequence MCPENRVTYVSGRTTHYPTPKNSHALSIVKTGGDRTRHTSQRPTATQDLVTQDSSEAPFGTVPPGFRLPALAHVGGVQLQVSDLRRSIEYYELLLGLTAETRPDGTVALAAGNQETPLVTLHTRPGVTRARRGAFGLYHFAILLPDRAALGRFAAHLARVRVEVGMADHLVSEALYLWDPDGLGIEVYADRPRETWQHRGRELVMTTDPLDVDSLIDAGGGEDWTGMPPATTMGHVHLHVGSLDGAEAFYHRGLGFDKTVWSYPGALFMSAGGYHHHLGTNVWAQGPSPSPEHAQLLEWELIVPSSDDLTAAADSLQAAGHAAERGPDSVLTSDPWGTRFRLRSNRRR

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.1
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 19.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100131353 3300005546 Bacteria 1822
2 rootL2_10043223 3300003322 Bacteria 3654
3 Ga0065704_10194550 3300005289 Archaea 1174
4 Ga0065712_10079606 3300005290 Plasmid 3158
5 Ga0065712_10081364 3300005290 Unclassified 3013
6 Ga0065715_10006660 3300005293 Bacteria 5279
7 Ga0065715_10089203 3300005293 Bacteria 12615
8 Ga0065707_10084277 3300005295 Bacteria 7414
9 Ga0065707_10112824 3300005295 Archaea 2347
10 Ga0070658_10024736 3300005327 Bacteria 4815
11 Ga0070658_10153904 3300005327 Bacteria 1927
12 Ga0070676_10003717 3300005328 Bacteria 7996
13 Ga0070676_10037129 3300005328 Bacteria 2809
14 Ga0070676_10047239 3300005328 Bacteria 2513
15 Ga0070676_10055489 3300005328 Bacteria 2338
16 Ga0070676_10158330 3300005328 Bacteria 1455
17 Ga0070683_100014687 3300005329 Bacteria 6859
18 Ga0070683_100018022 3300005329 Bacteria 6245
19 Ga0070683_100051765 3300005329 Plasmid 3803
20 Ga0070683_100058306 3300005329 Bacteria 3587
21 Ga0070683_100253712 3300005329 Unclassified 1673
22 Ga0070683_100291693 3300005329 Unclassified 1551
23 Ga0070690_100014476 3300005330 Bacteria 4680
24 Ga0070690_100029563 3300005330 Bacteria 3399
25 Ga0070690_100032575 3300005330 Bacteria 3256
26 Ga0070670_100116494 3300005331 Bacteria 2304
27 Ga0070677_10083046 3300005333 Bacteria 1375
28 Ga0068869_100075805 3300005334 Unclassified 2500
29 Ga0070666_10024367 3300005335 Bacteria 3941
30 Ga0070666_10037180 3300005335 Bacteria 3236
31 Ga0070666_10225792 3300005335 Bacteria 1322
32 Ga0070680_100005756 3300005336 Bacteria 9402
33 Ga0070680_100024254 3300005336 Unclassified 4842
34 Ga0070680_100026658 3300005336 Bacteria 4622
35 Ga0070680_100036068 3300005336 Unclassified 3994
36 Ga0070680_100192473 3300005336 Bacteria 1719
37 Ga0070682_100000385 3300005337 Bacteria 29420
38 Ga0070682_100003109 3300005337 Bacteria 9191
39 Ga0070682_100005029 3300005337 Bacteria 7348
40 Ga0070682_100294240 3300005337 Bacteria 1189
41 Ga0068868_100020905 3300005338 Bacteria 4926
42 Ga0068868_100034462 3300005338 Bacteria 3908
43 Ga0068868_100114703 3300005338 Bacteria 2192
44 Ga0070660_100014271 3300005339 Bacteria 5720
45 Ga0070660_100322977 3300005339 Bacteria 1268
46 Ga0070660_100575966 3300005339 Unclassified 940
47 Ga0070689_100017528 3300005340 Bacteria 5262
48 Ga0070689_100056623 3300005340 Unclassified 3040
49 Ga0070689_100153186 3300005340 Bacteria 1860
50 Ga0070689_100199053 3300005340 Unclassified 1635
51 Ga0070689_100274362 3300005340 Bacteria 1397
52 Ga0070687_100007321 3300005343 Bacteria 4592
53 Ga0070687_100035254 3300005343 Unclassified 2483
54 Ga0070687_100053364 3300005343 Bacteria 2102
55 Ga0070661_100094903 3300005344 Unclassified 2211
56 Ga0070661_100096666 3300005344 Bacteria 2192
57 Ga0070661_100223382 3300005344 Bacteria 1445
58 Ga0070692_10161463 3300005345 Bacteria 1284
59 Ga0070669_100000513 3300005353 Bacteria 29162
60 Ga0070669_100025932 3300005353 Unclassified 4215
61 Ga0070669_100083179 3300005353 Bacteria 2387
62 Ga0070675_100001517 3300005354 Bacteria 17163
63 Ga0070675_100006870 3300005354 Bacteria 8736
64 Ga0070675_100032007 3300005354 Bacteria 4253
65 Ga0070675_100082760 3300005354 Bacteria 2678
66 Ga0070675_100486362 3300005354 Bacteria 1111
67 Ga0070671_100019482 3300005355 Bacteria 5523
68 Ga0070671_100053114 3300005355 Bacteria 3369
69 Ga0070671_100139202 3300005355 Bacteria 2048
70 Ga0070671_100408432 3300005355 Unclassified 1162
71 Ga0070674_100003654 3300005356 Bacteria 8666
72 Ga0070674_100260780 3300005356 Bacteria 1365
73 Ga0070674_100433278 3300005356 Bacteria 1081
74 Ga0070673_100031457 3300005364 Bacteria 3982
75 Ga0070673_100036165 3300005364 Bacteria 3751
76 Ga0070673_100102426 3300005364 Bacteria 2360
77 Ga0070673_100206755 3300005364 Unclassified 1693
78 Ga0070688_100165960 3300005365 Unclassified 1520
79 Ga0070659_100007890 3300005366 Bacteria 7751
80 Ga0070659_100018354 3300005366 Bacteria 5280
81 Ga0070659_100145968 3300005366 Unclassified 1927
82 Ga0070667_100037945 3300005367 Bacteria 4039
83 Ga0070667_100053209 3300005367 Bacteria 3416
84 Ga0070709_10016582 3300005434 Bacteria 4208
85 Ga0070709_10078695 3300005434 Bacteria 2146
86 Ga0070714_100001912 3300005435 Bacteria 15186
87 Ga0070700_100015909 3300005441 Bacteria 4274
88 Ga0070700_100041101 3300005441 Bacteria 2833
89 Ga0070700_100164583 3300005441 Bacteria 1530
90 Ga0070694_100104466 3300005444 Bacteria 2009
91 Ga0070708_100000184 3300005445 Bacteria 45171
92 Ga0070663_100009457 3300005455 Bacteria 6037
93 Ga0070663_100022874 3300005455 Bacteria 4183
94 Ga0070663_100047381 3300005455 Bacteria 3044
95 Ga0070678_100051747 3300005456 Unclassified 2979
96 Ga0070678_100117935 3300005456 Bacteria 2088
97 Ga0070678_100190444 3300005456 Unclassified 1686
98 Ga0070678_100251994 3300005456 Bacteria 1481
99 Ga0070678_100320064 3300005456 Unclassified 1324
100 Ga0070678_100390858 3300005456 Bacteria 1206
101 Ga0070662_100000274 3300005457 Bacteria 30490
102 Ga0070662_100004383 3300005457 Bacteria 8917
103 Ga0070662_100047053 3300005457 Bacteria 3101
104 Ga0070662_100206197 3300005457 Unclassified 1562
105 Ga0070662_100234568 3300005457 Archaea 1469
106 Ga0070662_100343670 3300005457 Bacteria 1221
107 Ga0070681_10015520 3300005458 Bacteria 7586
108 Ga0070681_10030614 3300005458 Bacteria 5401
109 Ga0070681_10035531 3300005458 Bacteria 5007
110 Ga0070681_10245564 3300005458 Unclassified 1703
111 Ga0070681_10284870 3300005458 Bacteria 1563
112 Ga0070681_10405707 3300005458 Bacteria 1274
113 Ga0068867_100091603 3300005459 Bacteria 2308
114 Ga0068867_100270952 3300005459 Bacteria 1388
115 Ga0070685_10002962 3300005466 Bacteria 8670
116 Ga0070685_10047844 3300005466 Unclassified 2461
117 Ga0070706_100098633 3300005467 Bacteria 2715
118 Ga0070707_100004384 3300005468 Bacteria 13212
119 Ga0070707_100227587 3300005468 Bacteria 1816
120 Ga0070698_100033572 3300005471 Bacteria 5315
121 Ga0070699_100046548 3300005518 Unclassified 3753
122 Ga0070699_100050173 3300005518 Unclassified 3613
123 Ga0070699_100203473 3300005518 Bacteria 1761
124 Ga0070679_100000787 3300005530 Bacteria 27616
125 Ga0070679_100037297 3300005530 Unclassified 4827
126 Ga0070679_100037692 3300005530 Bacteria 4804
127 Ga0070679_100088200 3300005530 Bacteria 3089
128 Ga0070679_100145985 3300005530 Bacteria 2343
129 Ga0070679_100209361 3300005530 Bacteria 1914
130 Ga0070679_100222906 3300005530 Unclassified 1846
131 Ga0070679_100373283 3300005530 Bacteria 1373
132 Ga0070684_100027932 3300005535 Unclassified 4768
133 Ga0070684_100145383 3300005535 Unclassified 2146
134 Ga0070697_100109088 3300005536 Unclassified 2305
135 Ga0068853_100185067 3300005539 Bacteria 1890
136 Ga0070672_100010270 3300005543 Bacteria 6490
137 Ga0070672_100020589 3300005543 Bacteria 4814
138 Ga0070672_100049120 3300005543 Bacteria 3281
139 Ga0070672_100182408 3300005543 Bacteria 1750
140 Ga0070686_100000009 3300005544 Bacteria 202453
141 Ga0070686_100015338 3300005544 Bacteria 4436
142 Ga0070695_100019535 3300005545 Unclassified 4126
143 Ga0070695_100042162 3300005545 Bacteria 2896
144 Ga0070696_100003007 3300005546 Bacteria 11189
145 Ga0070696_100319065 3300005546 Bacteria 1195
146 Ga0070696_100361461 3300005546 Bacteria 1127
147 Ga0070693_100075596 3300005547 Bacteria 1995
148 Ga0070665_100234259 3300005548 Bacteria 1836
149 Ga0070665_100301149 3300005548 Bacteria 1606
150 Ga0070665_100536111 3300005548 Bacteria 1182
151 Ga0070704_100140177 3300005549 Unclassified 1887
152 Ga0070704_100141169 3300005549 Bacteria 1881
153 Ga0068855_100006396 3300005563 Bacteria 14347
154 Ga0068855_100168946 3300005563 Unclassified 2477
155 Ga0068855_100220311 3300005563 Bacteria 2128
156 Ga0068855_100362798 3300005563 Unclassified 1594
157 Ga0070664_100009845 3300005564 Bacteria 7745
158 Ga0070664_100035582 3300005564 Bacteria 4180
159 Ga0070664_100043193 3300005564 Bacteria 3803
160 Ga0070664_100206381 3300005564 Unclassified 1755
161 Ga0070664_100328391 3300005564 Unclassified 1387
162 Ga0070664_100459969 3300005564 Unclassified 1169
163 Ga0068857_100007853 3300005577 Bacteria 9204
164 Ga0068857_100021761 3300005577 Bacteria 5643
165 Ga0068854_100078824 3300005578 Bacteria 2427
166 Ga0068854_100083306 3300005578 Bacteria 2365
167 Ga0068854_100150474 3300005578 Bacteria 1794
168 Ga0068854_100384473 3300005578 Bacteria 1157
169 Ga0068856_100005203 3300005614 Bacteria 12843
170 Ga0070702_100030837 3300005615 Unclassified 2927
171 Ga0070702_100077157 3300005615 Bacteria 1985
172 Ga0070702_100119380 3300005615 Bacteria 1648
173 Ga0068852_100044816 3300005616 Unclassified 3760
174 Ga0068852_100282682 3300005616 Bacteria 1600
175 Ga0068859_100023846 3300005617 Bacteria 6142
176 Ga0068859_100072390 3300005617 Unclassified 3483
177 Ga0068859_100189569 3300005617 Unclassified 2140
178 Ga0068859_100507075 3300005617 Bacteria 1302
179 Ga0068864_100016008 3300005618 Bacteria 6239
180 Ga0068866_10045781 3300005718 Bacteria 2196
181 Ga0068866_10100396 3300005718 Bacteria 1595
182 Ga0068863_100021622 3300005841 Bacteria 6136
183 Ga0068858_100124666 3300005842 Bacteria 2411
184 Ga0068858_100142441 3300005842 Unclassified 2251
185 Ga0068860_100030785 3300005843 Bacteria 5160
186 Ga0068862_100015673 3300005844 Bacteria 6297
187 Ga0081539_10000693 3300005985 Bacteria 67531
188 Ga0070712_100246169 3300006175 Unclassified 1426
189 Ga0097621_100100848 3300006237 Unclassified 2429
190 Ga0097621_100387049 3300006237 Unclassified 1250
191 Ga0075428_100224384 3300006844 Unclassified 2028
192 Ga0075430_100001246 3300006846 Bacteria 20485
193 Ga0075430_100108278 3300006846 Bacteria 2318
194 Ga0075430_100151881 3300006846 Bacteria 1928
195 Ga0075430_100242966 3300006846 Bacteria 1492
196 Ga0075431_100007932 3300006847 Bacteria 10583
197 Ga0075431_100021106 3300006847 Bacteria 6656
198 Ga0075431_100022476 3300006847 Bacteria 6448
199 Ga0075431_100037056 3300006847 Bacteria 5024
200 Ga0075431_100092672 3300006847 Bacteria 3118
201 Ga0075431_100425409 3300006847 Archaea 1327
202 Ga0075433_10009681 3300006852 Bacteria 7715
203 Ga0075433_10197025 3300006852 Archaea 1791
204 Ga0075434_100001831 3300006871 Bacteria 18346
205 Ga0075434_100035455 3300006871 Bacteria 4932
206 Ga0075434_100265729 3300006871 Bacteria 1735
207 Ga0075429_100003535 3300006880 Bacteria 13310
208 Ga0075429_100119434 3300006880 Unclassified 2303
209 Ga0075429_100143544 3300006880 Bacteria 2090
210 Ga0068865_100102756 3300006881 Bacteria 2095
211 Ga0097620_100023846 3300006931 Bacteria 6142
212 Ga0097620_100072390 3300006931 Unclassified 3483
213 Ga0097620_100189571 3300006931 Unclassified 2140
214 Ga0097620_100507089 3300006931 Bacteria 1302
215 Ga0075435_100006040 3300007076 Bacteria 8527
216 Ga0105240_10191460 3300009093 Unclassified 2405
217 Ga0105240_10228305 3300009093 Bacteria 2165
218 Ga0111539_10000435 3300009094 Bacteria 52742
219 Ga0111539_10019080 3300009094 Bacteria 8473
220 Ga0111539_10019229 3300009094 Bacteria 8436
221 Ga0111539_10061044 3300009094 Bacteria 4466
222 Ga0111539_10091796 3300009094 Bacteria 3568
223 Ga0111539_10163097 3300009094 Bacteria 2607
224 Ga0105245_10031577 3300009098 Bacteria 4687
225 Ga0105245_10183764 3300009098 Bacteria 1999
226 Ga0105245_10605581 3300009098 Bacteria 1122
227 Ga0114129_10002025 3300009147 Bacteria 27789
228 Ga0114129_10171016 3300009147 Bacteria 2962
229 Ga0114129_10186241 3300009147 Bacteria 2821
230 Ga0105243_10124002 3300009148 Bacteria 2183
231 Ga0105243_10216769 3300009148 Bacteria 1689
232 Ga0105241_10034415 3300009174 Bacteria 3806
233 Ga0105241_10271178 3300009174 Bacteria 1446
234 Ga0105242_10024384 3300009176 Bacteria 4777
235 Ga0105248_10003724 3300009177 Bacteria 16906
236 Ga0105248_10032627 3300009177 Bacteria 5818
237 Ga0105248_10049824 3300009177 Bacteria 4696
238 Ga0105248_10051768 3300009177 Bacteria 4607
239 Ga0105248_10331607 3300009177 Bacteria 1714
240 Ga0105248_10366403 3300009177 Bacteria 1622
241 Ga0105248_10488022 3300009177 Bacteria 1389
242 Ga0105238_10000223 3300009551 Bacteria 62977
243 Ga0105238_10019257 3300009551 Bacteria 6953
244 Ga0105249_10000456 3300009553 Bacteria 38267
245 Ga0105249_10272538 3300009553 Bacteria 1687
246 Ga0099796_10003303 3300010159 Bacteria 3719
247 Ga0157371_10094420 3300013102 Bacteria 2119
248 Ga0157371_10316215 3300013102 Unclassified 1132
249 Ga0157370_10067053 3300013104 Bacteria 3393
250 Ga0157370_10121658 3300013104 Unclassified 2437
251 Ga0157369_10035742 3300013105 Bacteria 5446
252 Ga0157369_10035989 3300013105 Bacteria 5426
253 Ga0157369_10110590 3300013105 Bacteria 2921
254 Ga0157369_10183834 3300013105 Unclassified 2198
255 Ga0157369_10747221 3300013105 Bacteria 1006
256 Ga0157378_10010026 3300013297 Bacteria 8260
257 Ga0157378_10011892 3300013297 Bacteria 7622
258 Ga0163162_10431378 3300013306 Bacteria 1450
259 Ga0157372_10105043 3300013307 Unclassified 3230
260 Ga0157372_10403743 3300013307 Unclassified 1592
261 Ga0157372_10410893 3300013307 Unclassified 1577
262 Ga0157375_10087186 3300013308 Bacteria 3173
263 Ga0157375_10468517 3300013308 Unclassified 1425
264 Ga0163163_10141789 3300014325 Bacteria 2446
265 Ga0163163_10834127 3300014325 Unclassified 985
266 Ga0163161_10097845 3300017792 Bacteria 2180
267 Ga0163161_10210027 3300017792 Unclassified 1504
268 Ga0213876_10006692 3300021384 Bacteria 6290
269 Ga0213876_10077853 3300021384 Bacteria 1752
270 Ga0213876_10179278 3300021384 Bacteria 1127
271 Ga0207666_1009683 3300025271 Unclassified 1306
272 Ga0207697_10000243 3300025315 Bacteria 29799
273 Ga0207697_10061707 3300025315 Unclassified 1560
274 Ga0207682_10008263 3300025893 Unclassified 4122
275 Ga0207688_10001364 3300025901 Bacteria 12684
276 Ga0207680_10280454 3300025903 Bacteria 1157
277 Ga0207699_10013563 3300025906 Bacteria 4176
278 Ga0207645_10006730 3300025907 Bacteria 8209
279 Ga0207645_10055420 3300025907 Bacteria 2531
280 Ga0207705_10008761 3300025909 Bacteria 7373
281 Ga0207705_10052221 3300025909 Bacteria 2942
282 Ga0207684_10188971 3300025910 Unclassified 1776
283 Ga0207707_10006068 3300025912 Bacteria 10575
284 Ga0207707_10036245 3300025912 Bacteria 4314
285 Ga0207707_10038237 3300025912 Bacteria 4194
286 Ga0207707_10047888 3300025912 Bacteria 3723
287 Ga0207707_10072007 3300025912 Unclassified 3012
288 Ga0207707_10448677 3300025912 Bacteria 1104
289 Ga0207695_10103699 3300025913 Unclassified 2835
290 Ga0207695_10207351 3300025913 Bacteria 1872
291 Ga0207693_10241733 3300025915 Unclassified 1417
292 Ga0207660_10009591 3300025917 Bacteria 6267
293 Ga0207660_10031278 3300025917 Unclassified 3663
294 Ga0207660_10050367 3300025917 Bacteria 2956
295 Ga0207660_10063305 3300025917 Bacteria 2666
296 Ga0207660_10157031 3300025917 Bacteria 1752
297 Ga0207662_10029986 3300025918 Bacteria 3154
298 Ga0207662_10034221 3300025918 Unclassified 2965
299 Ga0207662_10034269 3300025918 Bacteria 2963
300 Ga0207657_10182829 3300025919 Bacteria 1694
301 Ga0207649_10083637 3300025920 Bacteria 2072
302 Ga0207652_10081434 3300025921 Unclassified 2832
303 Ga0207652_10224546 3300025921 Unclassified 1692
304 Ga0207652_10246842 3300025921 Bacteria 1610
305 Ga0207652_10405205 3300025921 Bacteria 1231
306 Ga0207646_10002245 3300025922 Bacteria 22996
307 Ga0207646_10189644 3300025922 Bacteria 1857
308 Ga0207694_10000013 3300025924 Bacteria 384823
309 Ga0207650_10099401 3300025925 Unclassified 2237
310 Ga0207659_10010089 3300025926 Bacteria 5919
311 Ga0207659_10039159 3300025926 Bacteria 3303
312 Ga0207659_10126086 3300025926 Bacteria 1969
313 Ga0207659_10307760 3300025926 Unclassified 1304
314 Ga0207700_10026284 3300025928 Bacteria 4057
315 Ga0207664_10053175 3300025929 Bacteria 3205
316 Ga0207644_10013335 3300025931 Bacteria 5478
317 Ga0207644_10015127 3300025931 Bacteria 5176
318 Ga0207644_10029468 3300025931 Bacteria 3809
319 Ga0207690_10040045 3300025932 Bacteria 3061
320 Ga0207690_10096921 3300025932 Bacteria 2098
321 Ga0207706_10000678 3300025933 Bacteria 35772
322 Ga0207706_10001076 3300025933 Bacteria 27745
323 Ga0207706_10211171 3300025933 Bacteria 1701
324 Ga0207706_10339909 3300025933 Bacteria 1306
325 Ga0207686_10075571 3300025934 Unclassified 2181
326 Ga0207670_10061914 3300025936 Unclassified 2555
327 Ga0207670_10168974 3300025936 Bacteria 1638
328 Ga0207669_10059473 3300025937 Bacteria 2338
329 Ga0207669_10280057 3300025937 Unclassified 1257
330 Ga0207704_10006541 3300025938 Bacteria 5443
331 Ga0207704_10023462 3300025938 Bacteria 3326
332 Ga0207665_10010024 3300025939 Bacteria 6221
333 Ga0207691_10072509 3300025940 Bacteria 3106
334 Ga0207691_10099183 3300025940 Bacteria 2601
335 Ga0207691_10140969 3300025940 Unclassified 2125
336 Ga0207691_10224002 3300025940 Bacteria 1630
337 Ga0207711_10017992 3300025941 Bacteria 5873
338 Ga0207689_10108809 3300025942 Bacteria 2278
339 Ga0207661_10004028 3300025944 Bacteria 10272
340 Ga0207661_10017547 3300025944 Bacteria 5299
341 Ga0207661_10031598 3300025944 Bacteria 4093
342 Ga0207661_10082885 3300025944 Unclassified 2653
343 Ga0207661_10088037 3300025944 Unclassified 2580
344 Ga0207679_10068149 3300025945 Bacteria 2672
345 Ga0207679_10086896 3300025945 Unclassified 2406
346 Ga0207679_10197517 3300025945 Unclassified 1678
347 Ga0207679_10252915 3300025945 Bacteria 1499
348 Ga0207667_10008326 3300025949 Bacteria 12331
349 Ga0207667_10232577 3300025949 Bacteria 1887
350 Ga0207651_10026942 3300025960 Bacteria 3601
351 Ga0207651_10060171 3300025960 Bacteria 2635
352 Ga0207651_10125255 3300025960 Bacteria 1956
353 Ga0207651_10140549 3300025960 Unclassified 1864
354 Ga0207712_10212297 3300025961 Bacteria 1542
355 Ga0207640_10068932 3300025981 Bacteria 2372
356 Ga0207640_10262588 3300025981 Bacteria 1346
357 Ga0207658_10052833 3300025986 Unclassified 3000
358 Ga0207658_10096163 3300025986 Bacteria 2309
359 Ga0207677_10070345 3300026023 Bacteria 2466
360 Ga0207677_10077518 3300026023 Bacteria 2370
361 Ga0207639_10155849 3300026041 Bacteria 1919
362 Ga0207678_10026706 3300026067 Bacteria 5037
363 Ga0207678_10032645 3300026067 Bacteria 4537
364 Ga0207678_10219850 3300026067 Bacteria 1626
365 Ga0207708_10074616 3300026075 Bacteria 2600
366 Ga0207708_10304466 3300026075 Unclassified 1297
367 Ga0207702_10007969 3300026078 Bacteria 8977
368 Ga0207648_10086676 3300026089 Unclassified 2732
369 Ga0207648_10216154 3300026089 Bacteria 1702
370 Ga0207648_10232829 3300026089 Unclassified 1639
371 Ga0207648_10261287 3300026089 Unclassified 1545
372 Ga0207676_10024334 3300026095 Bacteria 4480
373 Ga0207674_10010804 3300026116 Bacteria 10295
374 Ga0207674_10096509 3300026116 Archaea 2941
375 Ga0207674_10398251 3300026116 Unclassified 1331
376 Ga0207675_100047303 3300026118 Bacteria 4017
377 Ga0207675_100263201 3300026118 Bacteria 1672
378 Ga0207683_10031155 3300026121 Bacteria 4628
379 Ga0207683_10314681 3300026121 Unclassified 1433
380 Ga0207683_10321541 3300026121 Bacteria 1417
381 Ga0207698_10029976 3300026142 Unclassified 3905
382 Ga0207698_10036228 3300026142 Bacteria 3619
383 Ga0207698_10461933 3300026142 Unclassified 1228
384 Ga0207698_10554115 3300026142 Unclassified 1127
385 Ga0209969_1004990 3300027360 Unclassified 1857
386 Ga0210000_1009777 3300027462 Unclassified 1415
387 Ga0209999_1004062 3300027543 Bacteria 2631
388 Ga0209999_1011652 3300027543 Unclassified 1592
389 Ga0209966_1000835 3300027695 Bacteria 6021
390 Ga0209998_10001531 3300027717 Bacteria 5557
391 Ga0207428_10008099 3300027907 Bacteria 9530
392 Ga0207428_10011128 3300027907 Bacteria 7985
393 Ga0207428_10018267 3300027907 Bacteria 5992
394 Ga0268266_10258488 3300028379 Bacteria 1613
395 Ga0268266_10581410 3300028379 Bacteria 1075
396 Ga0268265_10384480 3300028380 Unclassified 1292
397 Ga0268265_10685366 3300028380 Archaea 988
398 Ga0268264_10042247 3300028381 Bacteria 3774
399 Ga0268264_10183307 3300028381 Bacteria 1903
400 Ga0316182_1369244 3300030745 Archaea 1841
401 Ga0307408_100045780 3300031548 Bacteria 3126
402 Ga0307408_100052537 3300031548 Unclassified 2939
403 Ga0307408_100115716 3300031548 Bacteria 2068
404 Ga0307408_100336288 3300031548 Bacteria 1277
405 Ga0307408_100461771 3300031548 Bacteria 1104
406 Ga0307405_10003383 3300031731 Bacteria 7317
407 Ga0307405_10181513 3300031731 Bacteria 1511
408 Ga0307405_10409806 3300031731 Bacteria 1063
409 Ga0307413_10057264 3300031824 Bacteria 2382
410 Ga0307413_10088146 3300031824 Bacteria 2012
411 Ga0307413_10129056 3300031824 Bacteria 1727
412 Ga0307413_10203042 3300031824 Bacteria 1433
413 Ga0307413_10334127 3300031824 Unclassified 1163
414 Ga0307410_10005956 3300031852 Bacteria 6522
415 Ga0307410_10039376 3300031852 Bacteria 3103
416 Ga0307410_10131626 3300031852 Bacteria 1838
417 Ga0307410_10146773 3300031852 Bacteria 1751
418 Ga0307410_10165404 3300031852 Unclassified 1662
419 Ga0307410_10283274 3300031852 Bacteria 1301
420 Ga0307406_10048215 3300031901 Bacteria 2689
421 Ga0307406_10074261 3300031901 Bacteria 2238
422 Ga0307406_10256475 3300031901 Bacteria 1320
423 Ga0307407_10000271 3300031903 Bacteria 15193
424 Ga0307407_10008465 3300031903 Unclassified 4726
425 Ga0307407_10080861 3300031903 Bacteria 1965
426 Ga0307407_10255377 3300031903 Bacteria 1203
427 Ga0307407_10280764 3300031903 Bacteria 1153
428 Ga0307412_10297864 3300031911 Bacteria 1273
429 Ga0307412_10332252 3300031911 Bacteria 1213
430 Ga0307409_100034873 3300031995 Bacteria 3681
431 Ga0307409_100035362 3300031995 Bacteria 3660
432 Ga0307409_100065329 3300031995 Unclassified 2862
433 Ga0307409_100186676 3300031995 Bacteria 1841
434 Ga0307409_100574660 3300031995 Bacteria 1110
435 Ga0307409_100608770 3300031995 Bacteria 1080
436 Ga0307416_100001765 3300032002 Bacteria 11979
437 Ga0307416_100040738 3300032002 Bacteria 3612
438 Ga0307416_100098067 3300032002 Bacteria 2540
439 Ga0307416_100255554 3300032002 Bacteria 1708
440 Ga0307416_100311445 3300032002 Bacteria 1571
441 Ga0307414_10001221 3300032004 Bacteria 13241
442 Ga0307414_10006643 3300032004 Bacteria 6467
443 Ga0307414_10065313 3300032004 Bacteria 2596
444 Ga0307414_10171151 3300032004 Bacteria 1737
445 Ga0307414_10313073 3300032004 Bacteria 1333
446 Ga0307411_10022701 3300032005 Bacteria 3701
447 Ga0307411_10270638 3300032005 Bacteria 1347
448 Ga0307415_100102977 3300032126 Bacteria 2099
449 Ga0307415_100316665 3300032126 Unclassified 1299
450 Ga0373959_0010404 3300034820 Bacteria 1624
451 Ga0373928_0041884 3300035084 Bacteria 1054
452 Ga0373932_0116300 3300035112 Unclassified 887
453 Ga0373931_0127375 3300035691 Bacteria 1462
454 Ga0373935_0062074 3300035692 Bacteria 2393
455 Ga0373947_0186082 3300035725 Bacteria 1354
456 Ga0373937_0006173 3300036401 Bacteria 10319
457 Ga0373925_0143061 3300037068 Bacteria 1873
458 Ga0373925_0465074 3300037068 Bacteria 1037
459 Ga0395900_0400038 3300037418 Bacteria 1338
460 Ga0395898_0556106 3300037466 Unclassified 1090
461 Ga0395905_0040898 3300037471 Bacteria 4348
462 Ga0242420_005754 3300038996 Bacteria 1935
463 Ga0436365_0176886 3300039437 Bacteria 1507
464 Ga0436365_1380568 3300039437 Bacteria 4854
465 Ga0451807_1970742 3300041486 Bacteria 1589
466 Ga0439457_013567 3300042014 Bacteria 1830
467 Ga0450898_006139 3300042134 Bacteria 1837
468 Ga0439434_0016106 3300042435 Bacteria 2233
469 Ga0439434_0019082 3300042435 Bacteria 2055
470 Ga0451577_0003443 3300042876 Bacteria 17622
471 Ga0451577_0071465 3300042876 Bacteria 3095
472 Ga0451577_0083324 3300042876 Bacteria 2852
473 Ga0439440_0024587 3300042993 Bacteria 1382
474 Ga0453684_0140327 3300044712 Bacteria 2887
475 Ga0453684_0859240 3300044712 Unclassified 974
476 Ga0466959_0078120 3300045049 Bacteria 2387
477 Ga0451576_0131975 3300045051 Bacteria 2604
478 Ga0495603_0010610 3300046455 Bacteria 5582
479 Ga0495629_0338377 3300046459 Bacteria 1028
480 Ga0495643_0002127 3300046522 Bacteria 16326
481 Ga0495665_0226428 3300046531 Bacteria 966
482 Ga0495587_0037940 3300046536 Unclassified 2891
483 Ga0495645_0188991 3300046543 Bacteria 1405
484 Ga0495658_0125922 3300046683 Bacteria 1555
485 Ga0495672_0005599 3300047320 Bacteria 9920
486 Ga0495675_0058825 3300047444 Unclassified 2437
487 Ga0495675_0211512 3300047444 Bacteria 1177
488 Ga0495684_0095538 3300047471 Bacteria 2250
489 Ga0496104_0034910 3300048907 Bacteria 4692
490 Ga0496108_0016923 3300048911 Bacteria 5958
491 Ga0496108_0589329 3300048911 Unclassified 969
492 Ga0496109_0001056 3300048912 Bacteria 22767
493 Ga0496109_0154670 3300048912 Bacteria 2148
494 Ga0496110_0010353 3300048913 Bacteria 7580
495 Ga0496112_0019481 3300048915 Bacteria 6406
496 Ga0496112_0092427 3300048915 Bacteria 2995
497 Ga0496112_0110097 3300048915 Unclassified 2724
498 Ga0496112_0343031 3300048915 Unclassified 1437
499 Ga0496112_0514130 3300048915 Bacteria 1132
500 Ga0496113_0000741 3300048916 Bacteria 16766
501 Ga0501031_0064961 3300049568 Unclassified 2377
502 Ga0501032_0000283 3300049569 Bacteria 42856
503 Ga0501032_0024684 3300049569 Bacteria 4148
504 Ga0501033_0010442 3300049570 Bacteria 7123
505 Ga0501034_0001054 3300049571 Bacteria 39163
506 Ga0501034_0084119 3300049571 Bacteria 3183
507 Ga0501034_0184960 3300049571 Bacteria 2047
508 Ga0501034_0282255 3300049571 Bacteria 1600
509 Ga0501036_0032909 3300049572 Bacteria 4383
510 Ga0501036_0091980 3300049572 Bacteria 2562
511 Ga0501036_0106793 3300049572 Unclassified 2367
512 Ga0501037_0056179 3300049573 Bacteria 2876
513 Ga0501037_0227692 3300049573 Bacteria 1309
514 Ga0501038_0001785 3300049574 Bacteria 19959
515 Ga0501038_0035049 3300049574 Bacteria 4410
516 Ga0501038_0092276 3300049574 Bacteria 2536
517 Ga0501039_0123256 3300049575 Unclassified 2032
518 Ga0501039_0144668 3300049575 Bacteria 1868
519 Ga0501039_0247912 3300049575 Bacteria 1400
520 Ga0501040_0070009 3300049576 Bacteria 2420
521 Ga0501041_0103626 3300049577 Bacteria 1762
522 Ga0501042_0127758 3300049578 Unclassified 1831
523 Ga0501043_0004051 3300049579 Bacteria 11989
524 Ga0501043_0111656 3300049579 Bacteria 2146
525 Ga0501046_0003338 3300049580 Bacteria 14747
526 Ga0501046_0039685 3300049580 Unclassified 3768
527 Ga0501046_0186573 3300049580 Bacteria 1548
528 Ga0501046_0290757 3300049580 Bacteria 1195
529 Ga0501047_0006227 3300049581 Bacteria 11217
530 Ga0501047_0006357 3300049581 Bacteria 11109
531 Ga0501047_0007362 3300049581 Bacteria 10351
532 Ga0501047_0007615 3300049581 Bacteria 10191
533 Ga0501047_0031441 3300049581 Bacteria 5119
534 Ga0501048_0005838 3300049582 Bacteria 9364
535 Ga0501048_0105431 3300049582 Unclassified 1990
536 Ga0501048_0118851 3300049582 Bacteria 1867
537 Ga0501048_0149234 3300049582 Bacteria 1653
538 Ga0501067_0029589 3300049583 Bacteria 3036
539 Ga0501067_0048541 3300049583 Bacteria 2354
540 Ga0501067_0049043 3300049583 Unclassified 2340
541 Ga0501067_0069041 3300049583 Bacteria 1957
542 Ga0501068_0002554 3300049584 Bacteria 9657
543 Ga0501068_0009538 3300049584 Bacteria 5435
544 Ga0501069_0051127 3300049585 Unclassified 2299
545 Ga0501069_0173861 3300049585 Bacteria 1243
546 Ga0501070_0175187 3300049586 Bacteria 1766
547 Ga0501071_0062918 3300049587 Bacteria 2689
548 Ga0501072_0007960 3300049588 Bacteria 8044
549 Ga0501072_0023743 3300049588 Bacteria 4763
550 Ga0501073_0004342 3300049589 Bacteria 10645
551 Ga0501073_0169454 3300049589 Unclassified 1511
552 Ga0501074_0157492 3300049590 Bacteria 1622
553 Ga0501076_0042138 3300049592 Bacteria 3594
554 Ga0501077_0016848 3300049593 Bacteria 4609
555 Ga0501235_000099 3300049669 Bacteria 13729
556 Ga0501221_007215 3300049704 Bacteria 1899
557 Ga0501079_0033271 3300049741 Bacteria 3966
558 Ga0501079_0098778 3300049741 Bacteria 2263
559 Ga0501080_0004226 3300049742 Bacteria 12742
560 Ga0501080_0278366 3300049742 Unclassified 1521
561 Ga0501080_0643584 3300049742 Bacteria 938
562 Ga0501083_0033764 3300049744 Bacteria 3501
563 Ga0501083_0035783 3300049744 Bacteria 3391
564 Ga0501083_0171369 3300049744 Bacteria 1418
565 Ga0501266_002054 3300049763 Bacteria 2535
566 Ga0501035_0007258 3300049822 Bacteria 10370
567 Ga0501035_0109422 3300049822 Bacteria 2422
568 Ga0501044_0008225 3300049823 Bacteria 11445
569 Ga0501044_0030362 3300049823 Bacteria 5697
570 Ga0501044_0054992 3300049823 Bacteria 4089
571 Ga0501044_0082867 3300049823 Bacteria 3244
572 Ga0501044_0109438 3300049823 Bacteria 2772
573 Ga0501044_0111196 3300049823 Bacteria 2747
574 Ga0501045_0011906 3300049824 Bacteria 6114
575 Ga0501045_0150584 3300049824 Bacteria 1731
576 nmdc:mga05p37_178732_c1 3300050507 Bacteria 2583
577 nmdc:mga05p37_533284_c1 3300050507 Bacteria 1340
578 nmdc:mga05p37_67148_c1 3300050507 Bacteria 4412
579 nmdc:mga05p37_79_c1 3300050507 Bacteria 85182
580 nmdc:mga09592_76607_c1 3300050508 Bacteria 2844
581 nmdc:mga09592_79937_c1 3300050508 Bacteria 2784
582 nmdc:mga0qj67_103027_c1 3300050509 Bacteria 2302
583 nmdc:mga0qj67_2379_c1 3300050509 Bacteria 13395
584 nmdc:mga0qj67_57261_c1 3300050509 Bacteria 3090
585 nmdc:mga0qj67_9693_c1 3300050509 Bacteria 7172
586 nmdc:mga06r32_115742_c1 3300050510 Bacteria 2641
587 nmdc:mga06r32_36344_c1 3300050510 Bacteria 4653
588 nmdc:mga06r32_37809_c1 3300050510 Bacteria 4567
589 nmdc:mga08y16_15413_c1 3300050511 Bacteria 8039
590 nmdc:mga08y16_195_c1 3300050511 Bacteria 54659
591 nmdc:mga08y16_198120_c1 3300050511 Bacteria 2081
592 nmdc:mga08y16_27389_c1 3300050511 Archaea 6006
593 nmdc:mga08y16_274457_c1 3300050511 Bacteria 1740
594 nmdc:mga08y16_6257_c1 3300050511 Bacteria 12482
595 nmdc:mga08y16_752675_c1 3300050511 Unclassified 970
596 nmdc:mga0n895_14349_c1 3300050512 Bacteria 7193
597 nmdc:mga0n895_1877_c1 3300050512 Bacteria 16061
598 nmdc:mga0n895_401063_c1 3300050512 Unclassified 1387
599 nmdc:mga0n895_81073_c1 3300050512 Bacteria 3233
600 nmdc:mga0rr50_264086_c1 3300050513 Bacteria 1433
601 nmdc:mga0rr50_32544_c1 3300050513 Bacteria 3716
602 nmdc:mga08x19_178987_c1 3300050514 Unclassified 1447
603 nmdc:mga0a205_188426_c1 3300050515 Archaea 1955
604 nmdc:mga0a205_67175_c1 3300050515 Unclassified 3463
605 Ga0501084_0018590 3300054114 Bacteria 5784
606 Ga0501084_0493143 3300054114 Unclassified 1035
607 Ga0590071_000216 3300059421 Bacteria 16939
608 Ga0590071_027722 3300059421 Bacteria 1345
609 Ga0590074_001182 3300059423 Bacteria 4118
610 Ga0590075_000312 3300059424 Bacteria 13529
611 Ga0590077_000022 3300059426 Bacteria 35588
612 Ga0501082_0008705 3300060353 Bacteria 8752
613 Ga0501082_0010200 3300060353 Bacteria 8088
614 Ga0501082_0028115 3300060353 Bacteria 4846
615 Ga0501082_0125068 3300060353 Bacteria 2230
616 Ga0501082_0184067 3300060353 Bacteria 1817
617 Ga0530510_0019730 3300061734 Bacteria 4789
618 Ga0530510_0045356 3300061734 Bacteria 3176
619 Ga0070696_100131353
620 rootL2_10043223
621 Ga0065704_10194550
622 Ga0065712_10079606
623 Ga0065712_10081364
624 Ga0065715_10006660
625 Ga0065715_10089203
626 Ga0065707_10084277
627 Ga0065707_10112824
628 Ga0070658_10024736
629 Ga0070658_10153904
630 Ga0070676_10003717
631 Ga0070676_10037129
632 Ga0070676_10047239
633 Ga0070676_10055489
634 Ga0070676_10158330
635 Ga0070683_100014687
636 Ga0070683_100018022
637 Ga0070683_100051765
638 Ga0070683_100058306
639 Ga0070683_100253712
640 Ga0070683_100291693
641 Ga0070690_100014476
642 Ga0070690_100029563
643 Ga0070690_100032575
644 Ga0070670_100116494
645 Ga0070677_10083046
646 Ga0068869_100075805
647 Ga0070666_10024367
648 Ga0070666_10037180
649 Ga0070666_10225792
650 Ga0070680_100005756
651 Ga0070680_100024254
652 Ga0070680_100026658
653 Ga0070680_100036068
654 Ga0070680_100192473
655 Ga0070682_100000385
656 Ga0070682_100003109
657 Ga0070682_100005029
658 Ga0070682_100294240
659 Ga0068868_100020905
660 Ga0068868_100034462
661 Ga0068868_100114703
662 Ga0070660_100014271
663 Ga0070660_100322977
664 Ga0070660_100575966
665 Ga0070689_100017528
666 Ga0070689_100056623
667 Ga0070689_100153186
668 Ga0070689_100199053
669 Ga0070689_100274362
670 Ga0070687_100007321
671 Ga0070687_100035254
672 Ga0070687_100053364
673 Ga0070661_100094903
674 Ga0070661_100096666
675 Ga0070661_100223382
676 Ga0070692_10161463
677 Ga0070669_100000513
678 Ga0070669_100025932
679 Ga0070669_100083179
680 Ga0070675_100001517
681 Ga0070675_100006870
682 Ga0070675_100032007
683 Ga0070675_100082760
684 Ga0070675_100486362
685 Ga0070671_100019482
686 Ga0070671_100053114
687 Ga0070671_100139202
688 Ga0070671_100408432
689 Ga0070674_100003654
690 Ga0070674_100260780
691 Ga0070674_100433278
692 Ga0070673_100031457
693 Ga0070673_100036165
694 Ga0070673_100102426
695 Ga0070673_100206755
696 Ga0070688_100165960
697 Ga0070659_100007890
698 Ga0070659_100018354
699 Ga0070659_100145968
700 Ga0070667_100037945
701 Ga0070667_100053209
702 Ga0070709_10016582
703 Ga0070709_10078695
704 Ga0070714_100001912
705 Ga0070700_100015909
706 Ga0070700_100041101
707 Ga0070700_100164583
708 Ga0070694_100104466
709 Ga0070708_100000184
710 Ga0070663_100009457
711 Ga0070663_100022874
712 Ga0070663_100047381
713 Ga0070678_100051747
714 Ga0070678_100117935
715 Ga0070678_100190444
716 Ga0070678_100251994
717 Ga0070678_100320064
718 Ga0070678_100390858
719 Ga0070662_100000274
720 Ga0070662_100004383
721 Ga0070662_100047053
722 Ga0070662_100206197
723 Ga0070662_100234568
724 Ga0070662_100343670
725 Ga0070681_10015520
726 Ga0070681_10030614
727 Ga0070681_10035531
728 Ga0070681_10245564
729 Ga0070681_10284870
730 Ga0070681_10405707
731 Ga0068867_100091603
732 Ga0068867_100270952
733 Ga0070685_10002962
734 Ga0070685_10047844
735 Ga0070706_100098633
736 Ga0070707_100004384
737 Ga0070707_100227587
738 Ga0070698_100033572
739 Ga0070699_100046548
740 Ga0070699_100050173
741 Ga0070699_100203473
742 Ga0070679_100000787
743 Ga0070679_100037297
744 Ga0070679_100037692
745 Ga0070679_100088200
746 Ga0070679_100145985
747 Ga0070679_100209361
748 Ga0070679_100222906
749 Ga0070679_100373283
750 Ga0070684_100027932
751 Ga0070684_100145383
752 Ga0070697_100109088
753 Ga0068853_100185067
754 Ga0070672_100010270
755 Ga0070672_100020589
756 Ga0070672_100049120
757 Ga0070672_100182408
758 Ga0070686_100000009
759 Ga0070686_100015338
760 Ga0070695_100019535
761 Ga0070695_100042162
762 Ga0070696_100003007
763 Ga0070696_100319065
764 Ga0070696_100361461
765 Ga0070693_100075596
766 Ga0070665_100234259
767 Ga0070665_100301149
768 Ga0070665_100536111
769 Ga0070704_100140177
770 Ga0070704_100141169
771 Ga0068855_100006396
772 Ga0068855_100168946
773 Ga0068855_100220311
774 Ga0068855_100362798
775 Ga0070664_100009845
776 Ga0070664_100035582
777 Ga0070664_100043193
778 Ga0070664_100206381
779 Ga0070664_100328391
780 Ga0070664_100459969
781 Ga0068857_100007853
782 Ga0068857_100021761
783 Ga0068854_100078824
784 Ga0068854_100083306
785 Ga0068854_100150474
786 Ga0068854_100384473
787 Ga0068856_100005203
788 Ga0070702_100030837
789 Ga0070702_100077157
790 Ga0070702_100119380
791 Ga0068852_100044816
792 Ga0068852_100282682
793 Ga0068859_100023846
794 Ga0068859_100072390
795 Ga0068859_100189569
796 Ga0068859_100507075
797 Ga0068864_100016008
798 Ga0068866_10045781
799 Ga0068866_10100396
800 Ga0068863_100021622
801 Ga0068858_100124666
802 Ga0068858_100142441
803 Ga0068860_100030785
804 Ga0068862_100015673
805 Ga0081539_10000693
806 Ga0070712_100246169
807 Ga0097621_100100848
808 Ga0097621_100387049
809 Ga0075428_100224384
810 Ga0075430_100001246
811 Ga0075430_100108278
812 Ga0075430_100151881
813 Ga0075430_100242966
814 Ga0075431_100007932
815 Ga0075431_100021106
816 Ga0075431_100022476
817 Ga0075431_100037056
818 Ga0075431_100092672
819 Ga0075431_100425409
820 Ga0075433_10009681
821 Ga0075433_10197025
822 Ga0075434_100001831
823 Ga0075434_100035455
824 Ga0075434_100265729
825 Ga0075429_100003535
826 Ga0075429_100119434
827 Ga0075429_100143544
828 Ga0068865_100102756
829 Ga0097620_100023846
830 Ga0097620_100072390
831 Ga0097620_100189571
832 Ga0097620_100507089
833 Ga0075435_100006040
834 Ga0105240_10191460
835 Ga0105240_10228305
836 Ga0111539_10000435
837 Ga0111539_10019080
838 Ga0111539_10019229
839 Ga0111539_10061044
840 Ga0111539_10091796
841 Ga0111539_10163097
842 Ga0105245_10031577
843 Ga0105245_10183764
844 Ga0105245_10605581
845 Ga0114129_10002025
846 Ga0114129_10171016
847 Ga0114129_10186241
848 Ga0105243_10124002
849 Ga0105243_10216769
850 Ga0105241_10034415
851 Ga0105241_10271178
852 Ga0105242_10024384
853 Ga0105248_10003724
854 Ga0105248_10032627
855 Ga0105248_10049824
856 Ga0105248_10051768
857 Ga0105248_10331607
858 Ga0105248_10366403
859 Ga0105248_10488022
860 Ga0105238_10000223
861 Ga0105238_10019257
862 Ga0105249_10000456
863 Ga0105249_10272538
864 Ga0099796_10003303
865 Ga0157371_10094420
866 Ga0157371_10316215
867 Ga0157370_10067053
868 Ga0157370_10121658
869 Ga0157369_10035742
870 Ga0157369_10035989
871 Ga0157369_10110590
872 Ga0157369_10183834
873 Ga0157369_10747221
874 Ga0157378_10010026
875 Ga0157378_10011892
876 Ga0163162_10431378
877 Ga0157372_10105043
878 Ga0157372_10403743
879 Ga0157372_10410893
880 Ga0157375_10087186
881 Ga0157375_10468517
882 Ga0163163_10141789
883 Ga0163163_10834127
884 Ga0163161_10097845
885 Ga0163161_10210027
886 Ga0213876_10006692
887 Ga0213876_10077853
888 Ga0213876_10179278
889 Ga0207666_1009683
890 Ga0207697_10000243
891 Ga0207697_10061707
892 Ga0207682_10008263
893 Ga0207688_10001364
894 Ga0207680_10280454
895 Ga0207699_10013563
896 Ga0207645_10006730
897 Ga0207645_10055420
898 Ga0207705_10008761
899 Ga0207705_10052221
900 Ga0207684_10188971
901 Ga0207707_10006068
902 Ga0207707_10036245
903 Ga0207707_10038237
904 Ga0207707_10047888
905 Ga0207707_10072007
906 Ga0207707_10448677
907 Ga0207695_10103699
908 Ga0207695_10207351
909 Ga0207693_10241733
910 Ga0207660_10009591
911 Ga0207660_10031278
912 Ga0207660_10050367
913 Ga0207660_10063305
914 Ga0207660_10157031
915 Ga0207662_10029986
916 Ga0207662_10034221
917 Ga0207662_10034269
918 Ga0207657_10182829
919 Ga0207649_10083637
920 Ga0207652_10081434
921 Ga0207652_10224546
922 Ga0207652_10246842
923 Ga0207652_10405205
924 Ga0207646_10002245
925 Ga0207646_10189644
926 Ga0207694_10000013
927 Ga0207650_10099401
928 Ga0207659_10010089
929 Ga0207659_10039159
930 Ga0207659_10126086
931 Ga0207659_10307760
932 Ga0207700_10026284
933 Ga0207664_10053175
934 Ga0207644_10013335
935 Ga0207644_10015127
936 Ga0207644_10029468
937 Ga0207690_10040045
938 Ga0207690_10096921
939 Ga0207706_10000678
940 Ga0207706_10001076
941 Ga0207706_10211171
942 Ga0207706_10339909
943 Ga0207686_10075571
944 Ga0207670_10061914
945 Ga0207670_10168974
946 Ga0207669_10059473
947 Ga0207669_10280057
948 Ga0207704_10006541
949 Ga0207704_10023462
950 Ga0207665_10010024
951 Ga0207691_10072509
952 Ga0207691_10099183
953 Ga0207691_10140969
954 Ga0207691_10224002
955 Ga0207711_10017992
956 Ga0207689_10108809
957 Ga0207661_10004028
958 Ga0207661_10017547
959 Ga0207661_10031598
960 Ga0207661_10082885
961 Ga0207661_10088037
962 Ga0207679_10068149
963 Ga0207679_10086896
964 Ga0207679_10197517
965 Ga0207679_10252915
966 Ga0207667_10008326
967 Ga0207667_10232577
968 Ga0207651_10026942
969 Ga0207651_10060171
970 Ga0207651_10125255
971 Ga0207651_10140549
972 Ga0207712_10212297
973 Ga0207640_10068932
974 Ga0207640_10262588
975 Ga0207658_10052833
976 Ga0207658_10096163
977 Ga0207677_10070345
978 Ga0207677_10077518
979 Ga0207639_10155849
980 Ga0207678_10026706
981 Ga0207678_10032645
982 Ga0207678_10219850
983 Ga0207708_10074616
984 Ga0207708_10304466
985 Ga0207702_10007969
986 Ga0207648_10086676
987 Ga0207648_10216154
988 Ga0207648_10232829
989 Ga0207648_10261287
990 Ga0207676_10024334
991 Ga0207674_10010804
992 Ga0207674_10096509
993 Ga0207674_10398251
994 Ga0207675_100047303
995 Ga0207675_100263201
996 Ga0207683_10031155
997 Ga0207683_10314681
998 Ga0207683_10321541
999 Ga0207698_10029976
1000 Ga0207698_10036228
1001 Ga0207698_10461933
1002 Ga0207698_10554115
1003 Ga0209969_1004990
1004 Ga0210000_1009777
1005 Ga0209999_1004062
1006 Ga0209999_1011652
1007 Ga0209966_1000835
1008 Ga0209998_10001531
1009 Ga0207428_10008099
1010 Ga0207428_10011128
1011 Ga0207428_10018267
1012 Ga0268266_10258488
1013 Ga0268266_10581410
1014 Ga0268265_10384480
1015 Ga0268265_10685366
1016 Ga0268264_10042247
1017 Ga0268264_10183307
1018 Ga0316182_1369244
1019 Ga0307408_100045780
1020 Ga0307408_100052537
1021 Ga0307408_100115716
1022 Ga0307408_100336288
1023 Ga0307408_100461771
1024 Ga0307405_10003383
1025 Ga0307405_10181513
1026 Ga0307405_10409806
1027 Ga0307413_10057264
1028 Ga0307413_10088146
1029 Ga0307413_10129056
1030 Ga0307413_10203042
1031 Ga0307413_10334127
1032 Ga0307410_10005956
1033 Ga0307410_10039376
1034 Ga0307410_10131626
1035 Ga0307410_10146773
1036 Ga0307410_10165404
1037 Ga0307410_10283274
1038 Ga0307406_10048215
1039 Ga0307406_10074261
1040 Ga0307406_10256475
1041 Ga0307407_10000271
1042 Ga0307407_10008465
1043 Ga0307407_10080861
1044 Ga0307407_10255377
1045 Ga0307407_10280764
1046 Ga0307412_10297864
1047 Ga0307412_10332252
1048 Ga0307409_100034873
1049 Ga0307409_100035362
1050 Ga0307409_100065329
1051 Ga0307409_100186676
1052 Ga0307409_100574660
1053 Ga0307409_100608770
1054 Ga0307416_100001765
1055 Ga0307416_100040738
1056 Ga0307416_100098067
1057 Ga0307416_100255554
1058 Ga0307416_100311445
1059 Ga0307414_10001221
1060 Ga0307414_10006643
1061 Ga0307414_10065313
1062 Ga0307414_10171151
1063 Ga0307414_10313073
1064 Ga0307411_10022701
1065 Ga0307411_10270638
1066 Ga0307415_100102977
1067 Ga0307415_100316665
1068 Ga0373959_0010404
1069 Ga0373928_0041884
1070 Ga0373932_0116300
1071 Ga0373931_0127375
1072 Ga0373935_0062074
1073 Ga0373947_0186082
1074 Ga0373937_0006173
1075 Ga0373925_0143061
1076 Ga0373925_0465074
1077 Ga0395900_0400038
1078 Ga0395898_0556106
1079 Ga0395905_0040898
1080 Ga0242420_005754
1081 Ga0436365_0176886
1082 Ga0436365_1380568
1083 Ga0451807_1970742
1084 Ga0439457_013567
1085 Ga0450898_006139
1086 Ga0439434_0016106
1087 Ga0439434_0019082
1088 Ga0451577_0003443
1089 Ga0451577_0071465
1090 Ga0451577_0083324
1091 Ga0439440_0024587
1092 Ga0453684_0140327
1093 Ga0453684_0859240
1094 Ga0466959_0078120
1095 Ga0451576_0131975
1096 Ga0495603_0010610
1097 Ga0495629_0338377
1098 Ga0495643_0002127
1099 Ga0495665_0226428
1100 Ga0495587_0037940
1101 Ga0495645_0188991
1102 Ga0495658_0125922
1103 Ga0495672_0005599
1104 Ga0495675_0058825
1105 Ga0495675_0211512
1106 Ga0495684_0095538
1107 Ga0496104_0034910
1108 Ga0496108_0016923
1109 Ga0496108_0589329
1110 Ga0496109_0001056
1111 Ga0496109_0154670
1112 Ga0496110_0010353
1113 Ga0496112_0019481
1114 Ga0496112_0092427
1115 Ga0496112_0110097
1116 Ga0496112_0343031
1117 Ga0496112_0514130
1118 Ga0496113_0000741
1119 Ga0501031_0064961
1120 Ga0501032_0000283
1121 Ga0501032_0024684
1122 Ga0501033_0010442
1123 Ga0501034_0001054
1124 Ga0501034_0084119
1125 Ga0501034_0184960
1126 Ga0501034_0282255
1127 Ga0501036_0032909
1128 Ga0501036_0091980
1129 Ga0501036_0106793
1130 Ga0501037_0056179
1131 Ga0501037_0227692
1132 Ga0501038_0001785
1133 Ga0501038_0035049
1134 Ga0501038_0092276
1135 Ga0501039_0123256
1136 Ga0501039_0144668
1137 Ga0501039_0247912
1138 Ga0501040_0070009
1139 Ga0501041_0103626
1140 Ga0501042_0127758
1141 Ga0501043_0004051
1142 Ga0501043_0111656
1143 Ga0501046_0003338
1144 Ga0501046_0039685
1145 Ga0501046_0186573
1146 Ga0501046_0290757
1147 Ga0501047_0006227
1148 Ga0501047_0006357
1149 Ga0501047_0007362
1150 Ga0501047_0007615
1151 Ga0501047_0031441
1152 Ga0501048_0005838
1153 Ga0501048_0105431
1154 Ga0501048_0118851
1155 Ga0501048_0149234
1156 Ga0501067_0029589
1157 Ga0501067_0048541
1158 Ga0501067_0049043
1159 Ga0501067_0069041
1160 Ga0501068_0002554
1161 Ga0501068_0009538
1162 Ga0501069_0051127
1163 Ga0501069_0173861
1164 Ga0501070_0175187
1165 Ga0501071_0062918
1166 Ga0501072_0007960
1167 Ga0501072_0023743
1168 Ga0501073_0004342
1169 Ga0501073_0169454
1170 Ga0501074_0157492
1171 Ga0501076_0042138
1172 Ga0501077_0016848
1173 Ga0501235_000099
1174 Ga0501221_007215
1175 Ga0501079_0033271
1176 Ga0501079_0098778
1177 Ga0501080_0004226
1178 Ga0501080_0278366
1179 Ga0501080_0643584
1180 Ga0501083_0033764
1181 Ga0501083_0035783
1182 Ga0501083_0171369
1183 Ga0501266_002054
1184 Ga0501035_0007258
1185 Ga0501035_0109422
1186 Ga0501044_0008225
1187 Ga0501044_0030362
1188 Ga0501044_0054992
1189 Ga0501044_0082867
1190 Ga0501044_0109438
1191 Ga0501044_0111196
1192 Ga0501045_0011906
1193 Ga0501045_0150584
1194 nmdc:mga05p37_178732_c1
1195 nmdc:mga05p37_533284_c1
1196 nmdc:mga05p37_67148_c1
1197 nmdc:mga05p37_79_c1
1198 nmdc:mga09592_76607_c1
1199 nmdc:mga09592_79937_c1
1200 nmdc:mga0qj67_103027_c1
1201 nmdc:mga0qj67_2379_c1
1202 nmdc:mga0qj67_57261_c1
1203 nmdc:mga0qj67_9693_c1
1204 nmdc:mga06r32_115742_c1
1205 nmdc:mga06r32_36344_c1
1206 nmdc:mga06r32_37809_c1
1207 nmdc:mga08y16_15413_c1
1208 nmdc:mga08y16_195_c1
1209 nmdc:mga08y16_198120_c1
1210 nmdc:mga08y16_27389_c1
1211 nmdc:mga08y16_274457_c1
1212 nmdc:mga08y16_6257_c1
1213 nmdc:mga08y16_752675_c1
1214 nmdc:mga0n895_14349_c1
1215 nmdc:mga0n895_1877_c1
1216 nmdc:mga0n895_401063_c1
1217 nmdc:mga0n895_81073_c1
1218 nmdc:mga0rr50_264086_c1
1219 nmdc:mga0rr50_32544_c1
1220 nmdc:mga08x19_178987_c1
1221 nmdc:mga0a205_188426_c1
1222 nmdc:mga0a205_67175_c1
1223 Ga0501084_0018590
1224 Ga0501084_0493143
1225 Ga0590071_000216
1226 Ga0590071_027722
1227 Ga0590074_001182
1228 Ga0590075_000312
1229 Ga0590077_000022
1230 Ga0501082_0008705
1231 Ga0501082_0010200
1232 Ga0501082_0028115
1233 Ga0501082_0125068
1234 Ga0501082_0184067
1235 Ga0530510_0019730
1236 Ga0530510_0045356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

70

187

0.86

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

232

341

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kol-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/dioxygenase from nostoc punctiforme 0.8257 8 127
5wew-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fosfomycin resistance protein (fosakp) with inhibitor (any1) bound 0.797 10 130
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7933 11 126
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7821 11 128
1npb-assembly2.cif.gz_D crystal structure of the fosfomycin resistance protein from transposon tn2921 0.7683 10 130
ID Description Score Start End Superfamily
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9246 8 133 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9107 8 133 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9086 9 141 3.10.180.10
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9021 9 141 3.10.180.10
3kolA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8163 11 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V9U599-F1-model_v4 VOC family protein 0.9921 1 281 GO:0004462
GO:0046872
AF-A0A2V8HIC6-F1-model_v4 Glyoxalase 0.9918 1 281
AF-A0A7V9U599-F1-model_v4 VOC family protein 0.9886 1 281 GO:0004462
GO:0046872
AF-A0A2V8HIC6-F1-model_v4 Glyoxalase 0.9883 1 281
AF-A0A5Q4D8Q4-F1-model_v4 VOC domain-containing protein 0.988 2 281

Map