F469627

General Info

Members Datasets Scaffolds Average Seq Length
617 315 617 99

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10191413|Ga0105240_101914133
Length 119
Sequence MVSSALSTVRQGAGIAHGFVSVLPYVRPYLPTALLVLLIVYFAMNAFTGDRGLLSSNQRDEALVGKTRELAQLRAQRADLEMRARLLRDTSLSRDLLEERARSLLGFADPRDYVIRMKP

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
179 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
266 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
274 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
277 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
278 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
282 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
283 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
288 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
289 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
290 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
291 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
292 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
293 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
294 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
295 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
296 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
297 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
298 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
299 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
300 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
303 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
306 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
310 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
311 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
314 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
315 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.18
Nodule 0.16
Rhizoplane 3.89
Rhizosphere 73.42
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10013301 3300003215 Bacteria 3485
2 rootH2_10147346 3300003320 Bacteria 1815
3 Ga0055526_1070314 3300003771 Bacteria 712
4 Ga0055537_1001022 3300003773 Bacteria 12643
5 Ga0055524_1021277 3300003775 Bacteria 2155
6 Ga0055524_1053809 3300003775 Bacteria 887
7 Ga0055528_1002711 3300003790 Bacteria 9311
8 Ga0055530_10002729 3300003791 Bacteria 10945
9 Ga0055530_10033909 3300003791 Bacteria 1310
10 Ga0055531_10000966 3300003794 Bacteria 23016
11 Ga0055531_10001958 3300003794 Bacteria 14377
12 Ga0065165_1000277 3300005262 Bacteria 87540
13 Ga0065165_1001667 3300005262 Bacteria 22484
14 Ga0065165_1126859 3300005262 Archaea 614
15 Ga0070658_10145626 3300005327 Bacteria 1981
16 Ga0070658_10192462 3300005327 Bacteria 1719
17 Ga0070658_10488668 3300005327 Bacteria 1063
18 Ga0070658_11256377 3300005327 Bacteria 643
19 Ga0070658_11285186 3300005327 Bacteria 636
20 Ga0070670_100000037 3300005331 Bacteria 156070
21 Ga0070670_100114793 3300005331 Bacteria 2321
22 Ga0070670_100868082 3300005331 Bacteria 817
23 Ga0068869_100317281 3300005334 Bacteria 1263
24 Ga0070680_100053013 3300005336 Bacteria 3310
25 Ga0068868_100538291 3300005338 Bacteria 1028
26 Ga0070660_100096530 3300005339 Bacteria 2337
27 Ga0070660_100377096 3300005339 Bacteria 1171
28 Ga0070660_101671984 3300005339 Bacteria 542
29 Ga0070691_10023519 3300005341 Bacteria 2862
30 Ga0070661_100355062 3300005344 Bacteria 1151
31 Ga0070661_101566067 3300005344 Bacteria 557
32 Ga0070661_101661478 3300005344 Unclassified 541
33 Ga0070692_11057857 3300005345 Bacteria 571
34 Ga0070668_100000097 3300005347 Bacteria 53800
35 Ga0070668_100001398 3300005347 Bacteria 17348
36 Ga0070668_100006261 3300005347 Bacteria 8813
37 Ga0070668_100058909 3300005347 Bacteria 2972
38 Ga0070675_100676856 3300005354 Bacteria 939
39 Ga0070675_101250234 3300005354 Bacteria 684
40 Ga0070671_100211856 3300005355 Bacteria 1643
41 Ga0070659_100000206 3300005366 Bacteria 45867
42 Ga0070659_100005903 3300005366 Bacteria 8821
43 Ga0070659_100661812 3300005366 Bacteria 901
44 Ga0070659_100862382 3300005366 Bacteria 790
45 Ga0070659_101372480 3300005366 Bacteria 628
46 Ga0070667_100000083 3300005367 Bacteria 118261
47 Ga0070667_100061211 3300005367 Bacteria 3187
48 Ga0070667_100391499 3300005367 Bacteria 1264
49 Ga0070667_100465990 3300005367 Bacteria 1156
50 Ga0070667_100687984 3300005367 Bacteria 946
51 Ga0070705_101249291 3300005440 Bacteria 614
52 Ga0070663_100097209 3300005455 Bacteria 2192
53 Ga0070663_101262569 3300005455 Unclassified 651
54 Ga0070678_100095809 3300005456 Bacteria 2288
55 Ga0070662_100080288 3300005457 Bacteria 2428
56 Ga0070662_100302959 3300005457 Bacteria 1299
57 Ga0070681_10019846 3300005458 Bacteria 6732
58 Ga0070681_10063521 3300005458 Bacteria 3664
59 Ga0070685_10417517 3300005466 Bacteria 933
60 Ga0070679_100003462 3300005530 Bacteria 14454
61 Ga0070679_100044372 3300005530 Bacteria 4429
62 Ga0070679_100704195 3300005530 Bacteria 953
63 Ga0068853_100057502 3300005539 Bacteria 3356
64 Ga0068853_100245881 3300005539 Bacteria 1641
65 Ga0068853_100272882 3300005539 Bacteria 1558
66 Ga0068853_100395554 3300005539 Bacteria 1293
67 Ga0070686_101210451 3300005544 Bacteria 628
68 Ga0070665_100000116 3300005548 Bacteria 150141
69 Ga0070665_100000278 3300005548 Bacteria 84248
70 Ga0070665_100000483 3300005548 Bacteria 57237
71 Ga0070665_100677183 3300005548 Bacteria 1044
72 Ga0070665_100962862 3300005548 Bacteria 866
73 Ga0070665_102279935 3300005548 Unclassified 545
74 Ga0068855_100098841 3300005563 Bacteria 3361
75 Ga0068855_100114730 3300005563 Bacteria 3088
76 Ga0068855_101027662 3300005563 Bacteria 865
77 Ga0068855_101345346 3300005563 Bacteria 738
78 Ga0068855_101552010 3300005563 Bacteria 679
79 Ga0070664_100064257 3300005564 Bacteria 3130
80 Ga0070664_100304364 3300005564 Bacteria 1441
81 Ga0070664_100677070 3300005564 Bacteria 960
82 Ga0068857_101470012 3300005577 Bacteria 664
83 Ga0068854_100523656 3300005578 Bacteria 1002
84 Ga0068854_101795851 3300005578 Bacteria 562
85 Ga0068856_100876569 3300005614 Bacteria 917
86 Ga0068852_100621770 3300005616 Bacteria 1086
87 Ga0068859_100137076 3300005617 Bacteria 2521
88 Ga0068859_101044915 3300005617 Bacteria 898
89 Ga0068864_100000115 3300005618 Bacteria 79542
90 Ga0068864_100000786 3300005618 Bacteria 26635
91 Ga0068864_100026445 3300005618 Bacteria 4894
92 Ga0068861_100528720 3300005719 Bacteria 1071
93 Ga0068863_100000007 3300005841 Bacteria 257578
94 Ga0068863_100000392 3300005841 Bacteria 44421
95 Ga0068863_100152772 3300005841 Bacteria 2209
96 Ga0068863_102491844 3300005841 Bacteria 527
97 Ga0068858_100000031 3300005842 Bacteria 143397
98 Ga0068858_100004211 3300005842 Bacteria 14164
99 Ga0068858_100574859 3300005842 Bacteria 1092
100 Ga0068858_102531228 3300005842 Unclassified 507
101 Ga0068860_100000128 3300005843 Bacteria 122731
102 Ga0068860_100060495 3300005843 Bacteria 3599
103 Ga0068862_100001627 3300005844 Bacteria 20442
104 Ga0068862_100012654 3300005844 Bacteria 6983
105 Ga0068862_100171133 3300005844 Bacteria 1945
106 Ga0070717_10194214 3300006028 Bacteria 1775
107 Ga0075362_10735639 3300006177 Bacteria 516
108 Ga0075366_10050358 3300006195 Bacteria 2473
109 Ga0075366_10458226 3300006195 Bacteria 787
110 Ga0075370_10067984 3300006353 Bacteria 2034
111 Ga0097620_100137068 3300006931 Bacteria 2521
112 Ga0097620_101045082 3300006931 Bacteria 898
113 Ga0079104_1037307 3300006946 Bacteria 1159
114 Ga0105250_10026243 3300009092 Bacteria 2346
115 Ga0105240_10005944 3300009093 Bacteria 18065
116 Ga0105240_10040708 3300009093 Bacteria 5940
117 Ga0105240_10043434 3300009093 Bacteria 5719
118 Ga0105240_10188036 3300009093 Bacteria 2431
119 Ga0105240_10191413 3300009093 Bacteria 2405
120 Ga0105240_11392717 3300009093 Bacteria 737
121 Ga0105245_10908894 3300009098 Bacteria 922
122 Ga0105247_10022438 3300009101 Bacteria 3802
123 Ga0105247_10513887 3300009101 Bacteria 875
124 Ga0105241_12079668 3300009174 Bacteria 561
125 Ga0105241_12484451 3300009174 Bacteria 518
126 Ga0105248_10038574 3300009177 Bacteria 5347
127 Ga0105248_10041310 3300009177 Bacteria 5170
128 Ga0105248_10050796 3300009177 Bacteria 4651
129 Ga0105248_10907946 3300009177 Bacteria 995
130 Ga0105248_11114173 3300009177 Bacteria 892
131 Ga0105237_10695156 3300009545 Bacteria 1024
132 Ga0105238_10056774 3300009551 Bacteria 3927
133 Ga0105238_10348261 3300009551 Bacteria 1470
134 Ga0105238_10960091 3300009551 Bacteria 875
135 Ga0105238_11173114 3300009551 Bacteria 792
136 Ga0105238_11384886 3300009551 Bacteria 730
137 Ga0105249_10000410 3300009553 Bacteria 41122
138 Ga0105249_10098444 3300009553 Bacteria 2747
139 Ga0105249_10210746 3300009553 Bacteria 1907
140 Ga0105249_11515628 3300009553 Bacteria 743
141 Ga0105239_10274989 3300010375 Bacteria 1895
142 Ga0105239_10538089 3300010375 Bacteria 1330
143 Ga0105239_10729711 3300010375 Bacteria 1133
144 Ga0105239_11477333 3300010375 Bacteria 785
145 Ga0105246_10713124 3300011119 Bacteria 881
146 Ga0157319_1056325 3300012497 Bacteria 501
147 Ga0157373_10007392 3300013100 Bacteria 8175
148 Ga0157373_10007540 3300013100 Bacteria 8089
149 Ga0157373_10682914 3300013100 Bacteria 751
150 Ga0157370_10396848 3300013104 Bacteria 1270
151 Ga0157370_11797833 3300013104 Bacteria 550
152 Ga0157369_10446843 3300013105 Bacteria 1339
153 Ga0157369_10819580 3300013105 Bacteria 956
154 Ga0157374_10402262 3300013296 Bacteria 1366
155 Ga0157378_10991010 3300013297 Bacteria 874
156 Ga0163162_11891683 3300013306 Bacteria 683
157 Ga0157372_11404771 3300013307 Bacteria 805
158 Ga0157372_11410539 3300013307 Bacteria 803
159 Ga0157372_12113280 3300013307 Bacteria 647
160 Ga0157375_10205678 3300013308 Bacteria 2125
161 Ga0163163_10868359 3300014325 Bacteria 965
162 Ga0163163_11464740 3300014325 Bacteria 744
163 Ga0163163_11504384 3300014325 Bacteria 734
164 Ga0163163_11736621 3300014325 Bacteria 685
165 Ga0163163_11869384 3300014325 Bacteria 660
166 Ga0157380_11109417 3300014326 Bacteria 830
167 Ga0157377_10722912 3300014745 Bacteria 725
168 Ga0157379_10080776 3300014968 Bacteria 2913
169 Ga0157379_10174569 3300014968 Bacteria 1940
170 Ga0157379_11508367 3300014968 Bacteria 654
171 Ga0182006_1071517 3300015261 Bacteria 1285
172 Ga0163161_10527455 3300017792 Bacteria 965
173 Ga0163161_11349309 3300017792 Bacteria 621
174 Ga0213876_10035545 3300021384 Bacteria 2628
175 Ga0213876_10147319 3300021384 Bacteria 1252
176 Ga0209148_1007316 3300025254 Bacteria 2306
177 Ga0209148_1015725 3300025254 Bacteria 1316
178 Ga0209565_1000641 3300025263 Bacteria 22666
179 Ga0209673_1003300 3300025273 Bacteria 9678
180 Ga0209673_1016328 3300025273 Bacteria 2782
181 Ga0209675_1003569 3300025291 Bacteria 7324
182 Ga0209564_1004845 3300025295 Bacteria 8001
183 Ga0209564_1036944 3300025295 Bacteria 1384
184 Ga0209758_1001863 3300025297 Bacteria 23117
185 Ga0209758_1007301 3300025297 Bacteria 7578
186 Ga0209758_1008993 3300025297 Bacteria 6316
187 Ga0209050_1000200 3300025298 Bacteria 134115
188 Ga0209050_1012865 3300025298 Bacteria 3786
189 Ga0209256_1002428 3300025299 Bacteria 15246
190 Ga0209256_1002898 3300025299 Bacteria 12975
191 Ga0209257_1000225 3300025304 Bacteria 134023
192 Ga0209257_1000944 3300025304 Bacteria 40166
193 Ga0207656_10390547 3300025321 Bacteria 698
194 Ga0207696_1022235 3300025711 Bacteria 2018
195 Ga0207710_10077787 3300025900 Bacteria 1533
196 Ga0207710_10187177 3300025900 Bacteria 1018
197 Ga0207710_10677661 3300025900 Bacteria 540
198 Ga0207680_10231626 3300025903 Bacteria 1270
199 Ga0207680_10652795 3300025903 Bacteria 753
200 Ga0207643_10359984 3300025908 Bacteria 914
201 Ga0207705_10007993 3300025909 Bacteria 7759
202 Ga0207705_10385445 3300025909 Bacteria 1083
203 Ga0207705_10474398 3300025909 Bacteria 971
204 Ga0207654_10863993 3300025911 Bacteria 655
205 Ga0207707_10016260 3300025912 Bacteria 6490
206 Ga0207707_10322269 3300025912 Bacteria 1334
207 Ga0207695_10001670 3300025913 Bacteria 35733
208 Ga0207695_10001727 3300025913 Bacteria 34901
209 Ga0207695_10015061 3300025913 Bacteria 9122
210 Ga0207695_10021597 3300025913 Bacteria 7340
211 Ga0207695_10133106 3300025913 Bacteria 2442
212 Ga0207695_10152637 3300025913 Bacteria 2248
213 Ga0207695_10957179 3300025913 Bacteria 736
214 Ga0207695_11029023 3300025913 Bacteria 703
215 Ga0207671_10435328 3300025914 Bacteria 1044
216 Ga0207671_11353336 3300025914 Unclassified 553
217 Ga0207660_10180924 3300025917 Bacteria 1637
218 Ga0207660_10385162 3300025917 Bacteria 1127
219 Ga0207657_10012109 3300025919 Bacteria 8523
220 Ga0207649_10453765 3300025920 Bacteria 968
221 Ga0207649_10585403 3300025920 Bacteria 857
222 Ga0207649_10902014 3300025920 Bacteria 693
223 Ga0207652_10042473 3300025921 Bacteria 3870
224 Ga0207652_10046510 3300025921 Bacteria 3702
225 Ga0207652_11176863 3300025921 Bacteria 668
226 Ga0207694_10040124 3300025924 Bacteria 3604
227 Ga0207694_10105146 3300025924 Bacteria 2241
228 Ga0207694_10655671 3300025924 Bacteria 884
229 Ga0207694_10676640 3300025924 Bacteria 870
230 Ga0207650_10000062 3300025925 Bacteria 149776
231 Ga0207650_10023019 3300025925 Bacteria 4415
232 Ga0207687_10475837 3300025927 Bacteria 1039
233 Ga0207644_10106649 3300025931 Bacteria 2112
234 Ga0207690_10000129 3300025932 Bacteria 62350
235 Ga0207690_10075218 3300025932 Bacteria 2341
236 Ga0207706_10111580 3300025933 Bacteria 2406
237 Ga0207706_10444125 3300025933 Bacteria 1122
238 Ga0207711_10022877 3300025941 Bacteria 5231
239 Ga0207711_10024435 3300025941 Bacteria 5063
240 Ga0207711_10106029 3300025941 Bacteria 2493
241 Ga0207711_10394789 3300025941 Bacteria 1285
242 Ga0207711_10411358 3300025941 Bacteria 1257
243 Ga0207689_10155093 3300025942 Bacteria 1887
244 Ga0207689_10432256 3300025942 Bacteria 1099
245 Ga0207661_11064949 3300025944 Bacteria 745
246 Ga0207661_11266424 3300025944 Bacteria 678
247 Ga0207661_11739239 3300025944 Bacteria 569
248 Ga0207679_10013998 3300025945 Bacteria 5262
249 Ga0207679_10112370 3300025945 Bacteria 2153
250 Ga0207679_10955602 3300025945 Bacteria 785
251 Ga0207667_10043300 3300025949 Bacteria 4778
252 Ga0207667_10634029 3300025949 Bacteria 1075
253 Ga0207667_10962401 3300025949 Bacteria 843
254 Ga0207667_11327801 3300025949 Bacteria 695
255 Ga0207651_10106194 3300025960 Bacteria 2096
256 Ga0207712_10001004 3300025961 Bacteria 20092
257 Ga0207712_10111886 3300025961 Bacteria 2049
258 Ga0207668_10000028 3300025972 Bacteria 125361
259 Ga0207668_10000507 3300025972 Bacteria 24393
260 Ga0207668_10005956 3300025972 Bacteria 7185
261 Ga0207640_10459030 3300025981 Bacteria 1052
262 Ga0207640_11187004 3300025981 Bacteria 678
263 Ga0207640_11646854 3300025981 Bacteria 579
264 Ga0207658_10000209 3300025986 Bacteria 61041
265 Ga0207658_10049046 3300025986 Bacteria 3100
266 Ga0207658_10359415 3300025986 Bacteria 1270
267 Ga0207658_10443625 3300025986 Bacteria 1148
268 Ga0207677_10112672 3300026023 Bacteria 2029
269 Ga0207703_10000038 3300026035 Bacteria 175917
270 Ga0207703_10003500 3300026035 Bacteria 13131
271 Ga0207703_10263749 3300026035 Bacteria 1558
272 Ga0207639_10034165 3300026041 Bacteria 3757
273 Ga0207639_10134102 3300026041 Bacteria 2054
274 Ga0207639_10261768 3300026041 Bacteria 1513
275 Ga0207639_10340443 3300026041 Bacteria 1337
276 Ga0207639_11174242 3300026041 Bacteria 720
277 Ga0207678_10239484 3300026067 Bacteria 1554
278 Ga0207678_10665928 3300026067 Bacteria 915
279 Ga0207678_11386480 3300026067 Bacteria 621
280 Ga0207708_11142745 3300026075 Bacteria 680
281 Ga0207702_10381961 3300026078 Bacteria 1355
282 Ga0207702_10472207 3300026078 Bacteria 1220
283 Ga0207702_11876756 3300026078 Bacteria 591
284 Ga0207702_12305779 3300026078 Bacteria 526
285 Ga0207641_10000012 3300026088 Bacteria 375486
286 Ga0207641_10000341 3300026088 Bacteria 56155
287 Ga0207641_11356611 3300026088 Bacteria 712
288 Ga0207641_12459287 3300026088 Unclassified 519
289 Ga0207676_10000255 3300026095 Bacteria 46136
290 Ga0207676_10000797 3300026095 Bacteria 24574
291 Ga0207676_10005948 3300026095 Bacteria 8607
292 Ga0207674_11502596 3300026116 Bacteria 643
293 Ga0207675_100572587 3300026118 Bacteria 1130
294 Ga0207683_10049180 3300026121 Bacteria 3691
295 Ga0207698_10771449 3300026142 Bacteria 962
296 Ga0207698_11655590 3300026142 Bacteria 655
297 Ga0209967_1022439 3300027364 Bacteria 926
298 Ga0209981_1000976 3300027378 Bacteria 3602
299 Ga0209999_1003416 3300027543 Bacteria 2836
300 Ga0209983_1015357 3300027665 Bacteria 1579
301 Ga0209974_10271765 3300027876 Bacteria 642
302 Ga0268266_10000064 3300028379 Bacteria 249533
303 Ga0268266_10001340 3300028379 Bacteria 29786
304 Ga0268266_10009825 3300028379 Bacteria 8411
305 Ga0268266_10443169 3300028379 Bacteria 1233
306 Ga0268265_10001646 3300028380 Bacteria 18291
307 Ga0268265_10005054 3300028380 Bacteria 9055
308 Ga0268265_10016564 3300028380 Bacteria 5067
309 Ga0268265_10970078 3300028380 Bacteria 838
310 Ga0268264_10000046 3300028381 Bacteria 364597
311 Ga0268264_10028586 3300028381 Bacteria 4561
312 Ga0268264_11121999 3300028381 Bacteria 795
313 Ga0307517_10082580 3300028786 Bacteria 2726
314 Ga0307517_10121079 3300028786 Bacteria 1934
315 Ga0307517_10175489 3300028786 Bacteria 1397
316 Ga0307515_10054933 3300028794 Bacteria 5833
317 Ga0307515_10123962 3300028794 Bacteria 2902
318 Ga0265327_10101553 3300031251 Bacteria 1387
319 Ga0307513_10000448 3300031456 Bacteria 59427
320 Ga0307513_10009333 3300031456 Bacteria 12420
321 Ga0307513_10014931 3300031456 Bacteria 9436
322 Ga0307513_10021685 3300031456 Bacteria 7577
323 Ga0307513_10241068 3300031456 Bacteria 1613
324 Ga0265314_10313776 3300031711 Bacteria 875
325 Ga0307516_10000004 3300031730 Bacteria 367451
326 Ga0307413_10682006 3300031824 Bacteria 851
327 Ga0307413_11759838 3300031824 Bacteria 554
328 Ga0307410_10333517 3300031852 Bacteria 1207
329 Ga0307406_10665721 3300031901 Bacteria 866
330 Ga0307406_11094156 3300031901 Bacteria 688
331 Ga0307407_10238519 3300031903 Bacteria 1239
332 Ga0307412_10459566 3300031911 Bacteria 1051
333 Ga0307412_10942731 3300031911 Bacteria 759
334 Ga0307409_100750868 3300031995 Bacteria 979
335 Ga0307414_10316441 3300032004 Bacteria 1326
336 Ga0307414_10461054 3300032004 Bacteria 1117
337 Ga0307510_10013265 3300033180 Bacteria 9772
338 Ga0373944_0243141 3300035089 Bacteria 662
339 Ga0373923_0606409 3300035111 Bacteria 539
340 Ga0373936_0000998 3300035113 Bacteria 10090
341 Ga0373936_0635685 3300035113 Bacteria 502
342 Ga0373945_0053890 3300035116 Bacteria 1486
343 Ga0373943_0387399 3300035170 Bacteria 805
344 Ga0373946_0223865 3300035171 Bacteria 909
345 Ga0373946_0341531 3300035171 Bacteria 747
346 Ga0373946_0567125 3300035171 Unclassified 587
347 Ga0373935_0094806 3300035692 Bacteria 1959
348 Ga0373927_0001126 3300035695 Bacteria 20271
349 Ga0373947_0285365 3300035725 Bacteria 1098
350 Ga0373947_0353720 3300035725 Bacteria 986
351 Ga0373925_0000061 3300037068 Bacteria 117783
352 Ga0373925_0167244 3300037068 Bacteria 1734
353 Ga0373925_1178609 3300037068 Bacteria 630
354 Ga0395899_0001481 3300037312 Bacteria 19981
355 Ga0395899_0114434 3300037312 Bacteria 1937
356 Ga0395900_0000009 3300037418 Bacteria 476249
357 Ga0395900_0127010 3300037418 Bacteria 2615
358 Ga0395905_0009333 3300037471 Bacteria 9594
359 Ga0395905_0103332 3300037471 Bacteria 2675
360 Ga0395905_0214382 3300037471 Bacteria 1803
361 Ga0395905_0354476 3300037471 Bacteria 1359
362 Ga0436364_0652191 3300037853 Bacteria 995
363 Ga0395901_0000014 3300038443 Bacteria 375100
364 Ga0395901_0214846 3300038443 Bacteria 2012
365 Ga0395901_0354836 3300038443 Bacteria 1513
366 Ga0237816_05968 3300039145 Bacteria 804
367 Ga0436365_0029920 3300039437 Bacteria 3132
368 Ga0436365_0126971 3300039437 Bacteria 1465
369 Ga0436361_1006839 3300039447 Bacteria 607
370 Ga0436362_0910244 3300039453 Unclassified 564
371 Ga0451789_0839542 3300041443 Bacteria 937
372 Ga0451791_1410250 3300041451 Bacteria 567
373 Ga0451839_0561046 3300041496 Bacteria 619
374 Ga0451849_1292768 3300041505 Bacteria 802
375 Ga0451853_1309221 3300041512 Bacteria 699
376 Ga0439431_0158908 3300041997 Bacteria 645
377 Ga0439437_013840 3300042000 Bacteria 940
378 Ga0439441_067702 3300042001 Bacteria 761
379 Ga0439445_0159551 3300042004 Bacteria 658
380 Ga0450923_193527 3300042125 Bacteria 504
381 Ga0439446_0011949 3300042156 Bacteria 2366
382 Ga0439459_0031974 3300042438 Bacteria 1075
383 Ga0466968_0072883 3300044735 Bacteria 1498
384 Ga0466957_0593099 3300044842 Bacteria 775
385 Ga0466957_0754530 3300044842 Bacteria 689
386 Ga0466959_0932265 3300045049 Bacteria 579
387 Ga0466967_2423307 3300045976 Bacteria 520
388 Ga0495627_001515 3300046453 Bacteria 13353
389 Ga0495590_0001875 3300046457 Bacteria 8894
390 Ga0495629_0047462 3300046459 Bacteria 3012
391 Ga0495638_0000260 3300046460 Bacteria 71071
392 Ga0495638_0000585 3300046460 Bacteria 41159
393 Ga0495638_0010056 3300046460 Bacteria 6595
394 Ga0495638_0022004 3300046460 Bacteria 4191
395 Ga0495638_0115689 3300046460 Bacteria 1589
396 Ga0495650_0000017 3300046471 Bacteria 542552
397 Ga0495650_0113444 3300046471 Bacteria 1004
398 Ga0495605_0490210 3300046474 Unclassified 503
399 Ga0495585_0537802 3300046492 Bacteria 553
400 Ga0495607_0327832 3300046501 Bacteria 712
401 Ga0495583_0000020 3300046506 Bacteria 296185
402 Ga0495606_0020511 3300046507 Bacteria 4868
403 Ga0495606_0475788 3300046507 Bacteria 635
404 Ga0495606_0520705 3300046507 Bacteria 597
405 Ga0495610_0014650 3300046512 Bacteria 4598
406 Ga0495610_0021498 3300046512 Bacteria 3547
407 Ga0495610_0083317 3300046512 Bacteria 1464
408 Ga0495616_0005319 3300046513 Bacteria 7937
409 Ga0495620_0031152 3300046515 Bacteria 2447
410 Ga0495620_0038413 3300046515 Bacteria 2125
411 Ga0495620_0301563 3300046515 Bacteria 609
412 Ga0495628_0047510 3300046516 Bacteria 3405
413 Ga0495630_0712891 3300046517 Bacteria 767
414 Ga0495631_0046830 3300046518 Bacteria 1900
415 Ga0495632_0023633 3300046519 Bacteria 3279
416 Ga0495632_0156522 3300046519 Bacteria 1051
417 Ga0495632_0207254 3300046519 Bacteria 890
418 Ga0495637_0036818 3300046520 Bacteria 2128
419 Ga0495637_0063819 3300046520 Bacteria 1504
420 Ga0495637_0118152 3300046520 Bacteria 1022
421 Ga0495643_0009536 3300046522 Bacteria 6029
422 Ga0495643_0348226 3300046522 Bacteria 664
423 Ga0495643_0471423 3300046522 Bacteria 544
424 Ga0495648_0000029 3300046524 Bacteria 223499
425 Ga0495648_0128996 3300046524 Bacteria 1347
426 Ga0495663_0052032 3300046525 Bacteria 1270
427 Ga0495663_0371085 3300046525 Bacteria 523
428 Ga0495642_0003852 3300046528 Bacteria 5880
429 Ga0495642_0218939 3300046528 Bacteria 831
430 Ga0495642_0472495 3300046528 Bacteria 554
431 Ga0495654_0000126 3300046530 Bacteria 85179
432 Ga0495654_0037471 3300046530 Bacteria 2431
433 Ga0495654_0349936 3300046530 Bacteria 594
434 Ga0495597_0001737 3300046542 Bacteria 15014
435 Ga0495597_0075882 3300046542 Bacteria 1442
436 Ga0495597_0100064 3300046542 Bacteria 1223
437 Ga0495645_0111590 3300046543 Bacteria 1934
438 Ga0495622_0091706 3300046557 Bacteria 1395
439 Ga0495633_0224570 3300046558 Bacteria 859
440 Ga0495668_0004748 3300046616 Bacteria 9510
441 Ga0495668_0006966 3300046616 Bacteria 7308
442 Ga0495668_0062435 3300046616 Bacteria 2053
443 Ga0495668_0206944 3300046616 Bacteria 1074
444 Ga0495668_0403615 3300046616 Bacteria 751
445 Ga0495668_0784743 3300046616 Unclassified 527
446 Ga0495611_0001817 3300046648 Bacteria 10230
447 Ga0495625_0008503 3300046660 Bacteria 8749
448 Ga0495625_0028887 3300046660 Bacteria 4152
449 Ga0495625_0096766 3300046660 Bacteria 2033
450 Ga0495625_0219743 3300046660 Bacteria 1245
451 Ga0495625_0270219 3300046660 Bacteria 1097
452 Ga0495625_0662794 3300046660 Bacteria 620
453 Ga0495659_0455861 3300046664 Bacteria 557
454 Ga0495659_0552665 3300046664 Bacteria 508
455 Ga0495658_0916199 3300046683 Bacteria 560
456 Ga0495669_0000114 3300046684 Bacteria 52644
457 Ga0495669_0000375 3300046684 Bacteria 22695
458 Ga0495669_0032254 3300046684 Bacteria 2302
459 Ga0495669_0435346 3300046684 Bacteria 636
460 Ga0495624_0064980 3300046690 Bacteria 2280
461 Ga0495670_0607589 3300046691 Bacteria 596
462 Ga0495671_0197556 3300046692 Bacteria 976
463 Ga0495589_0036990 3300046794 Bacteria 2446
464 Ga0495660_0033231 3300046810 Bacteria 2894
465 Ga0495660_0199554 3300046810 Bacteria 956
466 Ga0495660_0336714 3300046810 Bacteria 674
467 Ga0495581_0085549 3300047315 Bacteria 1828
468 Ga0495581_0428986 3300047315 Bacteria 770
469 Ga0495636_0336167 3300047318 Bacteria 711
470 Ga0495672_0000647 3300047320 Bacteria 38716
471 Ga0495672_0268436 3300047320 Bacteria 820
472 Ga0495683_0071213 3300047323 Bacteria 1706
473 Ga0495677_0064579 3300047445 Bacteria 1360
474 Ga0495679_007054 3300047446 Bacteria 4744
475 Ga0495673_0000078 3300047469 Bacteria 203066
476 Ga0495673_0000330 3300047469 Bacteria 60940
477 Ga0495673_0015305 3300047469 Bacteria 3955
478 Ga0495681_0120479 3300047470 Bacteria 1126
479 Ga0495686_0000525 3300047472 Bacteria 55165
480 Ga0495686_0008089 3300047472 Bacteria 7779
481 Ga0495686_0174098 3300047472 Bacteria 1250
482 Ga0495686_0398726 3300047472 Bacteria 739
483 Ga0495686_0509984 3300047472 Bacteria 632
484 Ga0495593_0019427 3300047673 Bacteria 3810
485 Ga0495602_0449010 3300048088 Bacteria 910
486 Ga0496100_0187330 3300048903 Bacteria 1500
487 Ga0496101_0196674 3300048904 Bacteria 1557
488 Ga0496101_0397153 3300048904 Bacteria 1086
489 Ga0496102_0010654 3300048905 Bacteria 7920
490 Ga0496102_0078602 3300048905 Bacteria 3037
491 Ga0496102_1164745 3300048905 Bacteria 690
492 Ga0496103_0056762 3300048906 Bacteria 2431
493 Ga0496103_0198133 3300048906 Bacteria 1291
494 Ga0496104_0796591 3300048907 Bacteria 851
495 Ga0496104_1885387 3300048907 Unclassified 500
496 Ga0496105_0561225 3300048908 Bacteria 890
497 Ga0496106_0024831 3300048909 Bacteria 4456
498 Ga0496106_0722403 3300048909 Bacteria 793
499 Ga0496107_0000023 3300048910 Bacteria 125918
500 Ga0496107_0314174 3300048910 Bacteria 1166
501 Ga0496108_0668921 3300048911 Bacteria 902
502 Ga0496109_0023216 3300048912 Bacteria 5503
503 Ga0496112_1003981 3300048915 Bacteria 754
504 Ga0496113_0086491 3300048916 Bacteria 2409
505 Ga0496115_0056404 3300048918 Bacteria 3157
506 Ga0496115_0096783 3300048918 Bacteria 2417
507 Ga0496115_0105546 3300048918 Bacteria 2312
508 Ga0496116_0161558 3300048919 Bacteria 1228
509 Ga0496118_0045404 3300048921 Bacteria 3430
510 Ga0496119_0101551 3300048922 Bacteria 1614
511 Ga0496119_0364199 3300048922 Unclassified 697
512 Ga0496121_0000009 3300048924 Bacteria 836971
513 Ga0496121_0017079 3300048924 Bacteria 7441
514 Ga0496122_0290588 3300048925 Bacteria 888
515 Ga0496124_0220272 3300048927 Bacteria 1428
516 Ga0496124_0235005 3300048927 Bacteria 1367
517 Ga0496125_0505751 3300048928 Bacteria 679
518 Ga0496126_0315991 3300048929 Bacteria 1285
519 Ga0495678_002702 3300049459 Bacteria 11696
520 Ga0495678_134065 3300049459 Bacteria 818
521 Ga0495682_0057491 3300049460 Bacteria 1408
522 Ga0501034_0002380 3300049571 Bacteria 22851
523 Ga0501037_0255526 3300049573 Bacteria 1225
524 Ga0501038_0395005 3300049574 Bacteria 1071
525 Ga0501038_0878138 3300049574 Bacteria 663
526 Ga0501043_1177919 3300049579 Bacteria 539
527 Ga0501047_0005360 3300049581 Bacteria 12051
528 Ga0501047_0015925 3300049581 Bacteria 7168
529 Ga0501047_0072292 3300049581 Bacteria 3320
530 Ga0501047_0468006 3300049581 Bacteria 1089
531 Ga0501047_0518541 3300049581 Bacteria 1018
532 Ga0501047_0605530 3300049581 Bacteria 917
533 Ga0501238_000728 3300049671 Bacteria 3684
534 Ga0501238_006716 3300049671 Bacteria 1486
535 Ga0501257_003780 3300049686 Bacteria 3272
536 Ga0501257_190253 3300049686 Bacteria 585
537 Ga0501080_1778774 3300049742 Unclassified 518
538 Ga0501035_0731082 3300049822 Bacteria 796
539 Ga0501044_0000504 3300049823 Bacteria 47543
540 Ga0501044_0005853 3300049823 Bacteria 13619
541 Ga0501044_0260458 3300049823 Bacteria 1673
542 Ga0501044_0350158 3300049823 Bacteria 1397
543 Ga0501044_1139595 3300049823 Bacteria 648
544 Ga0501044_1351592 3300049823 Unclassified 578
545 nmdc:mga0k408_19270_c1 3300050493 Bacteria 3811
546 nmdc:mga0k408_88519_c1 3300050493 Bacteria 1818
547 nmdc:mga07m45_747425_c1 3300050496 Bacteria 561
548 Ga0495601_0482140 3300053077 Unclassified 801
549 Ga0500635_0000302 3300053080 Bacteria 17373
550 Ga0500578_0000008 3300053086 Bacteria 223557
551 Ga0500578_0271497 3300053086 Bacteria 1014
552 Ga0500643_006804 3300053087 Bacteria 4711
553 Ga0500643_017285 3300053087 Bacteria 2418
554 Ga0500643_092806 3300053087 Bacteria 822
555 Ga0500644_0000028 3300053088 Bacteria 92405
556 Ga0500646_0132559 3300053090 Bacteria 811
557 Ga0500646_0224708 3300053090 Bacteria 652
558 Ga0500647_0045013 3300053091 Bacteria 2119
559 Ga0500651_0038819 3300053093 Bacteria 2999
560 Ga0500651_0200404 3300053093 Bacteria 1178
561 Ga0500566_0089867 3300053094 Bacteria 1698
562 Ga0500641_0072090 3300053096 Bacteria 1455
563 Ga0500641_0163247 3300053096 Bacteria 960
564 Ga0500554_084004 3300053102 Bacteria 1051
565 Ga0500555_001817 3300053103 Bacteria 6368
566 Ga0500555_115700 3300053103 Bacteria 672
567 Ga0500556_0003050 3300053104 Bacteria 5024
568 Ga0500556_0048840 3300053104 Bacteria 1523
569 Ga0500556_0100926 3300053104 Bacteria 1111
570 Ga0500562_002026 3300053108 Bacteria 5074
571 Ga0500562_004573 3300053108 Bacteria 3495
572 Ga0500569_102730 3300053109 Bacteria 938
573 Ga0500572_099153 3300053111 Bacteria 930
574 Ga0500594_0000309 3300053118 Bacteria 10991
575 Ga0500595_004249 3300053119 Bacteria 6464
576 Ga0500607_040329 3300053121 Bacteria 2531
577 Ga0500607_233215 3300053121 Bacteria 752
578 Ga0500608_000573 3300053122 Bacteria 13643
579 Ga0500608_060706 3300053122 Bacteria 1808
580 Ga0500608_179056 3300053122 Bacteria 900
581 Ga0500614_010544 3300053123 Bacteria 1986
582 Ga0500614_013483 3300053123 Bacteria 1796
583 Ga0500618_000060 3300053125 Bacteria 97135
584 Ga0500642_0097207 3300053130 Bacteria 1366
585 Ga0500642_0109215 3300053130 Bacteria 1291
586 Ga0500655_021803 3300053133 Bacteria 1203
587 Ga0500655_025521 3300053133 Bacteria 1122
588 Ga0500658_0073550 3300053134 Bacteria 1447
589 Ga0500658_0127586 3300053134 Bacteria 1132
590 Ga0500658_0419095 3300053134 Bacteria 612
591 Ga0500559_0000005 3300053136 Bacteria 230231
592 Ga0500559_0012527 3300053136 Bacteria 3601
593 Ga0500559_0294342 3300053136 Bacteria 762
594 Ga0500564_001092 3300053138 Bacteria 8997
595 Ga0500577_0003928 3300053142 Bacteria 3887
596 Ga0500590_014706 3300053148 Bacteria 4034
597 Ga0500590_319095 3300053148 Bacteria 573
598 Ga0500616_0006751 3300053153 Bacteria 7440
599 Ga0500616_0404338 3300053153 Bacteria 545
600 Ga0500619_002486 3300053154 Bacteria 3562
601 Ga0500622_0000105 3300053156 Bacteria 85855
602 Ga0500622_0024588 3300053156 Bacteria 3185
603 Ga0500627_0032197 3300053158 Bacteria 2208
604 Ga0500633_0203022 3300053160 Bacteria 742
605 Ga0500638_162590 3300053162 Bacteria 981
606 Ga0500638_174350 3300053162 Bacteria 934
607 Ga0500636_0078861 3300053177 Bacteria 1900
608 Ga0500636_0127369 3300053177 Bacteria 1422
609 Ga0500637_0061730 3300053178 Bacteria 2147
610 Ga0500637_0087263 3300053178 Bacteria 1804
611 Ga0500576_044374 3300053725 Bacteria 1993
612 Ga0500611_010295 3300053727 Bacteria 1511
613 Ga0500625_015994 3300053729 Bacteria 3489
614 Ga0500645_005969 3300053730 Bacteria 4405
615 Ga0500609_006570 3300053731 Bacteria 1583
616 Ga0500596_000489 3300053735 Bacteria 7420
617 Ga0500661_101066 3300055283 Bacteria 547

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0471423 Ga0495643_0471423_10_342 97
2 3300003215 JGI25153J46596_10013301 JGI25153J46596_100133013 98
3 3300003320 rootH2_10147346 rootH2_101473463 98
4 3300003771 Ga0055526_1070314 Ga0055526_10703141 98
5 3300003773 Ga0055537_1001022 Ga0055537_10010226 98
6 3300003775 Ga0055524_1021277 Ga0055524_10212772 98
7 3300003775 Ga0055524_1053809 Ga0055524_10538092 98
8 3300003790 Ga0055528_1002711 Ga0055528_10027115 98
9 3300003791 Ga0055530_10002729 Ga0055530_1000272912 98
10 3300003791 Ga0055530_10033909 Ga0055530_100339091 98
11 3300003794 Ga0055531_10000966 Ga0055531_1000096613 98
12 3300003794 Ga0055531_10001958 Ga0055531_100019587 98
13 3300005262 Ga0065165_1000277 Ga0065165_10002779 98
14 3300005262 Ga0065165_1001667 Ga0065165_100166715 98
15 3300005262 Ga0065165_1126859 Ga0065165_11268591 98
16 3300005327 Ga0070658_10145626 Ga0070658_101456262 98
17 3300005327 Ga0070658_10192462 Ga0070658_101924622 98
18 3300005327 Ga0070658_10488668 Ga0070658_104886682 98
19 3300005327 Ga0070658_11256377 Ga0070658_112563772 98
20 3300005327 Ga0070658_11285186 Ga0070658_112851861 98
21 3300005331 Ga0070670_100000037 Ga0070670_10000003781 98
22 3300005331 Ga0070670_100114793 Ga0070670_1001147933 98
23 3300005331 Ga0070670_100868082 Ga0070670_1008680821 98
24 3300005334 Ga0068869_100317281 Ga0068869_1003172812 98
25 3300005336 Ga0070680_100053013 Ga0070680_1000530133 98
26 3300005338 Ga0068868_100538291 Ga0068868_1005382912 98
27 3300005339 Ga0070660_100096530 Ga0070660_1000965302 98
28 3300005339 Ga0070660_100377096 Ga0070660_1003770962 98
29 3300005339 Ga0070660_101671984 Ga0070660_1016719842 98
30 3300005341 Ga0070691_10023519 Ga0070691_100235194 98
31 3300005344 Ga0070661_100355062 Ga0070661_1003550622 98
32 3300005344 Ga0070661_101566067 Ga0070661_1015660671 98
33 3300005344 Ga0070661_101661478 Ga0070661_1016614781 98
34 3300005345 Ga0070692_11057857 Ga0070692_110578571 98
35 3300005347 Ga0070668_100000097 Ga0070668_10000009738 98
36 3300005347 Ga0070668_100001398 Ga0070668_1000013989 98
37 3300005347 Ga0070668_100006261 Ga0070668_1000062619 98
38 3300005347 Ga0070668_100058909 Ga0070668_1000589094 98
39 3300005354 Ga0070675_100676856 Ga0070675_1006768562 98
40 3300005354 Ga0070675_101250234 Ga0070675_1012502341 98
41 3300005355 Ga0070671_100211856 Ga0070671_1002118562 98
42 3300005366 Ga0070659_100000206 Ga0070659_10000020639 98
43 3300005366 Ga0070659_100005903 Ga0070659_1000059036 98
44 3300005366 Ga0070659_100661812 Ga0070659_1006618122 98
45 3300005366 Ga0070659_100862382 Ga0070659_1008623822 98
46 3300005366 Ga0070659_101372480 Ga0070659_1013724801 98
47 3300005367 Ga0070667_100000083 Ga0070667_10000008381 98
48 3300005367 Ga0070667_100061211 Ga0070667_1000612111 98
49 3300005367 Ga0070667_100391499 Ga0070667_1003914992 98
50 3300005367 Ga0070667_100465990 Ga0070667_1004659902 98
51 3300005367 Ga0070667_100687984 Ga0070667_1006879842 98
52 3300005440 Ga0070705_101249291 Ga0070705_1012492911 98
53 3300005455 Ga0070663_100097209 Ga0070663_1000972091 98
54 3300005455 Ga0070663_101262569 Ga0070663_1012625692 98
55 3300005456 Ga0070678_100095809 Ga0070678_1000958092 98
56 3300005457 Ga0070662_100080288 Ga0070662_1000802882 98
57 3300005457 Ga0070662_100302959 Ga0070662_1003029592 98
58 3300005458 Ga0070681_10019846 Ga0070681_100198466 98
59 3300005458 Ga0070681_10063521 Ga0070681_100635214 98
60 3300005466 Ga0070685_10417517 Ga0070685_104175172 98
61 3300005530 Ga0070679_100003462 Ga0070679_1000034623 98
62 3300005530 Ga0070679_100044372 Ga0070679_1000443724 98
63 3300005530 Ga0070679_100704195 Ga0070679_1007041952 98
64 3300005539 Ga0068853_100057502 Ga0068853_1000575023 98
65 3300005539 Ga0068853_100245881 Ga0068853_1002458814 98
66 3300005539 Ga0068853_100272882 Ga0068853_1002728822 98
67 3300005539 Ga0068853_100395554 Ga0068853_1003955541 98
68 3300005544 Ga0070686_101210451 Ga0070686_1012104511 98
69 3300005548 Ga0070665_100000116 Ga0070665_10000011665 98
70 3300005548 Ga0070665_100000278 Ga0070665_10000027819 98
71 3300005548 Ga0070665_100000483 Ga0070665_10000048313 98
72 3300005548 Ga0070665_100677183 Ga0070665_1006771831 98
73 3300005548 Ga0070665_100962862 Ga0070665_1009628622 98
74 3300005548 Ga0070665_102279935 Ga0070665_1022799352 98
75 3300005563 Ga0068855_100098841 Ga0068855_1000988412 98
76 3300005563 Ga0068855_100114730 Ga0068855_1001147303 98
77 3300005563 Ga0068855_101027662 Ga0068855_1010276622 98
78 3300005563 Ga0068855_101345346 Ga0068855_1013453462 98
79 3300005563 Ga0068855_101552010 Ga0068855_1015520102 98
80 3300005564 Ga0070664_100064257 Ga0070664_1000642572 98
81 3300005564 Ga0070664_100304364 Ga0070664_1003043642 98
82 3300005564 Ga0070664_100677070 Ga0070664_1006770702 98
83 3300005577 Ga0068857_101470012 Ga0068857_1014700122 98
84 3300005578 Ga0068854_100523656 Ga0068854_1005236562 98
85 3300005578 Ga0068854_101795851 Ga0068854_1017958511 98
86 3300005614 Ga0068856_100876569 Ga0068856_1008765691 98
87 3300005616 Ga0068852_100621770 Ga0068852_1006217702 98
88 3300005617 Ga0068859_100137076 Ga0068859_1001370762 98
89 3300005617 Ga0068859_101044915 Ga0068859_1010449152 98
90 3300005618 Ga0068864_100000115 Ga0068864_10000011527 98
91 3300005618 Ga0068864_100000786 Ga0068864_10000078612 98
92 3300005618 Ga0068864_100026445 Ga0068864_1000264456 98
93 3300005719 Ga0068861_100528720 Ga0068861_1005287202 98
94 3300005841 Ga0068863_100000007 Ga0068863_100000007149 98
95 3300005841 Ga0068863_100000392 Ga0068863_1000003929 98
96 3300005841 Ga0068863_100152772 Ga0068863_1001527722 98
97 3300005841 Ga0068863_102491844 Ga0068863_1024918441 98
98 3300005842 Ga0068858_100000031 Ga0068858_10000003189 98
99 3300005842 Ga0068858_100004211 Ga0068858_1000042117 98
100 3300005842 Ga0068858_100574859 Ga0068858_1005748592 98
101 3300005842 Ga0068858_102531228 Ga0068858_1025312281 98
102 3300005843 Ga0068860_100000128 Ga0068860_10000012823 98
103 3300005843 Ga0068860_100060495 Ga0068860_1000604953 98
104 3300005844 Ga0068862_100001627 Ga0068862_1000016275 98
105 3300005844 Ga0068862_100012654 Ga0068862_1000126542 98
106 3300005844 Ga0068862_100171133 Ga0068862_1001711332 98
107 3300006028 Ga0070717_10194214 Ga0070717_101942142 98
108 3300006177 Ga0075362_10735639 Ga0075362_107356391 98
109 3300006195 Ga0075366_10050358 Ga0075366_100503582 98
110 3300006195 Ga0075366_10458226 Ga0075366_104582262 98
111 3300006353 Ga0075370_10067984 Ga0075370_100679843 98
112 3300006931 Ga0097620_100137068 Ga0097620_1001370682 98
113 3300006931 Ga0097620_101045082 Ga0097620_1010450822 98
114 3300006946 Ga0079104_1037307 Ga0079104_10373072 98
115 3300009092 Ga0105250_10026243 Ga0105250_100262432 98
116 3300009093 Ga0105240_10005944 Ga0105240_100059446 98
117 3300009093 Ga0105240_10040708 Ga0105240_100407084 98
118 3300009093 Ga0105240_10043434 Ga0105240_100434349 98
119 3300009093 Ga0105240_10188036 Ga0105240_101880364 98
120 3300009093 Ga0105240_10191413 Ga0105240_101914133 98
121 3300009093 Ga0105240_11392717 Ga0105240_113927172 98
122 3300009098 Ga0105245_10908894 Ga0105245_109088941 98
123 3300009101 Ga0105247_10022438 Ga0105247_100224382 98
124 3300009101 Ga0105247_10513887 Ga0105247_105138872 98
125 3300009174 Ga0105241_12079668 Ga0105241_120796682 98
126 3300009174 Ga0105241_12484451 Ga0105241_124844511 98
127 3300009177 Ga0105248_10038574 Ga0105248_100385744 98
128 3300009177 Ga0105248_10041310 Ga0105248_100413103 98
129 3300009177 Ga0105248_10050796 Ga0105248_100507962 98
130 3300009177 Ga0105248_10907946 Ga0105248_109079462 98
131 3300009177 Ga0105248_11114173 Ga0105248_111141732 98
132 3300009545 Ga0105237_10695156 Ga0105237_106951562 98
133 3300009551 Ga0105238_10056774 Ga0105238_100567744 98
134 3300009551 Ga0105238_10348261 Ga0105238_103482613 98
135 3300009551 Ga0105238_10960091 Ga0105238_109600912 98
136 3300009551 Ga0105238_11173114 Ga0105238_111731142 98
137 3300009551 Ga0105238_11384886 Ga0105238_113848862 98
138 3300009553 Ga0105249_10000410 Ga0105249_1000041042 98
139 3300009553 Ga0105249_10098444 Ga0105249_100984443 98
140 3300009553 Ga0105249_10210746 Ga0105249_102107462 98
141 3300009553 Ga0105249_11515628 Ga0105249_115156281 98
142 3300010375 Ga0105239_10274989 Ga0105239_102749893 98
143 3300010375 Ga0105239_10538089 Ga0105239_105380892 98
144 3300010375 Ga0105239_10729711 Ga0105239_107297112 98
145 3300010375 Ga0105239_11477333 Ga0105239_114773332 98
146 3300011119 Ga0105246_10713124 Ga0105246_107131241 98
147 3300012497 Ga0157319_1056325 Ga0157319_10563251 98
148 3300013100 Ga0157373_10007392 Ga0157373_100073922 98
149 3300013100 Ga0157373_10007540 Ga0157373_100075402 98
150 3300013100 Ga0157373_10682914 Ga0157373_106829141 98
151 3300013104 Ga0157370_10396848 Ga0157370_103968482 98
152 3300013104 Ga0157370_11797833 Ga0157370_117978332 98
153 3300013105 Ga0157369_10446843 Ga0157369_104468432 98
154 3300013105 Ga0157369_10819580 Ga0157369_108195802 98
155 3300013296 Ga0157374_10402262 Ga0157374_104022622 98
156 3300013297 Ga0157378_10991010 Ga0157378_109910102 98
157 3300013306 Ga0163162_11891683 Ga0163162_118916832 98
158 3300013307 Ga0157372_11404771 Ga0157372_114047712 98
159 3300013307 Ga0157372_11410539 Ga0157372_114105391 98
160 3300013307 Ga0157372_12113280 Ga0157372_121132802 98
161 3300013308 Ga0157375_10205678 Ga0157375_102056782 98
162 3300014325 Ga0163163_10868359 Ga0163163_108683592 98
163 3300014325 Ga0163163_11464740 Ga0163163_114647401 98
164 3300014325 Ga0163163_11504384 Ga0163163_115043842 98
165 3300014325 Ga0163163_11736621 Ga0163163_117366212 98
166 3300014325 Ga0163163_11869384 Ga0163163_118693841 98
167 3300014326 Ga0157380_11109417 Ga0157380_111094171 98
168 3300014745 Ga0157377_10722912 Ga0157377_107229122 98
169 3300014968 Ga0157379_10080776 Ga0157379_100807764 98
170 3300014968 Ga0157379_10174569 Ga0157379_101745692 98
171 3300014968 Ga0157379_11508367 Ga0157379_115083671 98
172 3300015261 Ga0182006_1071517 Ga0182006_10715171 98
173 3300017792 Ga0163161_10527455 Ga0163161_105274552 98
174 3300017792 Ga0163161_11349309 Ga0163161_113493091 98
175 3300021384 Ga0213876_10035545 Ga0213876_100355454 98
176 3300021384 Ga0213876_10147319 Ga0213876_101473192 98
177 3300025254 Ga0209148_1007316 Ga0209148_10073162 98
178 3300025254 Ga0209148_1015725 Ga0209148_10157252 98
179 3300025263 Ga0209565_1000641 Ga0209565_100064116 98
180 3300025273 Ga0209673_1003300 Ga0209673_10033002 98
181 3300025273 Ga0209673_1016328 Ga0209673_10163282 98
182 3300025291 Ga0209675_1003569 Ga0209675_10035695 98
183 3300025295 Ga0209564_1004845 Ga0209564_10048457 98
184 3300025295 Ga0209564_1036944 Ga0209564_10369441 98
185 3300025297 Ga0209758_1001863 Ga0209758_100186313 98
186 3300025297 Ga0209758_1007301 Ga0209758_10073014 98
187 3300025297 Ga0209758_1008993 Ga0209758_10089936 98
188 3300025298 Ga0209050_1000200 Ga0209050_100020013 98
189 3300025298 Ga0209050_1012865 Ga0209050_10128652 98
190 3300025299 Ga0209256_1002428 Ga0209256_100242815 98
191 3300025299 Ga0209256_1002898 Ga0209256_10028987 98
192 3300025304 Ga0209257_1000225 Ga0209257_100022513 98
193 3300025304 Ga0209257_1000944 Ga0209257_100094411 98
194 3300025321 Ga0207656_10390547 Ga0207656_103905472 98
195 3300025711 Ga0207696_1022235 Ga0207696_10222352 98
196 3300025900 Ga0207710_10077787 Ga0207710_100777872 98
197 3300025900 Ga0207710_10187177 Ga0207710_101871771 98
198 3300025900 Ga0207710_10677661 Ga0207710_106776611 98
199 3300025903 Ga0207680_10231626 Ga0207680_102316262 98
200 3300025903 Ga0207680_10652795 Ga0207680_106527951 98
201 3300025908 Ga0207643_10359984 Ga0207643_103599842 98
202 3300025909 Ga0207705_10007993 Ga0207705_100079933 98
203 3300025909 Ga0207705_10385445 Ga0207705_103854452 98
204 3300025909 Ga0207705_10474398 Ga0207705_104743982 98
205 3300025911 Ga0207654_10863993 Ga0207654_108639931 98
206 3300025912 Ga0207707_10016260 Ga0207707_100162609 98
207 3300025912 Ga0207707_10322269 Ga0207707_103222692 98
208 3300025913 Ga0207695_10001670 Ga0207695_1000167029 98
209 3300025913 Ga0207695_10001727 Ga0207695_1000172730 98
210 3300025913 Ga0207695_10015061 Ga0207695_100150614 98
211 3300025913 Ga0207695_10021597 Ga0207695_100215973 98
212 3300025913 Ga0207695_10133106 Ga0207695_101331063 98
213 3300025913 Ga0207695_10152637 Ga0207695_101526373 98
214 3300025913 Ga0207695_10957179 Ga0207695_109571792 98
215 3300025913 Ga0207695_11029023 Ga0207695_110290231 98
216 3300025914 Ga0207671_10435328 Ga0207671_104353282 98
217 3300025914 Ga0207671_11353336 Ga0207671_113533361 98
218 3300025917 Ga0207660_10180924 Ga0207660_101809242 98
219 3300025917 Ga0207660_10385162 Ga0207660_103851622 98
220 3300025919 Ga0207657_10012109 Ga0207657_100121096 98
221 3300025920 Ga0207649_10453765 Ga0207649_104537652 98
222 3300025920 Ga0207649_10585403 Ga0207649_105854032 98
223 3300025920 Ga0207649_10902014 Ga0207649_109020142 98
224 3300025921 Ga0207652_10042473 Ga0207652_100424733 98
225 3300025921 Ga0207652_10046510 Ga0207652_100465103 98
226 3300025921 Ga0207652_11176863 Ga0207652_111768631 98
227 3300025924 Ga0207694_10040124 Ga0207694_100401244 98
228 3300025924 Ga0207694_10105146 Ga0207694_101051464 98
229 3300025924 Ga0207694_10655671 Ga0207694_106556711 98
230 3300025924 Ga0207694_10676640 Ga0207694_106766402 98
231 3300025925 Ga0207650_10000062 Ga0207650_100000629 98
232 3300025925 Ga0207650_10023019 Ga0207650_100230193 98
233 3300025927 Ga0207687_10475837 Ga0207687_104758371 98
234 3300025931 Ga0207644_10106649 Ga0207644_101066493 98
235 3300025932 Ga0207690_10000129 Ga0207690_1000012927 98
236 3300025932 Ga0207690_10075218 Ga0207690_100752182 98
237 3300025933 Ga0207706_10111580 Ga0207706_101115802 98
238 3300025933 Ga0207706_10444125 Ga0207706_104441252 98
239 3300025941 Ga0207711_10022877 Ga0207711_100228774 98
240 3300025941 Ga0207711_10024435 Ga0207711_100244354 98
241 3300025941 Ga0207711_10106029 Ga0207711_101060293 98
242 3300025941 Ga0207711_10394789 Ga0207711_103947892 98
243 3300025941 Ga0207711_10411358 Ga0207711_104113582 98
244 3300025942 Ga0207689_10155093 Ga0207689_101550932 98
245 3300025942 Ga0207689_10432256 Ga0207689_104322562 98
246 3300025944 Ga0207661_11064949 Ga0207661_110649492 98
247 3300025944 Ga0207661_11266424 Ga0207661_112664242 98
248 3300025944 Ga0207661_11739239 Ga0207661_117392391 98
249 3300025945 Ga0207679_10013998 Ga0207679_100139987 98
250 3300025945 Ga0207679_10112370 Ga0207679_101123702 98
251 3300025945 Ga0207679_10955602 Ga0207679_109556022 98
252 3300025949 Ga0207667_10043300 Ga0207667_100433006 98
253 3300025949 Ga0207667_10634029 Ga0207667_106340292 98
254 3300025949 Ga0207667_10962401 Ga0207667_109624011 98
255 3300025949 Ga0207667_11327801 Ga0207667_113278012 98
256 3300025960 Ga0207651_10106194 Ga0207651_101061942 98
257 3300025961 Ga0207712_10001004 Ga0207712_100010049 98
258 3300025961 Ga0207712_10111886 Ga0207712_101118862 98
259 3300025972 Ga0207668_10000028 Ga0207668_1000002859 98
260 3300025972 Ga0207668_10000507 Ga0207668_100005077 98
261 3300025972 Ga0207668_10005956 Ga0207668_100059566 98
262 3300025981 Ga0207640_10459030 Ga0207640_104590302 98
263 3300025981 Ga0207640_11187004 Ga0207640_111870041 98
264 3300025981 Ga0207640_11646854 Ga0207640_116468541 98
265 3300025986 Ga0207658_10000209 Ga0207658_1000020940 98
266 3300025986 Ga0207658_10049046 Ga0207658_100490463 98
267 3300025986 Ga0207658_10359415 Ga0207658_103594152 98
268 3300025986 Ga0207658_10443625 Ga0207658_104436252 98
269 3300026023 Ga0207677_10112672 Ga0207677_101126723 98
270 3300026035 Ga0207703_10000038 Ga0207703_1000003898 98
271 3300026035 Ga0207703_10003500 Ga0207703_100035003 98
272 3300026035 Ga0207703_10263749 Ga0207703_102637492 98
273 3300026041 Ga0207639_10034165 Ga0207639_100341652 98
274 3300026041 Ga0207639_10134102 Ga0207639_101341022 98
275 3300026041 Ga0207639_10261768 Ga0207639_102617682 98
276 3300026041 Ga0207639_10340443 Ga0207639_103404432 98
277 3300026041 Ga0207639_11174242 Ga0207639_111742422 98
278 3300026067 Ga0207678_10239484 Ga0207678_102394842 98
279 3300026067 Ga0207678_10665928 Ga0207678_106659281 98
280 3300026067 Ga0207678_11386480 Ga0207678_113864802 98
281 3300026075 Ga0207708_11142745 Ga0207708_111427452 98
282 3300026078 Ga0207702_10381961 Ga0207702_103819612 98
283 3300026078 Ga0207702_10472207 Ga0207702_104722072 98
284 3300026078 Ga0207702_11876756 Ga0207702_118767561 98
285 3300026078 Ga0207702_12305779 Ga0207702_123057791 98
286 3300026088 Ga0207641_10000012 Ga0207641_10000012160 98
287 3300026088 Ga0207641_10000341 Ga0207641_1000034125 98
288 3300026088 Ga0207641_11356611 Ga0207641_113566111 98
289 3300026088 Ga0207641_12459287 Ga0207641_124592871 98
290 3300026095 Ga0207676_10000255 Ga0207676_1000025519 98
291 3300026095 Ga0207676_10000797 Ga0207676_1000079713 98
292 3300026095 Ga0207676_10005948 Ga0207676_100059483 98
293 3300026116 Ga0207674_11502596 Ga0207674_115025961 98
294 3300026118 Ga0207675_100572587 Ga0207675_1005725872 98
295 3300026121 Ga0207683_10049180 Ga0207683_100491803 98
296 3300026142 Ga0207698_10771449 Ga0207698_107714491 98
297 3300026142 Ga0207698_11655590 Ga0207698_116555902 98
298 3300027364 Ga0209967_1022439 Ga0209967_10224392 98
299 3300027378 Ga0209981_1000976 Ga0209981_10009762 98
300 3300027543 Ga0209999_1003416 Ga0209999_10034164 98
301 3300027665 Ga0209983_1015357 Ga0209983_10153572 98
302 3300027876 Ga0209974_10271765 Ga0209974_102717652 98
303 3300028379 Ga0268266_10000064 Ga0268266_10000064171 98
304 3300028379 Ga0268266_10001340 Ga0268266_1000134013 98
305 3300028379 Ga0268266_10009825 Ga0268266_100098252 98
306 3300028379 Ga0268266_10443169 Ga0268266_104431692 98
307 3300028380 Ga0268265_10001646 Ga0268265_1000164617 98
308 3300028380 Ga0268265_10005054 Ga0268265_100050544 98
309 3300028380 Ga0268265_10016564 Ga0268265_100165642 98
310 3300028380 Ga0268265_10970078 Ga0268265_109700782 98
311 3300028381 Ga0268264_10000046 Ga0268264_10000046133 98
312 3300028381 Ga0268264_10028586 Ga0268264_100285863 98
313 3300028381 Ga0268264_11121999 Ga0268264_111219992 98
314 3300028786 Ga0307517_10082580 Ga0307517_100825802 98
315 3300028786 Ga0307517_10121079 Ga0307517_101210792 98
316 3300028786 Ga0307517_10175489 Ga0307517_101754892 98
317 3300028794 Ga0307515_10054933 Ga0307515_100549336 98
318 3300028794 Ga0307515_10123962 Ga0307515_101239622 98
319 3300031251 Ga0265327_10101553 Ga0265327_101015532 98
320 3300031456 Ga0307513_10000448 Ga0307513_1000044819 98
321 3300031456 Ga0307513_10009333 Ga0307513_1000933311 98
322 3300031456 Ga0307513_10014931 Ga0307513_100149313 98
323 3300031456 Ga0307513_10021685 Ga0307513_100216853 98
324 3300031456 Ga0307513_10241068 Ga0307513_102410682 98
325 3300031711 Ga0265314_10313776 Ga0265314_103137762 98
326 3300031730 Ga0307516_10000004 Ga0307516_10000004336 98
327 3300031824 Ga0307413_10682006 Ga0307413_106820062 98
328 3300031824 Ga0307413_11759838 Ga0307413_117598382 98
329 3300031852 Ga0307410_10333517 Ga0307410_103335172 98
330 3300031901 Ga0307406_10665721 Ga0307406_106657212 98
331 3300031901 Ga0307406_11094156 Ga0307406_110941561 98
332 3300031903 Ga0307407_10238519 Ga0307407_102385192 98
333 3300031911 Ga0307412_10459566 Ga0307412_104595661 98
334 3300031911 Ga0307412_10942731 Ga0307412_109427312 98
335 3300031995 Ga0307409_100750868 Ga0307409_1007508682 98
336 3300032004 Ga0307414_10316441 Ga0307414_103164412 98
337 3300032004 Ga0307414_10461054 Ga0307414_104610542 98
338 3300033180 Ga0307510_10013265 Ga0307510_100132654 98
339 3300035089 Ga0373944_0243141 Ga0373944_0243141_198_494 98
340 3300035111 Ga0373923_0606409 Ga0373923_0606409_39_335 98
341 3300035113 Ga0373936_0000998 Ga0373936_0000998_4200_4496 98
342 3300035113 Ga0373936_0635685 Ga0373936_0635685_129_425 98
343 3300035116 Ga0373945_0053890 Ga0373945_0053890_835_1131 98
344 3300035170 Ga0373943_0387399 Ga0373943_0387399_426_722 98
345 3300035171 Ga0373946_0223865 Ga0373946_0223865_380_676 98
346 3300035171 Ga0373946_0341531 Ga0373946_0341531_209_505 98
347 3300035171 Ga0373946_0567125 Ga0373946_0567125_196_492 98
348 3300035692 Ga0373935_0094806 Ga0373935_0094806_1177_1473 98
349 3300035695 Ga0373927_0001126 Ga0373927_0001126_14659_14955 98
350 3300035725 Ga0373947_0285365 Ga0373947_0285365_567_863 98
351 3300035725 Ga0373947_0353720 Ga0373947_0353720_532_828 98
352 3300037068 Ga0373925_0000061 Ga0373925_0000061_2611_2907 98
353 3300037068 Ga0373925_0167244 Ga0373925_0167244_1347_1643 98
354 3300037068 Ga0373925_1178609 Ga0373925_1178609_77_373 98
355 3300037312 Ga0395899_0001481 Ga0395899_0001481_16684_16980 98
356 3300037312 Ga0395899_0114434 Ga0395899_0114434_1118_1414 98
357 3300037418 Ga0395900_0000009 Ga0395900_0000009_288552_288848 98
358 3300037418 Ga0395900_0127010 Ga0395900_0127010_308_604 98
359 3300037471 Ga0395905_0009333 Ga0395905_0009333_1373_1669 98
360 3300037471 Ga0395905_0103332 Ga0395905_0103332_56_352 98
361 3300037471 Ga0395905_0214382 Ga0395905_0214382_850_1146 98
362 3300037471 Ga0395905_0354476 Ga0395905_0354476_921_1217 98
363 3300037853 Ga0436364_0652191 Ga0436364_0652191_631_936 98
364 3300038443 Ga0395901_0000014 Ga0395901_0000014_239757_240053 98
365 3300038443 Ga0395901_0214846 Ga0395901_0214846_1058_1354 98
366 3300038443 Ga0395901_0354836 Ga0395901_0354836_773_1069 98
367 3300039145 Ga0237816_05968 Ga0237816_05968_445_741 98
368 3300039437 Ga0436365_0029920 Ga0436365_0029920_635_931 98
369 3300039437 Ga0436365_0126971 Ga0436365_0126971_536_841 98
370 3300039447 Ga0436361_1006839 Ga0436361_1006839_173_469 98
371 3300039453 Ga0436362_0910244 Ga0436362_0910244_111_422 98
372 3300041443 Ga0451789_0839542 Ga0451789_0839542_490_786 98
373 3300041451 Ga0451791_1410250 Ga0451791_1410250_137_433 98
374 3300041496 Ga0451839_0561046 Ga0451839_0561046_251_547 98
375 3300041505 Ga0451849_1292768 Ga0451849_1292768_364_660 98
376 3300041512 Ga0451853_1309221 Ga0451853_1309221_364_666 98
377 3300041997 Ga0439431_0158908 Ga0439431_0158908_207_503 98
378 3300042000 Ga0439437_013840 Ga0439437_013840_310_606 98
379 3300042001 Ga0439441_067702 Ga0439441_067702_251_547 98
380 3300042004 Ga0439445_0159551 Ga0439445_0159551_13_309 98
381 3300042125 Ga0450923_193527 Ga0450923_193527_181_477 98
382 3300042156 Ga0439446_0011949 Ga0439446_0011949_706_1002 98
383 3300042438 Ga0439459_0031974 Ga0439459_0031974_574_870 98
384 3300044735 Ga0466968_0072883 Ga0466968_0072883_1110_1406 98
385 3300044842 Ga0466957_0593099 Ga0466957_0593099_436_732 98
386 3300044842 Ga0466957_0754530 Ga0466957_0754530_348_644 98
387 3300045049 Ga0466959_0932265 Ga0466959_0932265_254_550 98
388 3300045976 Ga0466967_2423307 Ga0466967_2423307_190_486 98
389 3300046453 Ga0495627_001515 Ga0495627_001515_7973_8269 98
390 3300046457 Ga0495590_0001875 Ga0495590_0001875_7547_7843 98
391 3300046459 Ga0495629_0047462 Ga0495629_0047462_2275_2571 98
392 3300046460 Ga0495638_0000260 Ga0495638_0000260_63963_64259 98
393 3300046460 Ga0495638_0000585 Ga0495638_0000585_33137_33433 98
394 3300046460 Ga0495638_0010056 Ga0495638_0010056_3158_3454 98
395 3300046460 Ga0495638_0022004 Ga0495638_0022004_330_626 98
396 3300046460 Ga0495638_0115689 Ga0495638_0115689_468_764 98
397 3300046471 Ga0495650_0000017 Ga0495650_0000017_79881_80177 98
398 3300046471 Ga0495650_0113444 Ga0495650_0113444_63_359 98
399 3300046474 Ga0495605_0490210 Ga0495605_0490210_173_481 98
400 3300046492 Ga0495585_0537802 Ga0495585_0537802_92_388 98
401 3300046501 Ga0495607_0327832 Ga0495607_0327832_35_331 98
402 3300046506 Ga0495583_0000020 Ga0495583_0000020_193399_193695 98
403 3300046507 Ga0495606_0020511 Ga0495606_0020511_301_597 98
404 3300046507 Ga0495606_0475788 Ga0495606_0475788_235_531 98
405 3300046507 Ga0495606_0520705 Ga0495606_0520705_252_548 98
406 3300046512 Ga0495610_0014650 Ga0495610_0014650_748_1044 98
407 3300046512 Ga0495610_0021498 Ga0495610_0021498_744_1040 98
408 3300046512 Ga0495610_0083317 Ga0495610_0083317_1101_1397 98
409 3300046513 Ga0495616_0005319 Ga0495616_0005319_7593_7889 98
410 3300046515 Ga0495620_0031152 Ga0495620_0031152_1410_1706 98
411 3300046515 Ga0495620_0038413 Ga0495620_0038413_491_787 98
412 3300046515 Ga0495620_0301563 Ga0495620_0301563_150_446 98
413 3300046516 Ga0495628_0047510 Ga0495628_0047510_2785_3123 98
414 3300046517 Ga0495630_0712891 Ga0495630_0712891_302_640 98
415 3300046518 Ga0495631_0046830 Ga0495631_0046830_1001_1297 98
416 3300046519 Ga0495632_0023633 Ga0495632_0023633_2633_2929 98
417 3300046519 Ga0495632_0156522 Ga0495632_0156522_693_992 98
418 3300046519 Ga0495632_0207254 Ga0495632_0207254_244_540 98
419 3300046520 Ga0495637_0036818 Ga0495637_0036818_1184_1480 98
420 3300046520 Ga0495637_0063819 Ga0495637_0063819_206_502 98
421 3300046520 Ga0495637_0118152 Ga0495637_0118152_471_767 98
422 3300046522 Ga0495643_0009536 Ga0495643_0009536_5319_5615 98
423 3300046522 Ga0495643_0348226 Ga0495643_0348226_304_600 98
424 3300046524 Ga0495648_0000029 Ga0495648_0000029_170509_170805 98
425 3300046524 Ga0495648_0128996 Ga0495648_0128996_492_788 98
426 3300046525 Ga0495663_0052032 Ga0495663_0052032_391_687 98
427 3300046525 Ga0495663_0371085 Ga0495663_0371085_165_473 98
428 3300046528 Ga0495642_0003852 Ga0495642_0003852_4731_5039 98
429 3300046528 Ga0495642_0218939 Ga0495642_0218939_408_716 98
430 3300046528 Ga0495642_0472495 Ga0495642_0472495_225_536 98
431 3300046530 Ga0495654_0000126 Ga0495654_0000126_4423_4719 98
432 3300046530 Ga0495654_0037471 Ga0495654_0037471_671_967 98
433 3300046530 Ga0495654_0349936 Ga0495654_0349936_199_495 98
434 3300046542 Ga0495597_0001737 Ga0495597_0001737_2924_3220 98
435 3300046542 Ga0495597_0075882 Ga0495597_0075882_672_968 98
436 3300046542 Ga0495597_0100064 Ga0495597_0100064_890_1186 98
437 3300046543 Ga0495645_0111590 Ga0495645_0111590_726_1064 98
438 3300046557 Ga0495622_0091706 Ga0495622_0091706_298_594 98
439 3300046558 Ga0495633_0224570 Ga0495633_0224570_514_810 98
440 3300046616 Ga0495668_0004748 Ga0495668_0004748_3263_3559 98
441 3300046616 Ga0495668_0006966 Ga0495668_0006966_1281_1577 98
442 3300046616 Ga0495668_0062435 Ga0495668_0062435_161_457 98
443 3300046616 Ga0495668_0206944 Ga0495668_0206944_725_1021 98
444 3300046616 Ga0495668_0403615 Ga0495668_0403615_228_533 98
445 3300046616 Ga0495668_0784743 Ga0495668_0784743_58_369 98
446 3300046648 Ga0495611_0001817 Ga0495611_0001817_5795_6106 98
447 3300046660 Ga0495625_0008503 Ga0495625_0008503_2010_2306 98
448 3300046660 Ga0495625_0028887 Ga0495625_0028887_3081_3377 98
449 3300046660 Ga0495625_0096766 Ga0495625_0096766_1147_1443 98
450 3300046660 Ga0495625_0219743 Ga0495625_0219743_78_374 98
451 3300046660 Ga0495625_0270219 Ga0495625_0270219_58_354 98
452 3300046660 Ga0495625_0662794 Ga0495625_0662794_195_491 98
453 3300046664 Ga0495659_0455861 Ga0495659_0455861_174_470 98
454 3300046664 Ga0495659_0552665 Ga0495659_0552665_152_463 98
455 3300046683 Ga0495658_0916199 Ga0495658_0916199_153_449 98
456 3300046684 Ga0495669_0000114 Ga0495669_0000114_48318_48614 98
457 3300046684 Ga0495669_0000375 Ga0495669_0000375_1232_1540 98
458 3300046684 Ga0495669_0032254 Ga0495669_0032254_1968_2264 98
459 3300046684 Ga0495669_0435346 Ga0495669_0435346_291_587 98
460 3300046690 Ga0495624_0064980 Ga0495624_0064980_1934_2230 98
461 3300046691 Ga0495670_0607589 Ga0495670_0607589_102_413 98
462 3300046692 Ga0495671_0197556 Ga0495671_0197556_569_865 98
463 3300046794 Ga0495589_0036990 Ga0495589_0036990_2134_2430 98
464 3300046810 Ga0495660_0033231 Ga0495660_0033231_203_499 98
465 3300046810 Ga0495660_0199554 Ga0495660_0199554_330_626 98
466 3300046810 Ga0495660_0336714 Ga0495660_0336714_353_649 98
467 3300047315 Ga0495581_0085549 Ga0495581_0085549_1430_1726 98
468 3300047315 Ga0495581_0428986 Ga0495581_0428986_270_566 98
469 3300047318 Ga0495636_0336167 Ga0495636_0336167_335_646 98
470 3300047320 Ga0495672_0000647 Ga0495672_0000647_35543_35839 98
471 3300047320 Ga0495672_0268436 Ga0495672_0268436_104_415 98
472 3300047323 Ga0495683_0071213 Ga0495683_0071213_89_385 98
473 3300047445 Ga0495677_0064579 Ga0495677_0064579_210_518 98
474 3300047446 Ga0495679_007054 Ga0495679_007054_3868_4164 98
475 3300047469 Ga0495673_0000078 Ga0495673_0000078_134189_134485 98
476 3300047469 Ga0495673_0000330 Ga0495673_0000330_7152_7448 98
477 3300047469 Ga0495673_0015305 Ga0495673_0015305_512_808 98
478 3300047470 Ga0495681_0120479 Ga0495681_0120479_86_382 98
479 3300047472 Ga0495686_0000525 Ga0495686_0000525_37773_38069 98
480 3300047472 Ga0495686_0008089 Ga0495686_0008089_1016_1312 98
481 3300047472 Ga0495686_0174098 Ga0495686_0174098_405_701 98
482 3300047472 Ga0495686_0398726 Ga0495686_0398726_223_519 98
483 3300047472 Ga0495686_0509984 Ga0495686_0509984_29_334 98
484 3300047673 Ga0495593_0019427 Ga0495593_0019427_3313_3609 98
485 3300048088 Ga0495602_0449010 Ga0495602_0449010_555_851 98
486 3300048903 Ga0496100_0187330 Ga0496100_0187330_288_599 98
487 3300048904 Ga0496101_0196674 Ga0496101_0196674_690_986 98
488 3300048904 Ga0496101_0397153 Ga0496101_0397153_190_501 98
489 3300048905 Ga0496102_0010654 Ga0496102_0010654_570_878 98
490 3300048905 Ga0496102_0078602 Ga0496102_0078602_1219_1530 98
491 3300048905 Ga0496102_1164745 Ga0496102_1164745_92_388 98
492 3300048906 Ga0496103_0056762 Ga0496103_0056762_1292_1603 98
493 3300048906 Ga0496103_0198133 Ga0496103_0198133_663_971 98
494 3300048907 Ga0496104_0796591 Ga0496104_0796591_489_797 98
495 3300048907 Ga0496104_1885387 Ga0496104_1885387_136_432 98
496 3300048908 Ga0496105_0561225 Ga0496105_0561225_345_653 98
497 3300048909 Ga0496106_0024831 Ga0496106_0024831_864_1160 98
498 3300048909 Ga0496106_0722403 Ga0496106_0722403_286_582 98
499 3300048910 Ga0496107_0000023 Ga0496107_0000023_118827_119123 98
500 3300048910 Ga0496107_0314174 Ga0496107_0314174_612_908 98
501 3300048911 Ga0496108_0668921 Ga0496108_0668921_539_835 98
502 3300048912 Ga0496109_0023216 Ga0496109_0023216_2441_2752 98
503 3300048915 Ga0496112_1003981 Ga0496112_1003981_318_629 98
504 3300048916 Ga0496113_0086491 Ga0496113_0086491_1411_1722 98
505 3300048918 Ga0496115_0056404 Ga0496115_0056404_1703_2017 98
506 3300048918 Ga0496115_0096783 Ga0496115_0096783_793_1104 98
507 3300048918 Ga0496115_0105546 Ga0496115_0105546_664_960 98
508 3300048919 Ga0496116_0161558 Ga0496116_0161558_92_388 98
509 3300048921 Ga0496118_0045404 Ga0496118_0045404_1158_1454 98
510 3300048922 Ga0496119_0101551 Ga0496119_0101551_652_948 98
511 3300048922 Ga0496119_0364199 Ga0496119_0364199_198_494 98
512 3300048924 Ga0496121_0000009 Ga0496121_0000009_38903_39199 98
513 3300048924 Ga0496121_0017079 Ga0496121_0017079_2223_2519 98
514 3300048925 Ga0496122_0290588 Ga0496122_0290588_285_581 98
515 3300048927 Ga0496124_0220272 Ga0496124_0220272_775_1071 98
516 3300048927 Ga0496124_0235005 Ga0496124_0235005_784_1116 98
517 3300048928 Ga0496125_0505751 Ga0496125_0505751_354_650 98
518 3300048929 Ga0496126_0315991 Ga0496126_0315991_232_528 98
519 3300049459 Ga0495678_002702 Ga0495678_002702_10509_10805 98
520 3300049459 Ga0495678_134065 Ga0495678_134065_349_645 98
521 3300049460 Ga0495682_0057491 Ga0495682_0057491_1021_1317 98
522 3300049571 Ga0501034_0002380 Ga0501034_0002380_844_1158 98
523 3300049573 Ga0501037_0255526 Ga0501037_0255526_507_824 98
524 3300049574 Ga0501038_0395005 Ga0501038_0395005_382_696 98
525 3300049574 Ga0501038_0878138 Ga0501038_0878138_30_347 98
526 3300049579 Ga0501043_1177919 Ga0501043_1177919_67_363 98
527 3300049581 Ga0501047_0005360 Ga0501047_0005360_2068_2364 98
528 3300049581 Ga0501047_0015925 Ga0501047_0015925_4012_4308 98
529 3300049581 Ga0501047_0072292 Ga0501047_0072292_36_332 98
530 3300049581 Ga0501047_0468006 Ga0501047_0468006_259_555 98
531 3300049581 Ga0501047_0518541 Ga0501047_0518541_451_747 98
532 3300049581 Ga0501047_0605530 Ga0501047_0605530_15_311 98
533 3300049671 Ga0501238_000728 Ga0501238_000728_2758_3054 98
534 3300049671 Ga0501238_006716 Ga0501238_006716_1089_1385 98
535 3300049686 Ga0501257_003780 Ga0501257_003780_1979_2275 98
536 3300049686 Ga0501257_190253 Ga0501257_190253_152_502 98
537 3300049742 Ga0501080_1778774 Ga0501080_1778774_111_425 98
538 3300049822 Ga0501035_0731082 Ga0501035_0731082_451_747 98
539 3300049823 Ga0501044_0000504 Ga0501044_0000504_16323_16640 98
540 3300049823 Ga0501044_0005853 Ga0501044_0005853_3545_3841 98
541 3300049823 Ga0501044_0260458 Ga0501044_0260458_112_471 98
542 3300049823 Ga0501044_0350158 Ga0501044_0350158_664_960 98
543 3300049823 Ga0501044_1139595 Ga0501044_1139595_79_375 98
544 3300049823 Ga0501044_1351592 Ga0501044_1351592_96_392 98
545 3300050493 nmdc:mga0k408_19270_c1 nmdc:mga0k408_19270_c1_1655_1951 98
546 3300050493 nmdc:mga0k408_88519_c1 nmdc:mga0k408_88519_c1_141_437 98
547 3300050496 nmdc:mga07m45_747425_c1 nmdc:mga07m45_747425_c1_83_379 98
548 3300053077 Ga0495601_0482140 Ga0495601_0482140_418_756 98
549 3300053080 Ga0500635_0000302 Ga0500635_0000302_13361_13657 98
550 3300053086 Ga0500578_0000008 Ga0500578_0000008_7597_7893 98
551 3300053086 Ga0500578_0271497 Ga0500578_0271497_527_823 98
552 3300053087 Ga0500643_006804 Ga0500643_006804_2935_3231 98
553 3300053087 Ga0500643_017285 Ga0500643_017285_604_900 98
554 3300053087 Ga0500643_092806 Ga0500643_092806_471_767 98
555 3300053088 Ga0500644_0000028 Ga0500644_0000028_85825_86121 98
556 3300053090 Ga0500646_0132559 Ga0500646_0132559_459_755 98
557 3300053090 Ga0500646_0224708 Ga0500646_0224708_314_610 98
558 3300053091 Ga0500647_0045013 Ga0500647_0045013_1230_1526 98
559 3300053093 Ga0500651_0038819 Ga0500651_0038819_192_488 98
560 3300053093 Ga0500651_0200404 Ga0500651_0200404_299_595 98
561 3300053094 Ga0500566_0089867 Ga0500566_0089867_515_811 98
562 3300053096 Ga0500641_0072090 Ga0500641_0072090_951_1247 98
563 3300053096 Ga0500641_0163247 Ga0500641_0163247_616_912 98
564 3300053102 Ga0500554_084004 Ga0500554_084004_202_498 98
565 3300053103 Ga0500555_001817 Ga0500555_001817_1731_2027 98
566 3300053103 Ga0500555_115700 Ga0500555_115700_347_643 98
567 3300053104 Ga0500556_0003050 Ga0500556_0003050_3512_3808 98
568 3300053104 Ga0500556_0048840 Ga0500556_0048840_638_934 98
569 3300053104 Ga0500556_0100926 Ga0500556_0100926_752_1048 98
570 3300053108 Ga0500562_002026 Ga0500562_002026_3813_4238 98
571 3300053108 Ga0500562_004573 Ga0500562_004573_1798_2094 98
572 3300053109 Ga0500569_102730 Ga0500569_102730_545_841 98
573 3300053111 Ga0500572_099153 Ga0500572_099153_569_865 98
574 3300053118 Ga0500594_0000309 Ga0500594_0000309_7551_7847 98
575 3300053119 Ga0500595_004249 Ga0500595_004249_2851_3147 98
576 3300053121 Ga0500607_040329 Ga0500607_040329_1021_1317 98
577 3300053121 Ga0500607_233215 Ga0500607_233215_443_739 98
578 3300053122 Ga0500608_000573 Ga0500608_000573_1605_1901 98
579 3300053122 Ga0500608_060706 Ga0500608_060706_897_1193 98
580 3300053122 Ga0500608_179056 Ga0500608_179056_325_621 98
581 3300053123 Ga0500614_010544 Ga0500614_010544_537_833 98
582 3300053123 Ga0500614_013483 Ga0500614_013483_629_925 98
583 3300053125 Ga0500618_000060 Ga0500618_000060_31882_32178 98
584 3300053130 Ga0500642_0097207 Ga0500642_0097207_306_602 98
585 3300053130 Ga0500642_0109215 Ga0500642_0109215_68_364 98
586 3300053133 Ga0500655_021803 Ga0500655_021803_637_933 98
587 3300053133 Ga0500655_025521 Ga0500655_025521_278_574 98
588 3300053134 Ga0500658_0073550 Ga0500658_0073550_858_1154 98
589 3300053134 Ga0500658_0127586 Ga0500658_0127586_461_757 98
590 3300053134 Ga0500658_0419095 Ga0500658_0419095_11_307 98
591 3300053136 Ga0500559_0000005 Ga0500559_0000005_198499_198795 98
592 3300053136 Ga0500559_0012527 Ga0500559_0012527_230_526 98
593 3300053136 Ga0500559_0294342 Ga0500559_0294342_78_374 98
594 3300053138 Ga0500564_001092 Ga0500564_001092_6970_7266 98
595 3300053142 Ga0500577_0003928 Ga0500577_0003928_2052_2348 98
596 3300053148 Ga0500590_014706 Ga0500590_014706_3326_3622 98
597 3300053148 Ga0500590_319095 Ga0500590_319095_263_559 98
598 3300053153 Ga0500616_0006751 Ga0500616_0006751_6294_6590 98
599 3300053153 Ga0500616_0404338 Ga0500616_0404338_30_326 98
600 3300053154 Ga0500619_002486 Ga0500619_002486_1846_2142 98
601 3300053156 Ga0500622_0000105 Ga0500622_0000105_24577_24873 98
602 3300053156 Ga0500622_0024588 Ga0500622_0024588_1190_1486 98
603 3300053158 Ga0500627_0032197 Ga0500627_0032197_1153_1449 98
604 3300053160 Ga0500633_0203022 Ga0500633_0203022_373_669 98
605 3300053162 Ga0500638_162590 Ga0500638_162590_664_960 98
606 3300053162 Ga0500638_174350 Ga0500638_174350_356_652 98
607 3300053177 Ga0500636_0078861 Ga0500636_0078861_1355_1651 98
608 3300053177 Ga0500636_0127369 Ga0500636_0127369_897_1193 98
609 3300053178 Ga0500637_0061730 Ga0500637_0061730_1240_1536 98
610 3300053178 Ga0500637_0087263 Ga0500637_0087263_507_803 98
611 3300053725 Ga0500576_044374 Ga0500576_044374_698_994 98
612 3300053727 Ga0500611_010295 Ga0500611_010295_867_1163 98
613 3300053729 Ga0500625_015994 Ga0500625_015994_565_861 98
614 3300053730 Ga0500645_005969 Ga0500645_005969_798_1094 98
615 3300053731 Ga0500609_006570 Ga0500609_006570_826_1122 98
616 3300053735 Ga0500596_000489 Ga0500596_000489_3972_4268 98
617 3300055283 Ga0500661_101066 Ga0500661_101066_187_483 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04977

DivIC

Septum formation initiator

38

119

0.97

Feature Viewer

pLDDT pTM Quality
73.81 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map