F469627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 617 | 315 | 617 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10191413|Ga0105240_101914133 |
| Length | 119 |
| Sequence | MVSSALSTVRQGAGIAHGFVSVLPYVRPYLPTALLVLLIVYFAMNAFTGDRGLLSSNQRDEALVGKTRELAQLRAQRADLEMRARLLRDTSLSRDLLEERARSLLGFADPRDYVIRMKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 53 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 145 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 148 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 149 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 151 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 152 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 153 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 171 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 172 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 175 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 178 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 179 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 180 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 181 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 182 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 183 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 184 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 188 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 266 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 271 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 274 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 275 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 276 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 278 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 279 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 280 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 281 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 282 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 283 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 284 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 285 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 286 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 287 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 288 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 289 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 290 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 291 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 292 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 293 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 295 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 296 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 298 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 300 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 301 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 303 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 304 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 306 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 309 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 310 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 311 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 312 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 314 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 315 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.18 |
| Nodule | 0.16 |
| Rhizoplane | 3.89 |
| Rhizosphere | 73.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10013301 | 3300003215 | Bacteria | 3485 |
| 2 | rootH2_10147346 | 3300003320 | Bacteria | 1815 |
| 3 | Ga0055526_1070314 | 3300003771 | Bacteria | 712 |
| 4 | Ga0055537_1001022 | 3300003773 | Bacteria | 12643 |
| 5 | Ga0055524_1021277 | 3300003775 | Bacteria | 2155 |
| 6 | Ga0055524_1053809 | 3300003775 | Bacteria | 887 |
| 7 | Ga0055528_1002711 | 3300003790 | Bacteria | 9311 |
| 8 | Ga0055530_10002729 | 3300003791 | Bacteria | 10945 |
| 9 | Ga0055530_10033909 | 3300003791 | Bacteria | 1310 |
| 10 | Ga0055531_10000966 | 3300003794 | Bacteria | 23016 |
| 11 | Ga0055531_10001958 | 3300003794 | Bacteria | 14377 |
| 12 | Ga0065165_1000277 | 3300005262 | Bacteria | 87540 |
| 13 | Ga0065165_1001667 | 3300005262 | Bacteria | 22484 |
| 14 | Ga0065165_1126859 | 3300005262 | Archaea | 614 |
| 15 | Ga0070658_10145626 | 3300005327 | Bacteria | 1981 |
| 16 | Ga0070658_10192462 | 3300005327 | Bacteria | 1719 |
| 17 | Ga0070658_10488668 | 3300005327 | Bacteria | 1063 |
| 18 | Ga0070658_11256377 | 3300005327 | Bacteria | 643 |
| 19 | Ga0070658_11285186 | 3300005327 | Bacteria | 636 |
| 20 | Ga0070670_100000037 | 3300005331 | Bacteria | 156070 |
| 21 | Ga0070670_100114793 | 3300005331 | Bacteria | 2321 |
| 22 | Ga0070670_100868082 | 3300005331 | Bacteria | 817 |
| 23 | Ga0068869_100317281 | 3300005334 | Bacteria | 1263 |
| 24 | Ga0070680_100053013 | 3300005336 | Bacteria | 3310 |
| 25 | Ga0068868_100538291 | 3300005338 | Bacteria | 1028 |
| 26 | Ga0070660_100096530 | 3300005339 | Bacteria | 2337 |
| 27 | Ga0070660_100377096 | 3300005339 | Bacteria | 1171 |
| 28 | Ga0070660_101671984 | 3300005339 | Bacteria | 542 |
| 29 | Ga0070691_10023519 | 3300005341 | Bacteria | 2862 |
| 30 | Ga0070661_100355062 | 3300005344 | Bacteria | 1151 |
| 31 | Ga0070661_101566067 | 3300005344 | Bacteria | 557 |
| 32 | Ga0070661_101661478 | 3300005344 | Unclassified | 541 |
| 33 | Ga0070692_11057857 | 3300005345 | Bacteria | 571 |
| 34 | Ga0070668_100000097 | 3300005347 | Bacteria | 53800 |
| 35 | Ga0070668_100001398 | 3300005347 | Bacteria | 17348 |
| 36 | Ga0070668_100006261 | 3300005347 | Bacteria | 8813 |
| 37 | Ga0070668_100058909 | 3300005347 | Bacteria | 2972 |
| 38 | Ga0070675_100676856 | 3300005354 | Bacteria | 939 |
| 39 | Ga0070675_101250234 | 3300005354 | Bacteria | 684 |
| 40 | Ga0070671_100211856 | 3300005355 | Bacteria | 1643 |
| 41 | Ga0070659_100000206 | 3300005366 | Bacteria | 45867 |
| 42 | Ga0070659_100005903 | 3300005366 | Bacteria | 8821 |
| 43 | Ga0070659_100661812 | 3300005366 | Bacteria | 901 |
| 44 | Ga0070659_100862382 | 3300005366 | Bacteria | 790 |
| 45 | Ga0070659_101372480 | 3300005366 | Bacteria | 628 |
| 46 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 47 | Ga0070667_100061211 | 3300005367 | Bacteria | 3187 |
| 48 | Ga0070667_100391499 | 3300005367 | Bacteria | 1264 |
| 49 | Ga0070667_100465990 | 3300005367 | Bacteria | 1156 |
| 50 | Ga0070667_100687984 | 3300005367 | Bacteria | 946 |
| 51 | Ga0070705_101249291 | 3300005440 | Bacteria | 614 |
| 52 | Ga0070663_100097209 | 3300005455 | Bacteria | 2192 |
| 53 | Ga0070663_101262569 | 3300005455 | Unclassified | 651 |
| 54 | Ga0070678_100095809 | 3300005456 | Bacteria | 2288 |
| 55 | Ga0070662_100080288 | 3300005457 | Bacteria | 2428 |
| 56 | Ga0070662_100302959 | 3300005457 | Bacteria | 1299 |
| 57 | Ga0070681_10019846 | 3300005458 | Bacteria | 6732 |
| 58 | Ga0070681_10063521 | 3300005458 | Bacteria | 3664 |
| 59 | Ga0070685_10417517 | 3300005466 | Bacteria | 933 |
| 60 | Ga0070679_100003462 | 3300005530 | Bacteria | 14454 |
| 61 | Ga0070679_100044372 | 3300005530 | Bacteria | 4429 |
| 62 | Ga0070679_100704195 | 3300005530 | Bacteria | 953 |
| 63 | Ga0068853_100057502 | 3300005539 | Bacteria | 3356 |
| 64 | Ga0068853_100245881 | 3300005539 | Bacteria | 1641 |
| 65 | Ga0068853_100272882 | 3300005539 | Bacteria | 1558 |
| 66 | Ga0068853_100395554 | 3300005539 | Bacteria | 1293 |
| 67 | Ga0070686_101210451 | 3300005544 | Bacteria | 628 |
| 68 | Ga0070665_100000116 | 3300005548 | Bacteria | 150141 |
| 69 | Ga0070665_100000278 | 3300005548 | Bacteria | 84248 |
| 70 | Ga0070665_100000483 | 3300005548 | Bacteria | 57237 |
| 71 | Ga0070665_100677183 | 3300005548 | Bacteria | 1044 |
| 72 | Ga0070665_100962862 | 3300005548 | Bacteria | 866 |
| 73 | Ga0070665_102279935 | 3300005548 | Unclassified | 545 |
| 74 | Ga0068855_100098841 | 3300005563 | Bacteria | 3361 |
| 75 | Ga0068855_100114730 | 3300005563 | Bacteria | 3088 |
| 76 | Ga0068855_101027662 | 3300005563 | Bacteria | 865 |
| 77 | Ga0068855_101345346 | 3300005563 | Bacteria | 738 |
| 78 | Ga0068855_101552010 | 3300005563 | Bacteria | 679 |
| 79 | Ga0070664_100064257 | 3300005564 | Bacteria | 3130 |
| 80 | Ga0070664_100304364 | 3300005564 | Bacteria | 1441 |
| 81 | Ga0070664_100677070 | 3300005564 | Bacteria | 960 |
| 82 | Ga0068857_101470012 | 3300005577 | Bacteria | 664 |
| 83 | Ga0068854_100523656 | 3300005578 | Bacteria | 1002 |
| 84 | Ga0068854_101795851 | 3300005578 | Bacteria | 562 |
| 85 | Ga0068856_100876569 | 3300005614 | Bacteria | 917 |
| 86 | Ga0068852_100621770 | 3300005616 | Bacteria | 1086 |
| 87 | Ga0068859_100137076 | 3300005617 | Bacteria | 2521 |
| 88 | Ga0068859_101044915 | 3300005617 | Bacteria | 898 |
| 89 | Ga0068864_100000115 | 3300005618 | Bacteria | 79542 |
| 90 | Ga0068864_100000786 | 3300005618 | Bacteria | 26635 |
| 91 | Ga0068864_100026445 | 3300005618 | Bacteria | 4894 |
| 92 | Ga0068861_100528720 | 3300005719 | Bacteria | 1071 |
| 93 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 94 | Ga0068863_100000392 | 3300005841 | Bacteria | 44421 |
| 95 | Ga0068863_100152772 | 3300005841 | Bacteria | 2209 |
| 96 | Ga0068863_102491844 | 3300005841 | Bacteria | 527 |
| 97 | Ga0068858_100000031 | 3300005842 | Bacteria | 143397 |
| 98 | Ga0068858_100004211 | 3300005842 | Bacteria | 14164 |
| 99 | Ga0068858_100574859 | 3300005842 | Bacteria | 1092 |
| 100 | Ga0068858_102531228 | 3300005842 | Unclassified | 507 |
| 101 | Ga0068860_100000128 | 3300005843 | Bacteria | 122731 |
| 102 | Ga0068860_100060495 | 3300005843 | Bacteria | 3599 |
| 103 | Ga0068862_100001627 | 3300005844 | Bacteria | 20442 |
| 104 | Ga0068862_100012654 | 3300005844 | Bacteria | 6983 |
| 105 | Ga0068862_100171133 | 3300005844 | Bacteria | 1945 |
| 106 | Ga0070717_10194214 | 3300006028 | Bacteria | 1775 |
| 107 | Ga0075362_10735639 | 3300006177 | Bacteria | 516 |
| 108 | Ga0075366_10050358 | 3300006195 | Bacteria | 2473 |
| 109 | Ga0075366_10458226 | 3300006195 | Bacteria | 787 |
| 110 | Ga0075370_10067984 | 3300006353 | Bacteria | 2034 |
| 111 | Ga0097620_100137068 | 3300006931 | Bacteria | 2521 |
| 112 | Ga0097620_101045082 | 3300006931 | Bacteria | 898 |
| 113 | Ga0079104_1037307 | 3300006946 | Bacteria | 1159 |
| 114 | Ga0105250_10026243 | 3300009092 | Bacteria | 2346 |
| 115 | Ga0105240_10005944 | 3300009093 | Bacteria | 18065 |
| 116 | Ga0105240_10040708 | 3300009093 | Bacteria | 5940 |
| 117 | Ga0105240_10043434 | 3300009093 | Bacteria | 5719 |
| 118 | Ga0105240_10188036 | 3300009093 | Bacteria | 2431 |
| 119 | Ga0105240_10191413 | 3300009093 | Bacteria | 2405 |
| 120 | Ga0105240_11392717 | 3300009093 | Bacteria | 737 |
| 121 | Ga0105245_10908894 | 3300009098 | Bacteria | 922 |
| 122 | Ga0105247_10022438 | 3300009101 | Bacteria | 3802 |
| 123 | Ga0105247_10513887 | 3300009101 | Bacteria | 875 |
| 124 | Ga0105241_12079668 | 3300009174 | Bacteria | 561 |
| 125 | Ga0105241_12484451 | 3300009174 | Bacteria | 518 |
| 126 | Ga0105248_10038574 | 3300009177 | Bacteria | 5347 |
| 127 | Ga0105248_10041310 | 3300009177 | Bacteria | 5170 |
| 128 | Ga0105248_10050796 | 3300009177 | Bacteria | 4651 |
| 129 | Ga0105248_10907946 | 3300009177 | Bacteria | 995 |
| 130 | Ga0105248_11114173 | 3300009177 | Bacteria | 892 |
| 131 | Ga0105237_10695156 | 3300009545 | Bacteria | 1024 |
| 132 | Ga0105238_10056774 | 3300009551 | Bacteria | 3927 |
| 133 | Ga0105238_10348261 | 3300009551 | Bacteria | 1470 |
| 134 | Ga0105238_10960091 | 3300009551 | Bacteria | 875 |
| 135 | Ga0105238_11173114 | 3300009551 | Bacteria | 792 |
| 136 | Ga0105238_11384886 | 3300009551 | Bacteria | 730 |
| 137 | Ga0105249_10000410 | 3300009553 | Bacteria | 41122 |
| 138 | Ga0105249_10098444 | 3300009553 | Bacteria | 2747 |
| 139 | Ga0105249_10210746 | 3300009553 | Bacteria | 1907 |
| 140 | Ga0105249_11515628 | 3300009553 | Bacteria | 743 |
| 141 | Ga0105239_10274989 | 3300010375 | Bacteria | 1895 |
| 142 | Ga0105239_10538089 | 3300010375 | Bacteria | 1330 |
| 143 | Ga0105239_10729711 | 3300010375 | Bacteria | 1133 |
| 144 | Ga0105239_11477333 | 3300010375 | Bacteria | 785 |
| 145 | Ga0105246_10713124 | 3300011119 | Bacteria | 881 |
| 146 | Ga0157319_1056325 | 3300012497 | Bacteria | 501 |
| 147 | Ga0157373_10007392 | 3300013100 | Bacteria | 8175 |
| 148 | Ga0157373_10007540 | 3300013100 | Bacteria | 8089 |
| 149 | Ga0157373_10682914 | 3300013100 | Bacteria | 751 |
| 150 | Ga0157370_10396848 | 3300013104 | Bacteria | 1270 |
| 151 | Ga0157370_11797833 | 3300013104 | Bacteria | 550 |
| 152 | Ga0157369_10446843 | 3300013105 | Bacteria | 1339 |
| 153 | Ga0157369_10819580 | 3300013105 | Bacteria | 956 |
| 154 | Ga0157374_10402262 | 3300013296 | Bacteria | 1366 |
| 155 | Ga0157378_10991010 | 3300013297 | Bacteria | 874 |
| 156 | Ga0163162_11891683 | 3300013306 | Bacteria | 683 |
| 157 | Ga0157372_11404771 | 3300013307 | Bacteria | 805 |
| 158 | Ga0157372_11410539 | 3300013307 | Bacteria | 803 |
| 159 | Ga0157372_12113280 | 3300013307 | Bacteria | 647 |
| 160 | Ga0157375_10205678 | 3300013308 | Bacteria | 2125 |
| 161 | Ga0163163_10868359 | 3300014325 | Bacteria | 965 |
| 162 | Ga0163163_11464740 | 3300014325 | Bacteria | 744 |
| 163 | Ga0163163_11504384 | 3300014325 | Bacteria | 734 |
| 164 | Ga0163163_11736621 | 3300014325 | Bacteria | 685 |
| 165 | Ga0163163_11869384 | 3300014325 | Bacteria | 660 |
| 166 | Ga0157380_11109417 | 3300014326 | Bacteria | 830 |
| 167 | Ga0157377_10722912 | 3300014745 | Bacteria | 725 |
| 168 | Ga0157379_10080776 | 3300014968 | Bacteria | 2913 |
| 169 | Ga0157379_10174569 | 3300014968 | Bacteria | 1940 |
| 170 | Ga0157379_11508367 | 3300014968 | Bacteria | 654 |
| 171 | Ga0182006_1071517 | 3300015261 | Bacteria | 1285 |
| 172 | Ga0163161_10527455 | 3300017792 | Bacteria | 965 |
| 173 | Ga0163161_11349309 | 3300017792 | Bacteria | 621 |
| 174 | Ga0213876_10035545 | 3300021384 | Bacteria | 2628 |
| 175 | Ga0213876_10147319 | 3300021384 | Bacteria | 1252 |
| 176 | Ga0209148_1007316 | 3300025254 | Bacteria | 2306 |
| 177 | Ga0209148_1015725 | 3300025254 | Bacteria | 1316 |
| 178 | Ga0209565_1000641 | 3300025263 | Bacteria | 22666 |
| 179 | Ga0209673_1003300 | 3300025273 | Bacteria | 9678 |
| 180 | Ga0209673_1016328 | 3300025273 | Bacteria | 2782 |
| 181 | Ga0209675_1003569 | 3300025291 | Bacteria | 7324 |
| 182 | Ga0209564_1004845 | 3300025295 | Bacteria | 8001 |
| 183 | Ga0209564_1036944 | 3300025295 | Bacteria | 1384 |
| 184 | Ga0209758_1001863 | 3300025297 | Bacteria | 23117 |
| 185 | Ga0209758_1007301 | 3300025297 | Bacteria | 7578 |
| 186 | Ga0209758_1008993 | 3300025297 | Bacteria | 6316 |
| 187 | Ga0209050_1000200 | 3300025298 | Bacteria | 134115 |
| 188 | Ga0209050_1012865 | 3300025298 | Bacteria | 3786 |
| 189 | Ga0209256_1002428 | 3300025299 | Bacteria | 15246 |
| 190 | Ga0209256_1002898 | 3300025299 | Bacteria | 12975 |
| 191 | Ga0209257_1000225 | 3300025304 | Bacteria | 134023 |
| 192 | Ga0209257_1000944 | 3300025304 | Bacteria | 40166 |
| 193 | Ga0207656_10390547 | 3300025321 | Bacteria | 698 |
| 194 | Ga0207696_1022235 | 3300025711 | Bacteria | 2018 |
| 195 | Ga0207710_10077787 | 3300025900 | Bacteria | 1533 |
| 196 | Ga0207710_10187177 | 3300025900 | Bacteria | 1018 |
| 197 | Ga0207710_10677661 | 3300025900 | Bacteria | 540 |
| 198 | Ga0207680_10231626 | 3300025903 | Bacteria | 1270 |
| 199 | Ga0207680_10652795 | 3300025903 | Bacteria | 753 |
| 200 | Ga0207643_10359984 | 3300025908 | Bacteria | 914 |
| 201 | Ga0207705_10007993 | 3300025909 | Bacteria | 7759 |
| 202 | Ga0207705_10385445 | 3300025909 | Bacteria | 1083 |
| 203 | Ga0207705_10474398 | 3300025909 | Bacteria | 971 |
| 204 | Ga0207654_10863993 | 3300025911 | Bacteria | 655 |
| 205 | Ga0207707_10016260 | 3300025912 | Bacteria | 6490 |
| 206 | Ga0207707_10322269 | 3300025912 | Bacteria | 1334 |
| 207 | Ga0207695_10001670 | 3300025913 | Bacteria | 35733 |
| 208 | Ga0207695_10001727 | 3300025913 | Bacteria | 34901 |
| 209 | Ga0207695_10015061 | 3300025913 | Bacteria | 9122 |
| 210 | Ga0207695_10021597 | 3300025913 | Bacteria | 7340 |
| 211 | Ga0207695_10133106 | 3300025913 | Bacteria | 2442 |
| 212 | Ga0207695_10152637 | 3300025913 | Bacteria | 2248 |
| 213 | Ga0207695_10957179 | 3300025913 | Bacteria | 736 |
| 214 | Ga0207695_11029023 | 3300025913 | Bacteria | 703 |
| 215 | Ga0207671_10435328 | 3300025914 | Bacteria | 1044 |
| 216 | Ga0207671_11353336 | 3300025914 | Unclassified | 553 |
| 217 | Ga0207660_10180924 | 3300025917 | Bacteria | 1637 |
| 218 | Ga0207660_10385162 | 3300025917 | Bacteria | 1127 |
| 219 | Ga0207657_10012109 | 3300025919 | Bacteria | 8523 |
| 220 | Ga0207649_10453765 | 3300025920 | Bacteria | 968 |
| 221 | Ga0207649_10585403 | 3300025920 | Bacteria | 857 |
| 222 | Ga0207649_10902014 | 3300025920 | Bacteria | 693 |
| 223 | Ga0207652_10042473 | 3300025921 | Bacteria | 3870 |
| 224 | Ga0207652_10046510 | 3300025921 | Bacteria | 3702 |
| 225 | Ga0207652_11176863 | 3300025921 | Bacteria | 668 |
| 226 | Ga0207694_10040124 | 3300025924 | Bacteria | 3604 |
| 227 | Ga0207694_10105146 | 3300025924 | Bacteria | 2241 |
| 228 | Ga0207694_10655671 | 3300025924 | Bacteria | 884 |
| 229 | Ga0207694_10676640 | 3300025924 | Bacteria | 870 |
| 230 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 231 | Ga0207650_10023019 | 3300025925 | Bacteria | 4415 |
| 232 | Ga0207687_10475837 | 3300025927 | Bacteria | 1039 |
| 233 | Ga0207644_10106649 | 3300025931 | Bacteria | 2112 |
| 234 | Ga0207690_10000129 | 3300025932 | Bacteria | 62350 |
| 235 | Ga0207690_10075218 | 3300025932 | Bacteria | 2341 |
| 236 | Ga0207706_10111580 | 3300025933 | Bacteria | 2406 |
| 237 | Ga0207706_10444125 | 3300025933 | Bacteria | 1122 |
| 238 | Ga0207711_10022877 | 3300025941 | Bacteria | 5231 |
| 239 | Ga0207711_10024435 | 3300025941 | Bacteria | 5063 |
| 240 | Ga0207711_10106029 | 3300025941 | Bacteria | 2493 |
| 241 | Ga0207711_10394789 | 3300025941 | Bacteria | 1285 |
| 242 | Ga0207711_10411358 | 3300025941 | Bacteria | 1257 |
| 243 | Ga0207689_10155093 | 3300025942 | Bacteria | 1887 |
| 244 | Ga0207689_10432256 | 3300025942 | Bacteria | 1099 |
| 245 | Ga0207661_11064949 | 3300025944 | Bacteria | 745 |
| 246 | Ga0207661_11266424 | 3300025944 | Bacteria | 678 |
| 247 | Ga0207661_11739239 | 3300025944 | Bacteria | 569 |
| 248 | Ga0207679_10013998 | 3300025945 | Bacteria | 5262 |
| 249 | Ga0207679_10112370 | 3300025945 | Bacteria | 2153 |
| 250 | Ga0207679_10955602 | 3300025945 | Bacteria | 785 |
| 251 | Ga0207667_10043300 | 3300025949 | Bacteria | 4778 |
| 252 | Ga0207667_10634029 | 3300025949 | Bacteria | 1075 |
| 253 | Ga0207667_10962401 | 3300025949 | Bacteria | 843 |
| 254 | Ga0207667_11327801 | 3300025949 | Bacteria | 695 |
| 255 | Ga0207651_10106194 | 3300025960 | Bacteria | 2096 |
| 256 | Ga0207712_10001004 | 3300025961 | Bacteria | 20092 |
| 257 | Ga0207712_10111886 | 3300025961 | Bacteria | 2049 |
| 258 | Ga0207668_10000028 | 3300025972 | Bacteria | 125361 |
| 259 | Ga0207668_10000507 | 3300025972 | Bacteria | 24393 |
| 260 | Ga0207668_10005956 | 3300025972 | Bacteria | 7185 |
| 261 | Ga0207640_10459030 | 3300025981 | Bacteria | 1052 |
| 262 | Ga0207640_11187004 | 3300025981 | Bacteria | 678 |
| 263 | Ga0207640_11646854 | 3300025981 | Bacteria | 579 |
| 264 | Ga0207658_10000209 | 3300025986 | Bacteria | 61041 |
| 265 | Ga0207658_10049046 | 3300025986 | Bacteria | 3100 |
| 266 | Ga0207658_10359415 | 3300025986 | Bacteria | 1270 |
| 267 | Ga0207658_10443625 | 3300025986 | Bacteria | 1148 |
| 268 | Ga0207677_10112672 | 3300026023 | Bacteria | 2029 |
| 269 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 270 | Ga0207703_10003500 | 3300026035 | Bacteria | 13131 |
| 271 | Ga0207703_10263749 | 3300026035 | Bacteria | 1558 |
| 272 | Ga0207639_10034165 | 3300026041 | Bacteria | 3757 |
| 273 | Ga0207639_10134102 | 3300026041 | Bacteria | 2054 |
| 274 | Ga0207639_10261768 | 3300026041 | Bacteria | 1513 |
| 275 | Ga0207639_10340443 | 3300026041 | Bacteria | 1337 |
| 276 | Ga0207639_11174242 | 3300026041 | Bacteria | 720 |
| 277 | Ga0207678_10239484 | 3300026067 | Bacteria | 1554 |
| 278 | Ga0207678_10665928 | 3300026067 | Bacteria | 915 |
| 279 | Ga0207678_11386480 | 3300026067 | Bacteria | 621 |
| 280 | Ga0207708_11142745 | 3300026075 | Bacteria | 680 |
| 281 | Ga0207702_10381961 | 3300026078 | Bacteria | 1355 |
| 282 | Ga0207702_10472207 | 3300026078 | Bacteria | 1220 |
| 283 | Ga0207702_11876756 | 3300026078 | Bacteria | 591 |
| 284 | Ga0207702_12305779 | 3300026078 | Bacteria | 526 |
| 285 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 286 | Ga0207641_10000341 | 3300026088 | Bacteria | 56155 |
| 287 | Ga0207641_11356611 | 3300026088 | Bacteria | 712 |
| 288 | Ga0207641_12459287 | 3300026088 | Unclassified | 519 |
| 289 | Ga0207676_10000255 | 3300026095 | Bacteria | 46136 |
| 290 | Ga0207676_10000797 | 3300026095 | Bacteria | 24574 |
| 291 | Ga0207676_10005948 | 3300026095 | Bacteria | 8607 |
| 292 | Ga0207674_11502596 | 3300026116 | Bacteria | 643 |
| 293 | Ga0207675_100572587 | 3300026118 | Bacteria | 1130 |
| 294 | Ga0207683_10049180 | 3300026121 | Bacteria | 3691 |
| 295 | Ga0207698_10771449 | 3300026142 | Bacteria | 962 |
| 296 | Ga0207698_11655590 | 3300026142 | Bacteria | 655 |
| 297 | Ga0209967_1022439 | 3300027364 | Bacteria | 926 |
| 298 | Ga0209981_1000976 | 3300027378 | Bacteria | 3602 |
| 299 | Ga0209999_1003416 | 3300027543 | Bacteria | 2836 |
| 300 | Ga0209983_1015357 | 3300027665 | Bacteria | 1579 |
| 301 | Ga0209974_10271765 | 3300027876 | Bacteria | 642 |
| 302 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 303 | Ga0268266_10001340 | 3300028379 | Bacteria | 29786 |
| 304 | Ga0268266_10009825 | 3300028379 | Bacteria | 8411 |
| 305 | Ga0268266_10443169 | 3300028379 | Bacteria | 1233 |
| 306 | Ga0268265_10001646 | 3300028380 | Bacteria | 18291 |
| 307 | Ga0268265_10005054 | 3300028380 | Bacteria | 9055 |
| 308 | Ga0268265_10016564 | 3300028380 | Bacteria | 5067 |
| 309 | Ga0268265_10970078 | 3300028380 | Bacteria | 838 |
| 310 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 311 | Ga0268264_10028586 | 3300028381 | Bacteria | 4561 |
| 312 | Ga0268264_11121999 | 3300028381 | Bacteria | 795 |
| 313 | Ga0307517_10082580 | 3300028786 | Bacteria | 2726 |
| 314 | Ga0307517_10121079 | 3300028786 | Bacteria | 1934 |
| 315 | Ga0307517_10175489 | 3300028786 | Bacteria | 1397 |
| 316 | Ga0307515_10054933 | 3300028794 | Bacteria | 5833 |
| 317 | Ga0307515_10123962 | 3300028794 | Bacteria | 2902 |
| 318 | Ga0265327_10101553 | 3300031251 | Bacteria | 1387 |
| 319 | Ga0307513_10000448 | 3300031456 | Bacteria | 59427 |
| 320 | Ga0307513_10009333 | 3300031456 | Bacteria | 12420 |
| 321 | Ga0307513_10014931 | 3300031456 | Bacteria | 9436 |
| 322 | Ga0307513_10021685 | 3300031456 | Bacteria | 7577 |
| 323 | Ga0307513_10241068 | 3300031456 | Bacteria | 1613 |
| 324 | Ga0265314_10313776 | 3300031711 | Bacteria | 875 |
| 325 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 326 | Ga0307413_10682006 | 3300031824 | Bacteria | 851 |
| 327 | Ga0307413_11759838 | 3300031824 | Bacteria | 554 |
| 328 | Ga0307410_10333517 | 3300031852 | Bacteria | 1207 |
| 329 | Ga0307406_10665721 | 3300031901 | Bacteria | 866 |
| 330 | Ga0307406_11094156 | 3300031901 | Bacteria | 688 |
| 331 | Ga0307407_10238519 | 3300031903 | Bacteria | 1239 |
| 332 | Ga0307412_10459566 | 3300031911 | Bacteria | 1051 |
| 333 | Ga0307412_10942731 | 3300031911 | Bacteria | 759 |
| 334 | Ga0307409_100750868 | 3300031995 | Bacteria | 979 |
| 335 | Ga0307414_10316441 | 3300032004 | Bacteria | 1326 |
| 336 | Ga0307414_10461054 | 3300032004 | Bacteria | 1117 |
| 337 | Ga0307510_10013265 | 3300033180 | Bacteria | 9772 |
| 338 | Ga0373944_0243141 | 3300035089 | Bacteria | 662 |
| 339 | Ga0373923_0606409 | 3300035111 | Bacteria | 539 |
| 340 | Ga0373936_0000998 | 3300035113 | Bacteria | 10090 |
| 341 | Ga0373936_0635685 | 3300035113 | Bacteria | 502 |
| 342 | Ga0373945_0053890 | 3300035116 | Bacteria | 1486 |
| 343 | Ga0373943_0387399 | 3300035170 | Bacteria | 805 |
| 344 | Ga0373946_0223865 | 3300035171 | Bacteria | 909 |
| 345 | Ga0373946_0341531 | 3300035171 | Bacteria | 747 |
| 346 | Ga0373946_0567125 | 3300035171 | Unclassified | 587 |
| 347 | Ga0373935_0094806 | 3300035692 | Bacteria | 1959 |
| 348 | Ga0373927_0001126 | 3300035695 | Bacteria | 20271 |
| 349 | Ga0373947_0285365 | 3300035725 | Bacteria | 1098 |
| 350 | Ga0373947_0353720 | 3300035725 | Bacteria | 986 |
| 351 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 352 | Ga0373925_0167244 | 3300037068 | Bacteria | 1734 |
| 353 | Ga0373925_1178609 | 3300037068 | Bacteria | 630 |
| 354 | Ga0395899_0001481 | 3300037312 | Bacteria | 19981 |
| 355 | Ga0395899_0114434 | 3300037312 | Bacteria | 1937 |
| 356 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 357 | Ga0395900_0127010 | 3300037418 | Bacteria | 2615 |
| 358 | Ga0395905_0009333 | 3300037471 | Bacteria | 9594 |
| 359 | Ga0395905_0103332 | 3300037471 | Bacteria | 2675 |
| 360 | Ga0395905_0214382 | 3300037471 | Bacteria | 1803 |
| 361 | Ga0395905_0354476 | 3300037471 | Bacteria | 1359 |
| 362 | Ga0436364_0652191 | 3300037853 | Bacteria | 995 |
| 363 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 364 | Ga0395901_0214846 | 3300038443 | Bacteria | 2012 |
| 365 | Ga0395901_0354836 | 3300038443 | Bacteria | 1513 |
| 366 | Ga0237816_05968 | 3300039145 | Bacteria | 804 |
| 367 | Ga0436365_0029920 | 3300039437 | Bacteria | 3132 |
| 368 | Ga0436365_0126971 | 3300039437 | Bacteria | 1465 |
| 369 | Ga0436361_1006839 | 3300039447 | Bacteria | 607 |
| 370 | Ga0436362_0910244 | 3300039453 | Unclassified | 564 |
| 371 | Ga0451789_0839542 | 3300041443 | Bacteria | 937 |
| 372 | Ga0451791_1410250 | 3300041451 | Bacteria | 567 |
| 373 | Ga0451839_0561046 | 3300041496 | Bacteria | 619 |
| 374 | Ga0451849_1292768 | 3300041505 | Bacteria | 802 |
| 375 | Ga0451853_1309221 | 3300041512 | Bacteria | 699 |
| 376 | Ga0439431_0158908 | 3300041997 | Bacteria | 645 |
| 377 | Ga0439437_013840 | 3300042000 | Bacteria | 940 |
| 378 | Ga0439441_067702 | 3300042001 | Bacteria | 761 |
| 379 | Ga0439445_0159551 | 3300042004 | Bacteria | 658 |
| 380 | Ga0450923_193527 | 3300042125 | Bacteria | 504 |
| 381 | Ga0439446_0011949 | 3300042156 | Bacteria | 2366 |
| 382 | Ga0439459_0031974 | 3300042438 | Bacteria | 1075 |
| 383 | Ga0466968_0072883 | 3300044735 | Bacteria | 1498 |
| 384 | Ga0466957_0593099 | 3300044842 | Bacteria | 775 |
| 385 | Ga0466957_0754530 | 3300044842 | Bacteria | 689 |
| 386 | Ga0466959_0932265 | 3300045049 | Bacteria | 579 |
| 387 | Ga0466967_2423307 | 3300045976 | Bacteria | 520 |
| 388 | Ga0495627_001515 | 3300046453 | Bacteria | 13353 |
| 389 | Ga0495590_0001875 | 3300046457 | Bacteria | 8894 |
| 390 | Ga0495629_0047462 | 3300046459 | Bacteria | 3012 |
| 391 | Ga0495638_0000260 | 3300046460 | Bacteria | 71071 |
| 392 | Ga0495638_0000585 | 3300046460 | Bacteria | 41159 |
| 393 | Ga0495638_0010056 | 3300046460 | Bacteria | 6595 |
| 394 | Ga0495638_0022004 | 3300046460 | Bacteria | 4191 |
| 395 | Ga0495638_0115689 | 3300046460 | Bacteria | 1589 |
| 396 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 397 | Ga0495650_0113444 | 3300046471 | Bacteria | 1004 |
| 398 | Ga0495605_0490210 | 3300046474 | Unclassified | 503 |
| 399 | Ga0495585_0537802 | 3300046492 | Bacteria | 553 |
| 400 | Ga0495607_0327832 | 3300046501 | Bacteria | 712 |
| 401 | Ga0495583_0000020 | 3300046506 | Bacteria | 296185 |
| 402 | Ga0495606_0020511 | 3300046507 | Bacteria | 4868 |
| 403 | Ga0495606_0475788 | 3300046507 | Bacteria | 635 |
| 404 | Ga0495606_0520705 | 3300046507 | Bacteria | 597 |
| 405 | Ga0495610_0014650 | 3300046512 | Bacteria | 4598 |
| 406 | Ga0495610_0021498 | 3300046512 | Bacteria | 3547 |
| 407 | Ga0495610_0083317 | 3300046512 | Bacteria | 1464 |
| 408 | Ga0495616_0005319 | 3300046513 | Bacteria | 7937 |
| 409 | Ga0495620_0031152 | 3300046515 | Bacteria | 2447 |
| 410 | Ga0495620_0038413 | 3300046515 | Bacteria | 2125 |
| 411 | Ga0495620_0301563 | 3300046515 | Bacteria | 609 |
| 412 | Ga0495628_0047510 | 3300046516 | Bacteria | 3405 |
| 413 | Ga0495630_0712891 | 3300046517 | Bacteria | 767 |
| 414 | Ga0495631_0046830 | 3300046518 | Bacteria | 1900 |
| 415 | Ga0495632_0023633 | 3300046519 | Bacteria | 3279 |
| 416 | Ga0495632_0156522 | 3300046519 | Bacteria | 1051 |
| 417 | Ga0495632_0207254 | 3300046519 | Bacteria | 890 |
| 418 | Ga0495637_0036818 | 3300046520 | Bacteria | 2128 |
| 419 | Ga0495637_0063819 | 3300046520 | Bacteria | 1504 |
| 420 | Ga0495637_0118152 | 3300046520 | Bacteria | 1022 |
| 421 | Ga0495643_0009536 | 3300046522 | Bacteria | 6029 |
| 422 | Ga0495643_0348226 | 3300046522 | Bacteria | 664 |
| 423 | Ga0495643_0471423 | 3300046522 | Bacteria | 544 |
| 424 | Ga0495648_0000029 | 3300046524 | Bacteria | 223499 |
| 425 | Ga0495648_0128996 | 3300046524 | Bacteria | 1347 |
| 426 | Ga0495663_0052032 | 3300046525 | Bacteria | 1270 |
| 427 | Ga0495663_0371085 | 3300046525 | Bacteria | 523 |
| 428 | Ga0495642_0003852 | 3300046528 | Bacteria | 5880 |
| 429 | Ga0495642_0218939 | 3300046528 | Bacteria | 831 |
| 430 | Ga0495642_0472495 | 3300046528 | Bacteria | 554 |
| 431 | Ga0495654_0000126 | 3300046530 | Bacteria | 85179 |
| 432 | Ga0495654_0037471 | 3300046530 | Bacteria | 2431 |
| 433 | Ga0495654_0349936 | 3300046530 | Bacteria | 594 |
| 434 | Ga0495597_0001737 | 3300046542 | Bacteria | 15014 |
| 435 | Ga0495597_0075882 | 3300046542 | Bacteria | 1442 |
| 436 | Ga0495597_0100064 | 3300046542 | Bacteria | 1223 |
| 437 | Ga0495645_0111590 | 3300046543 | Bacteria | 1934 |
| 438 | Ga0495622_0091706 | 3300046557 | Bacteria | 1395 |
| 439 | Ga0495633_0224570 | 3300046558 | Bacteria | 859 |
| 440 | Ga0495668_0004748 | 3300046616 | Bacteria | 9510 |
| 441 | Ga0495668_0006966 | 3300046616 | Bacteria | 7308 |
| 442 | Ga0495668_0062435 | 3300046616 | Bacteria | 2053 |
| 443 | Ga0495668_0206944 | 3300046616 | Bacteria | 1074 |
| 444 | Ga0495668_0403615 | 3300046616 | Bacteria | 751 |
| 445 | Ga0495668_0784743 | 3300046616 | Unclassified | 527 |
| 446 | Ga0495611_0001817 | 3300046648 | Bacteria | 10230 |
| 447 | Ga0495625_0008503 | 3300046660 | Bacteria | 8749 |
| 448 | Ga0495625_0028887 | 3300046660 | Bacteria | 4152 |
| 449 | Ga0495625_0096766 | 3300046660 | Bacteria | 2033 |
| 450 | Ga0495625_0219743 | 3300046660 | Bacteria | 1245 |
| 451 | Ga0495625_0270219 | 3300046660 | Bacteria | 1097 |
| 452 | Ga0495625_0662794 | 3300046660 | Bacteria | 620 |
| 453 | Ga0495659_0455861 | 3300046664 | Bacteria | 557 |
| 454 | Ga0495659_0552665 | 3300046664 | Bacteria | 508 |
| 455 | Ga0495658_0916199 | 3300046683 | Bacteria | 560 |
| 456 | Ga0495669_0000114 | 3300046684 | Bacteria | 52644 |
| 457 | Ga0495669_0000375 | 3300046684 | Bacteria | 22695 |
| 458 | Ga0495669_0032254 | 3300046684 | Bacteria | 2302 |
| 459 | Ga0495669_0435346 | 3300046684 | Bacteria | 636 |
| 460 | Ga0495624_0064980 | 3300046690 | Bacteria | 2280 |
| 461 | Ga0495670_0607589 | 3300046691 | Bacteria | 596 |
| 462 | Ga0495671_0197556 | 3300046692 | Bacteria | 976 |
| 463 | Ga0495589_0036990 | 3300046794 | Bacteria | 2446 |
| 464 | Ga0495660_0033231 | 3300046810 | Bacteria | 2894 |
| 465 | Ga0495660_0199554 | 3300046810 | Bacteria | 956 |
| 466 | Ga0495660_0336714 | 3300046810 | Bacteria | 674 |
| 467 | Ga0495581_0085549 | 3300047315 | Bacteria | 1828 |
| 468 | Ga0495581_0428986 | 3300047315 | Bacteria | 770 |
| 469 | Ga0495636_0336167 | 3300047318 | Bacteria | 711 |
| 470 | Ga0495672_0000647 | 3300047320 | Bacteria | 38716 |
| 471 | Ga0495672_0268436 | 3300047320 | Bacteria | 820 |
| 472 | Ga0495683_0071213 | 3300047323 | Bacteria | 1706 |
| 473 | Ga0495677_0064579 | 3300047445 | Bacteria | 1360 |
| 474 | Ga0495679_007054 | 3300047446 | Bacteria | 4744 |
| 475 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 476 | Ga0495673_0000330 | 3300047469 | Bacteria | 60940 |
| 477 | Ga0495673_0015305 | 3300047469 | Bacteria | 3955 |
| 478 | Ga0495681_0120479 | 3300047470 | Bacteria | 1126 |
| 479 | Ga0495686_0000525 | 3300047472 | Bacteria | 55165 |
| 480 | Ga0495686_0008089 | 3300047472 | Bacteria | 7779 |
| 481 | Ga0495686_0174098 | 3300047472 | Bacteria | 1250 |
| 482 | Ga0495686_0398726 | 3300047472 | Bacteria | 739 |
| 483 | Ga0495686_0509984 | 3300047472 | Bacteria | 632 |
| 484 | Ga0495593_0019427 | 3300047673 | Bacteria | 3810 |
| 485 | Ga0495602_0449010 | 3300048088 | Bacteria | 910 |
| 486 | Ga0496100_0187330 | 3300048903 | Bacteria | 1500 |
| 487 | Ga0496101_0196674 | 3300048904 | Bacteria | 1557 |
| 488 | Ga0496101_0397153 | 3300048904 | Bacteria | 1086 |
| 489 | Ga0496102_0010654 | 3300048905 | Bacteria | 7920 |
| 490 | Ga0496102_0078602 | 3300048905 | Bacteria | 3037 |
| 491 | Ga0496102_1164745 | 3300048905 | Bacteria | 690 |
| 492 | Ga0496103_0056762 | 3300048906 | Bacteria | 2431 |
| 493 | Ga0496103_0198133 | 3300048906 | Bacteria | 1291 |
| 494 | Ga0496104_0796591 | 3300048907 | Bacteria | 851 |
| 495 | Ga0496104_1885387 | 3300048907 | Unclassified | 500 |
| 496 | Ga0496105_0561225 | 3300048908 | Bacteria | 890 |
| 497 | Ga0496106_0024831 | 3300048909 | Bacteria | 4456 |
| 498 | Ga0496106_0722403 | 3300048909 | Bacteria | 793 |
| 499 | Ga0496107_0000023 | 3300048910 | Bacteria | 125918 |
| 500 | Ga0496107_0314174 | 3300048910 | Bacteria | 1166 |
| 501 | Ga0496108_0668921 | 3300048911 | Bacteria | 902 |
| 502 | Ga0496109_0023216 | 3300048912 | Bacteria | 5503 |
| 503 | Ga0496112_1003981 | 3300048915 | Bacteria | 754 |
| 504 | Ga0496113_0086491 | 3300048916 | Bacteria | 2409 |
| 505 | Ga0496115_0056404 | 3300048918 | Bacteria | 3157 |
| 506 | Ga0496115_0096783 | 3300048918 | Bacteria | 2417 |
| 507 | Ga0496115_0105546 | 3300048918 | Bacteria | 2312 |
| 508 | Ga0496116_0161558 | 3300048919 | Bacteria | 1228 |
| 509 | Ga0496118_0045404 | 3300048921 | Bacteria | 3430 |
| 510 | Ga0496119_0101551 | 3300048922 | Bacteria | 1614 |
| 511 | Ga0496119_0364199 | 3300048922 | Unclassified | 697 |
| 512 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 513 | Ga0496121_0017079 | 3300048924 | Bacteria | 7441 |
| 514 | Ga0496122_0290588 | 3300048925 | Bacteria | 888 |
| 515 | Ga0496124_0220272 | 3300048927 | Bacteria | 1428 |
| 516 | Ga0496124_0235005 | 3300048927 | Bacteria | 1367 |
| 517 | Ga0496125_0505751 | 3300048928 | Bacteria | 679 |
| 518 | Ga0496126_0315991 | 3300048929 | Bacteria | 1285 |
| 519 | Ga0495678_002702 | 3300049459 | Bacteria | 11696 |
| 520 | Ga0495678_134065 | 3300049459 | Bacteria | 818 |
| 521 | Ga0495682_0057491 | 3300049460 | Bacteria | 1408 |
| 522 | Ga0501034_0002380 | 3300049571 | Bacteria | 22851 |
| 523 | Ga0501037_0255526 | 3300049573 | Bacteria | 1225 |
| 524 | Ga0501038_0395005 | 3300049574 | Bacteria | 1071 |
| 525 | Ga0501038_0878138 | 3300049574 | Bacteria | 663 |
| 526 | Ga0501043_1177919 | 3300049579 | Bacteria | 539 |
| 527 | Ga0501047_0005360 | 3300049581 | Bacteria | 12051 |
| 528 | Ga0501047_0015925 | 3300049581 | Bacteria | 7168 |
| 529 | Ga0501047_0072292 | 3300049581 | Bacteria | 3320 |
| 530 | Ga0501047_0468006 | 3300049581 | Bacteria | 1089 |
| 531 | Ga0501047_0518541 | 3300049581 | Bacteria | 1018 |
| 532 | Ga0501047_0605530 | 3300049581 | Bacteria | 917 |
| 533 | Ga0501238_000728 | 3300049671 | Bacteria | 3684 |
| 534 | Ga0501238_006716 | 3300049671 | Bacteria | 1486 |
| 535 | Ga0501257_003780 | 3300049686 | Bacteria | 3272 |
| 536 | Ga0501257_190253 | 3300049686 | Bacteria | 585 |
| 537 | Ga0501080_1778774 | 3300049742 | Unclassified | 518 |
| 538 | Ga0501035_0731082 | 3300049822 | Bacteria | 796 |
| 539 | Ga0501044_0000504 | 3300049823 | Bacteria | 47543 |
| 540 | Ga0501044_0005853 | 3300049823 | Bacteria | 13619 |
| 541 | Ga0501044_0260458 | 3300049823 | Bacteria | 1673 |
| 542 | Ga0501044_0350158 | 3300049823 | Bacteria | 1397 |
| 543 | Ga0501044_1139595 | 3300049823 | Bacteria | 648 |
| 544 | Ga0501044_1351592 | 3300049823 | Unclassified | 578 |
| 545 | nmdc:mga0k408_19270_c1 | 3300050493 | Bacteria | 3811 |
| 546 | nmdc:mga0k408_88519_c1 | 3300050493 | Bacteria | 1818 |
| 547 | nmdc:mga07m45_747425_c1 | 3300050496 | Bacteria | 561 |
| 548 | Ga0495601_0482140 | 3300053077 | Unclassified | 801 |
| 549 | Ga0500635_0000302 | 3300053080 | Bacteria | 17373 |
| 550 | Ga0500578_0000008 | 3300053086 | Bacteria | 223557 |
| 551 | Ga0500578_0271497 | 3300053086 | Bacteria | 1014 |
| 552 | Ga0500643_006804 | 3300053087 | Bacteria | 4711 |
| 553 | Ga0500643_017285 | 3300053087 | Bacteria | 2418 |
| 554 | Ga0500643_092806 | 3300053087 | Bacteria | 822 |
| 555 | Ga0500644_0000028 | 3300053088 | Bacteria | 92405 |
| 556 | Ga0500646_0132559 | 3300053090 | Bacteria | 811 |
| 557 | Ga0500646_0224708 | 3300053090 | Bacteria | 652 |
| 558 | Ga0500647_0045013 | 3300053091 | Bacteria | 2119 |
| 559 | Ga0500651_0038819 | 3300053093 | Bacteria | 2999 |
| 560 | Ga0500651_0200404 | 3300053093 | Bacteria | 1178 |
| 561 | Ga0500566_0089867 | 3300053094 | Bacteria | 1698 |
| 562 | Ga0500641_0072090 | 3300053096 | Bacteria | 1455 |
| 563 | Ga0500641_0163247 | 3300053096 | Bacteria | 960 |
| 564 | Ga0500554_084004 | 3300053102 | Bacteria | 1051 |
| 565 | Ga0500555_001817 | 3300053103 | Bacteria | 6368 |
| 566 | Ga0500555_115700 | 3300053103 | Bacteria | 672 |
| 567 | Ga0500556_0003050 | 3300053104 | Bacteria | 5024 |
| 568 | Ga0500556_0048840 | 3300053104 | Bacteria | 1523 |
| 569 | Ga0500556_0100926 | 3300053104 | Bacteria | 1111 |
| 570 | Ga0500562_002026 | 3300053108 | Bacteria | 5074 |
| 571 | Ga0500562_004573 | 3300053108 | Bacteria | 3495 |
| 572 | Ga0500569_102730 | 3300053109 | Bacteria | 938 |
| 573 | Ga0500572_099153 | 3300053111 | Bacteria | 930 |
| 574 | Ga0500594_0000309 | 3300053118 | Bacteria | 10991 |
| 575 | Ga0500595_004249 | 3300053119 | Bacteria | 6464 |
| 576 | Ga0500607_040329 | 3300053121 | Bacteria | 2531 |
| 577 | Ga0500607_233215 | 3300053121 | Bacteria | 752 |
| 578 | Ga0500608_000573 | 3300053122 | Bacteria | 13643 |
| 579 | Ga0500608_060706 | 3300053122 | Bacteria | 1808 |
| 580 | Ga0500608_179056 | 3300053122 | Bacteria | 900 |
| 581 | Ga0500614_010544 | 3300053123 | Bacteria | 1986 |
| 582 | Ga0500614_013483 | 3300053123 | Bacteria | 1796 |
| 583 | Ga0500618_000060 | 3300053125 | Bacteria | 97135 |
| 584 | Ga0500642_0097207 | 3300053130 | Bacteria | 1366 |
| 585 | Ga0500642_0109215 | 3300053130 | Bacteria | 1291 |
| 586 | Ga0500655_021803 | 3300053133 | Bacteria | 1203 |
| 587 | Ga0500655_025521 | 3300053133 | Bacteria | 1122 |
| 588 | Ga0500658_0073550 | 3300053134 | Bacteria | 1447 |
| 589 | Ga0500658_0127586 | 3300053134 | Bacteria | 1132 |
| 590 | Ga0500658_0419095 | 3300053134 | Bacteria | 612 |
| 591 | Ga0500559_0000005 | 3300053136 | Bacteria | 230231 |
| 592 | Ga0500559_0012527 | 3300053136 | Bacteria | 3601 |
| 593 | Ga0500559_0294342 | 3300053136 | Bacteria | 762 |
| 594 | Ga0500564_001092 | 3300053138 | Bacteria | 8997 |
| 595 | Ga0500577_0003928 | 3300053142 | Bacteria | 3887 |
| 596 | Ga0500590_014706 | 3300053148 | Bacteria | 4034 |
| 597 | Ga0500590_319095 | 3300053148 | Bacteria | 573 |
| 598 | Ga0500616_0006751 | 3300053153 | Bacteria | 7440 |
| 599 | Ga0500616_0404338 | 3300053153 | Bacteria | 545 |
| 600 | Ga0500619_002486 | 3300053154 | Bacteria | 3562 |
| 601 | Ga0500622_0000105 | 3300053156 | Bacteria | 85855 |
| 602 | Ga0500622_0024588 | 3300053156 | Bacteria | 3185 |
| 603 | Ga0500627_0032197 | 3300053158 | Bacteria | 2208 |
| 604 | Ga0500633_0203022 | 3300053160 | Bacteria | 742 |
| 605 | Ga0500638_162590 | 3300053162 | Bacteria | 981 |
| 606 | Ga0500638_174350 | 3300053162 | Bacteria | 934 |
| 607 | Ga0500636_0078861 | 3300053177 | Bacteria | 1900 |
| 608 | Ga0500636_0127369 | 3300053177 | Bacteria | 1422 |
| 609 | Ga0500637_0061730 | 3300053178 | Bacteria | 2147 |
| 610 | Ga0500637_0087263 | 3300053178 | Bacteria | 1804 |
| 611 | Ga0500576_044374 | 3300053725 | Bacteria | 1993 |
| 612 | Ga0500611_010295 | 3300053727 | Bacteria | 1511 |
| 613 | Ga0500625_015994 | 3300053729 | Bacteria | 3489 |
| 614 | Ga0500645_005969 | 3300053730 | Bacteria | 4405 |
| 615 | Ga0500609_006570 | 3300053731 | Bacteria | 1583 |
| 616 | Ga0500596_000489 | 3300053735 | Bacteria | 7420 |
| 617 | Ga0500661_101066 | 3300055283 | Bacteria | 547 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046522 | Ga0495643_0471423 | Ga0495643_0471423_10_342 | 97 |
| 2 | 3300003215 | JGI25153J46596_10013301 | JGI25153J46596_100133013 | 98 |
| 3 | 3300003320 | rootH2_10147346 | rootH2_101473463 | 98 |
| 4 | 3300003771 | Ga0055526_1070314 | Ga0055526_10703141 | 98 |
| 5 | 3300003773 | Ga0055537_1001022 | Ga0055537_10010226 | 98 |
| 6 | 3300003775 | Ga0055524_1021277 | Ga0055524_10212772 | 98 |
| 7 | 3300003775 | Ga0055524_1053809 | Ga0055524_10538092 | 98 |
| 8 | 3300003790 | Ga0055528_1002711 | Ga0055528_10027115 | 98 |
| 9 | 3300003791 | Ga0055530_10002729 | Ga0055530_1000272912 | 98 |
| 10 | 3300003791 | Ga0055530_10033909 | Ga0055530_100339091 | 98 |
| 11 | 3300003794 | Ga0055531_10000966 | Ga0055531_1000096613 | 98 |
| 12 | 3300003794 | Ga0055531_10001958 | Ga0055531_100019587 | 98 |
| 13 | 3300005262 | Ga0065165_1000277 | Ga0065165_10002779 | 98 |
| 14 | 3300005262 | Ga0065165_1001667 | Ga0065165_100166715 | 98 |
| 15 | 3300005262 | Ga0065165_1126859 | Ga0065165_11268591 | 98 |
| 16 | 3300005327 | Ga0070658_10145626 | Ga0070658_101456262 | 98 |
| 17 | 3300005327 | Ga0070658_10192462 | Ga0070658_101924622 | 98 |
| 18 | 3300005327 | Ga0070658_10488668 | Ga0070658_104886682 | 98 |
| 19 | 3300005327 | Ga0070658_11256377 | Ga0070658_112563772 | 98 |
| 20 | 3300005327 | Ga0070658_11285186 | Ga0070658_112851861 | 98 |
| 21 | 3300005331 | Ga0070670_100000037 | Ga0070670_10000003781 | 98 |
| 22 | 3300005331 | Ga0070670_100114793 | Ga0070670_1001147933 | 98 |
| 23 | 3300005331 | Ga0070670_100868082 | Ga0070670_1008680821 | 98 |
| 24 | 3300005334 | Ga0068869_100317281 | Ga0068869_1003172812 | 98 |
| 25 | 3300005336 | Ga0070680_100053013 | Ga0070680_1000530133 | 98 |
| 26 | 3300005338 | Ga0068868_100538291 | Ga0068868_1005382912 | 98 |
| 27 | 3300005339 | Ga0070660_100096530 | Ga0070660_1000965302 | 98 |
| 28 | 3300005339 | Ga0070660_100377096 | Ga0070660_1003770962 | 98 |
| 29 | 3300005339 | Ga0070660_101671984 | Ga0070660_1016719842 | 98 |
| 30 | 3300005341 | Ga0070691_10023519 | Ga0070691_100235194 | 98 |
| 31 | 3300005344 | Ga0070661_100355062 | Ga0070661_1003550622 | 98 |
| 32 | 3300005344 | Ga0070661_101566067 | Ga0070661_1015660671 | 98 |
| 33 | 3300005344 | Ga0070661_101661478 | Ga0070661_1016614781 | 98 |
| 34 | 3300005345 | Ga0070692_11057857 | Ga0070692_110578571 | 98 |
| 35 | 3300005347 | Ga0070668_100000097 | Ga0070668_10000009738 | 98 |
| 36 | 3300005347 | Ga0070668_100001398 | Ga0070668_1000013989 | 98 |
| 37 | 3300005347 | Ga0070668_100006261 | Ga0070668_1000062619 | 98 |
| 38 | 3300005347 | Ga0070668_100058909 | Ga0070668_1000589094 | 98 |
| 39 | 3300005354 | Ga0070675_100676856 | Ga0070675_1006768562 | 98 |
| 40 | 3300005354 | Ga0070675_101250234 | Ga0070675_1012502341 | 98 |
| 41 | 3300005355 | Ga0070671_100211856 | Ga0070671_1002118562 | 98 |
| 42 | 3300005366 | Ga0070659_100000206 | Ga0070659_10000020639 | 98 |
| 43 | 3300005366 | Ga0070659_100005903 | Ga0070659_1000059036 | 98 |
| 44 | 3300005366 | Ga0070659_100661812 | Ga0070659_1006618122 | 98 |
| 45 | 3300005366 | Ga0070659_100862382 | Ga0070659_1008623822 | 98 |
| 46 | 3300005366 | Ga0070659_101372480 | Ga0070659_1013724801 | 98 |
| 47 | 3300005367 | Ga0070667_100000083 | Ga0070667_10000008381 | 98 |
| 48 | 3300005367 | Ga0070667_100061211 | Ga0070667_1000612111 | 98 |
| 49 | 3300005367 | Ga0070667_100391499 | Ga0070667_1003914992 | 98 |
| 50 | 3300005367 | Ga0070667_100465990 | Ga0070667_1004659902 | 98 |
| 51 | 3300005367 | Ga0070667_100687984 | Ga0070667_1006879842 | 98 |
| 52 | 3300005440 | Ga0070705_101249291 | Ga0070705_1012492911 | 98 |
| 53 | 3300005455 | Ga0070663_100097209 | Ga0070663_1000972091 | 98 |
| 54 | 3300005455 | Ga0070663_101262569 | Ga0070663_1012625692 | 98 |
| 55 | 3300005456 | Ga0070678_100095809 | Ga0070678_1000958092 | 98 |
| 56 | 3300005457 | Ga0070662_100080288 | Ga0070662_1000802882 | 98 |
| 57 | 3300005457 | Ga0070662_100302959 | Ga0070662_1003029592 | 98 |
| 58 | 3300005458 | Ga0070681_10019846 | Ga0070681_100198466 | 98 |
| 59 | 3300005458 | Ga0070681_10063521 | Ga0070681_100635214 | 98 |
| 60 | 3300005466 | Ga0070685_10417517 | Ga0070685_104175172 | 98 |
| 61 | 3300005530 | Ga0070679_100003462 | Ga0070679_1000034623 | 98 |
| 62 | 3300005530 | Ga0070679_100044372 | Ga0070679_1000443724 | 98 |
| 63 | 3300005530 | Ga0070679_100704195 | Ga0070679_1007041952 | 98 |
| 64 | 3300005539 | Ga0068853_100057502 | Ga0068853_1000575023 | 98 |
| 65 | 3300005539 | Ga0068853_100245881 | Ga0068853_1002458814 | 98 |
| 66 | 3300005539 | Ga0068853_100272882 | Ga0068853_1002728822 | 98 |
| 67 | 3300005539 | Ga0068853_100395554 | Ga0068853_1003955541 | 98 |
| 68 | 3300005544 | Ga0070686_101210451 | Ga0070686_1012104511 | 98 |
| 69 | 3300005548 | Ga0070665_100000116 | Ga0070665_10000011665 | 98 |
| 70 | 3300005548 | Ga0070665_100000278 | Ga0070665_10000027819 | 98 |
| 71 | 3300005548 | Ga0070665_100000483 | Ga0070665_10000048313 | 98 |
| 72 | 3300005548 | Ga0070665_100677183 | Ga0070665_1006771831 | 98 |
| 73 | 3300005548 | Ga0070665_100962862 | Ga0070665_1009628622 | 98 |
| 74 | 3300005548 | Ga0070665_102279935 | Ga0070665_1022799352 | 98 |
| 75 | 3300005563 | Ga0068855_100098841 | Ga0068855_1000988412 | 98 |
| 76 | 3300005563 | Ga0068855_100114730 | Ga0068855_1001147303 | 98 |
| 77 | 3300005563 | Ga0068855_101027662 | Ga0068855_1010276622 | 98 |
| 78 | 3300005563 | Ga0068855_101345346 | Ga0068855_1013453462 | 98 |
| 79 | 3300005563 | Ga0068855_101552010 | Ga0068855_1015520102 | 98 |
| 80 | 3300005564 | Ga0070664_100064257 | Ga0070664_1000642572 | 98 |
| 81 | 3300005564 | Ga0070664_100304364 | Ga0070664_1003043642 | 98 |
| 82 | 3300005564 | Ga0070664_100677070 | Ga0070664_1006770702 | 98 |
| 83 | 3300005577 | Ga0068857_101470012 | Ga0068857_1014700122 | 98 |
| 84 | 3300005578 | Ga0068854_100523656 | Ga0068854_1005236562 | 98 |
| 85 | 3300005578 | Ga0068854_101795851 | Ga0068854_1017958511 | 98 |
| 86 | 3300005614 | Ga0068856_100876569 | Ga0068856_1008765691 | 98 |
| 87 | 3300005616 | Ga0068852_100621770 | Ga0068852_1006217702 | 98 |
| 88 | 3300005617 | Ga0068859_100137076 | Ga0068859_1001370762 | 98 |
| 89 | 3300005617 | Ga0068859_101044915 | Ga0068859_1010449152 | 98 |
| 90 | 3300005618 | Ga0068864_100000115 | Ga0068864_10000011527 | 98 |
| 91 | 3300005618 | Ga0068864_100000786 | Ga0068864_10000078612 | 98 |
| 92 | 3300005618 | Ga0068864_100026445 | Ga0068864_1000264456 | 98 |
| 93 | 3300005719 | Ga0068861_100528720 | Ga0068861_1005287202 | 98 |
| 94 | 3300005841 | Ga0068863_100000007 | Ga0068863_100000007149 | 98 |
| 95 | 3300005841 | Ga0068863_100000392 | Ga0068863_1000003929 | 98 |
| 96 | 3300005841 | Ga0068863_100152772 | Ga0068863_1001527722 | 98 |
| 97 | 3300005841 | Ga0068863_102491844 | Ga0068863_1024918441 | 98 |
| 98 | 3300005842 | Ga0068858_100000031 | Ga0068858_10000003189 | 98 |
| 99 | 3300005842 | Ga0068858_100004211 | Ga0068858_1000042117 | 98 |
| 100 | 3300005842 | Ga0068858_100574859 | Ga0068858_1005748592 | 98 |
| 101 | 3300005842 | Ga0068858_102531228 | Ga0068858_1025312281 | 98 |
| 102 | 3300005843 | Ga0068860_100000128 | Ga0068860_10000012823 | 98 |
| 103 | 3300005843 | Ga0068860_100060495 | Ga0068860_1000604953 | 98 |
| 104 | 3300005844 | Ga0068862_100001627 | Ga0068862_1000016275 | 98 |
| 105 | 3300005844 | Ga0068862_100012654 | Ga0068862_1000126542 | 98 |
| 106 | 3300005844 | Ga0068862_100171133 | Ga0068862_1001711332 | 98 |
| 107 | 3300006028 | Ga0070717_10194214 | Ga0070717_101942142 | 98 |
| 108 | 3300006177 | Ga0075362_10735639 | Ga0075362_107356391 | 98 |
| 109 | 3300006195 | Ga0075366_10050358 | Ga0075366_100503582 | 98 |
| 110 | 3300006195 | Ga0075366_10458226 | Ga0075366_104582262 | 98 |
| 111 | 3300006353 | Ga0075370_10067984 | Ga0075370_100679843 | 98 |
| 112 | 3300006931 | Ga0097620_100137068 | Ga0097620_1001370682 | 98 |
| 113 | 3300006931 | Ga0097620_101045082 | Ga0097620_1010450822 | 98 |
| 114 | 3300006946 | Ga0079104_1037307 | Ga0079104_10373072 | 98 |
| 115 | 3300009092 | Ga0105250_10026243 | Ga0105250_100262432 | 98 |
| 116 | 3300009093 | Ga0105240_10005944 | Ga0105240_100059446 | 98 |
| 117 | 3300009093 | Ga0105240_10040708 | Ga0105240_100407084 | 98 |
| 118 | 3300009093 | Ga0105240_10043434 | Ga0105240_100434349 | 98 |
| 119 | 3300009093 | Ga0105240_10188036 | Ga0105240_101880364 | 98 |
| 120 | 3300009093 | Ga0105240_10191413 | Ga0105240_101914133 | 98 |
| 121 | 3300009093 | Ga0105240_11392717 | Ga0105240_113927172 | 98 |
| 122 | 3300009098 | Ga0105245_10908894 | Ga0105245_109088941 | 98 |
| 123 | 3300009101 | Ga0105247_10022438 | Ga0105247_100224382 | 98 |
| 124 | 3300009101 | Ga0105247_10513887 | Ga0105247_105138872 | 98 |
| 125 | 3300009174 | Ga0105241_12079668 | Ga0105241_120796682 | 98 |
| 126 | 3300009174 | Ga0105241_12484451 | Ga0105241_124844511 | 98 |
| 127 | 3300009177 | Ga0105248_10038574 | Ga0105248_100385744 | 98 |
| 128 | 3300009177 | Ga0105248_10041310 | Ga0105248_100413103 | 98 |
| 129 | 3300009177 | Ga0105248_10050796 | Ga0105248_100507962 | 98 |
| 130 | 3300009177 | Ga0105248_10907946 | Ga0105248_109079462 | 98 |
| 131 | 3300009177 | Ga0105248_11114173 | Ga0105248_111141732 | 98 |
| 132 | 3300009545 | Ga0105237_10695156 | Ga0105237_106951562 | 98 |
| 133 | 3300009551 | Ga0105238_10056774 | Ga0105238_100567744 | 98 |
| 134 | 3300009551 | Ga0105238_10348261 | Ga0105238_103482613 | 98 |
| 135 | 3300009551 | Ga0105238_10960091 | Ga0105238_109600912 | 98 |
| 136 | 3300009551 | Ga0105238_11173114 | Ga0105238_111731142 | 98 |
| 137 | 3300009551 | Ga0105238_11384886 | Ga0105238_113848862 | 98 |
| 138 | 3300009553 | Ga0105249_10000410 | Ga0105249_1000041042 | 98 |
| 139 | 3300009553 | Ga0105249_10098444 | Ga0105249_100984443 | 98 |
| 140 | 3300009553 | Ga0105249_10210746 | Ga0105249_102107462 | 98 |
| 141 | 3300009553 | Ga0105249_11515628 | Ga0105249_115156281 | 98 |
| 142 | 3300010375 | Ga0105239_10274989 | Ga0105239_102749893 | 98 |
| 143 | 3300010375 | Ga0105239_10538089 | Ga0105239_105380892 | 98 |
| 144 | 3300010375 | Ga0105239_10729711 | Ga0105239_107297112 | 98 |
| 145 | 3300010375 | Ga0105239_11477333 | Ga0105239_114773332 | 98 |
| 146 | 3300011119 | Ga0105246_10713124 | Ga0105246_107131241 | 98 |
| 147 | 3300012497 | Ga0157319_1056325 | Ga0157319_10563251 | 98 |
| 148 | 3300013100 | Ga0157373_10007392 | Ga0157373_100073922 | 98 |
| 149 | 3300013100 | Ga0157373_10007540 | Ga0157373_100075402 | 98 |
| 150 | 3300013100 | Ga0157373_10682914 | Ga0157373_106829141 | 98 |
| 151 | 3300013104 | Ga0157370_10396848 | Ga0157370_103968482 | 98 |
| 152 | 3300013104 | Ga0157370_11797833 | Ga0157370_117978332 | 98 |
| 153 | 3300013105 | Ga0157369_10446843 | Ga0157369_104468432 | 98 |
| 154 | 3300013105 | Ga0157369_10819580 | Ga0157369_108195802 | 98 |
| 155 | 3300013296 | Ga0157374_10402262 | Ga0157374_104022622 | 98 |
| 156 | 3300013297 | Ga0157378_10991010 | Ga0157378_109910102 | 98 |
| 157 | 3300013306 | Ga0163162_11891683 | Ga0163162_118916832 | 98 |
| 158 | 3300013307 | Ga0157372_11404771 | Ga0157372_114047712 | 98 |
| 159 | 3300013307 | Ga0157372_11410539 | Ga0157372_114105391 | 98 |
| 160 | 3300013307 | Ga0157372_12113280 | Ga0157372_121132802 | 98 |
| 161 | 3300013308 | Ga0157375_10205678 | Ga0157375_102056782 | 98 |
| 162 | 3300014325 | Ga0163163_10868359 | Ga0163163_108683592 | 98 |
| 163 | 3300014325 | Ga0163163_11464740 | Ga0163163_114647401 | 98 |
| 164 | 3300014325 | Ga0163163_11504384 | Ga0163163_115043842 | 98 |
| 165 | 3300014325 | Ga0163163_11736621 | Ga0163163_117366212 | 98 |
| 166 | 3300014325 | Ga0163163_11869384 | Ga0163163_118693841 | 98 |
| 167 | 3300014326 | Ga0157380_11109417 | Ga0157380_111094171 | 98 |
| 168 | 3300014745 | Ga0157377_10722912 | Ga0157377_107229122 | 98 |
| 169 | 3300014968 | Ga0157379_10080776 | Ga0157379_100807764 | 98 |
| 170 | 3300014968 | Ga0157379_10174569 | Ga0157379_101745692 | 98 |
| 171 | 3300014968 | Ga0157379_11508367 | Ga0157379_115083671 | 98 |
| 172 | 3300015261 | Ga0182006_1071517 | Ga0182006_10715171 | 98 |
| 173 | 3300017792 | Ga0163161_10527455 | Ga0163161_105274552 | 98 |
| 174 | 3300017792 | Ga0163161_11349309 | Ga0163161_113493091 | 98 |
| 175 | 3300021384 | Ga0213876_10035545 | Ga0213876_100355454 | 98 |
| 176 | 3300021384 | Ga0213876_10147319 | Ga0213876_101473192 | 98 |
| 177 | 3300025254 | Ga0209148_1007316 | Ga0209148_10073162 | 98 |
| 178 | 3300025254 | Ga0209148_1015725 | Ga0209148_10157252 | 98 |
| 179 | 3300025263 | Ga0209565_1000641 | Ga0209565_100064116 | 98 |
| 180 | 3300025273 | Ga0209673_1003300 | Ga0209673_10033002 | 98 |
| 181 | 3300025273 | Ga0209673_1016328 | Ga0209673_10163282 | 98 |
| 182 | 3300025291 | Ga0209675_1003569 | Ga0209675_10035695 | 98 |
| 183 | 3300025295 | Ga0209564_1004845 | Ga0209564_10048457 | 98 |
| 184 | 3300025295 | Ga0209564_1036944 | Ga0209564_10369441 | 98 |
| 185 | 3300025297 | Ga0209758_1001863 | Ga0209758_100186313 | 98 |
| 186 | 3300025297 | Ga0209758_1007301 | Ga0209758_10073014 | 98 |
| 187 | 3300025297 | Ga0209758_1008993 | Ga0209758_10089936 | 98 |
| 188 | 3300025298 | Ga0209050_1000200 | Ga0209050_100020013 | 98 |
| 189 | 3300025298 | Ga0209050_1012865 | Ga0209050_10128652 | 98 |
| 190 | 3300025299 | Ga0209256_1002428 | Ga0209256_100242815 | 98 |
| 191 | 3300025299 | Ga0209256_1002898 | Ga0209256_10028987 | 98 |
| 192 | 3300025304 | Ga0209257_1000225 | Ga0209257_100022513 | 98 |
| 193 | 3300025304 | Ga0209257_1000944 | Ga0209257_100094411 | 98 |
| 194 | 3300025321 | Ga0207656_10390547 | Ga0207656_103905472 | 98 |
| 195 | 3300025711 | Ga0207696_1022235 | Ga0207696_10222352 | 98 |
| 196 | 3300025900 | Ga0207710_10077787 | Ga0207710_100777872 | 98 |
| 197 | 3300025900 | Ga0207710_10187177 | Ga0207710_101871771 | 98 |
| 198 | 3300025900 | Ga0207710_10677661 | Ga0207710_106776611 | 98 |
| 199 | 3300025903 | Ga0207680_10231626 | Ga0207680_102316262 | 98 |
| 200 | 3300025903 | Ga0207680_10652795 | Ga0207680_106527951 | 98 |
| 201 | 3300025908 | Ga0207643_10359984 | Ga0207643_103599842 | 98 |
| 202 | 3300025909 | Ga0207705_10007993 | Ga0207705_100079933 | 98 |
| 203 | 3300025909 | Ga0207705_10385445 | Ga0207705_103854452 | 98 |
| 204 | 3300025909 | Ga0207705_10474398 | Ga0207705_104743982 | 98 |
| 205 | 3300025911 | Ga0207654_10863993 | Ga0207654_108639931 | 98 |
| 206 | 3300025912 | Ga0207707_10016260 | Ga0207707_100162609 | 98 |
| 207 | 3300025912 | Ga0207707_10322269 | Ga0207707_103222692 | 98 |
| 208 | 3300025913 | Ga0207695_10001670 | Ga0207695_1000167029 | 98 |
| 209 | 3300025913 | Ga0207695_10001727 | Ga0207695_1000172730 | 98 |
| 210 | 3300025913 | Ga0207695_10015061 | Ga0207695_100150614 | 98 |
| 211 | 3300025913 | Ga0207695_10021597 | Ga0207695_100215973 | 98 |
| 212 | 3300025913 | Ga0207695_10133106 | Ga0207695_101331063 | 98 |
| 213 | 3300025913 | Ga0207695_10152637 | Ga0207695_101526373 | 98 |
| 214 | 3300025913 | Ga0207695_10957179 | Ga0207695_109571792 | 98 |
| 215 | 3300025913 | Ga0207695_11029023 | Ga0207695_110290231 | 98 |
| 216 | 3300025914 | Ga0207671_10435328 | Ga0207671_104353282 | 98 |
| 217 | 3300025914 | Ga0207671_11353336 | Ga0207671_113533361 | 98 |
| 218 | 3300025917 | Ga0207660_10180924 | Ga0207660_101809242 | 98 |
| 219 | 3300025917 | Ga0207660_10385162 | Ga0207660_103851622 | 98 |
| 220 | 3300025919 | Ga0207657_10012109 | Ga0207657_100121096 | 98 |
| 221 | 3300025920 | Ga0207649_10453765 | Ga0207649_104537652 | 98 |
| 222 | 3300025920 | Ga0207649_10585403 | Ga0207649_105854032 | 98 |
| 223 | 3300025920 | Ga0207649_10902014 | Ga0207649_109020142 | 98 |
| 224 | 3300025921 | Ga0207652_10042473 | Ga0207652_100424733 | 98 |
| 225 | 3300025921 | Ga0207652_10046510 | Ga0207652_100465103 | 98 |
| 226 | 3300025921 | Ga0207652_11176863 | Ga0207652_111768631 | 98 |
| 227 | 3300025924 | Ga0207694_10040124 | Ga0207694_100401244 | 98 |
| 228 | 3300025924 | Ga0207694_10105146 | Ga0207694_101051464 | 98 |
| 229 | 3300025924 | Ga0207694_10655671 | Ga0207694_106556711 | 98 |
| 230 | 3300025924 | Ga0207694_10676640 | Ga0207694_106766402 | 98 |
| 231 | 3300025925 | Ga0207650_10000062 | Ga0207650_100000629 | 98 |
| 232 | 3300025925 | Ga0207650_10023019 | Ga0207650_100230193 | 98 |
| 233 | 3300025927 | Ga0207687_10475837 | Ga0207687_104758371 | 98 |
| 234 | 3300025931 | Ga0207644_10106649 | Ga0207644_101066493 | 98 |
| 235 | 3300025932 | Ga0207690_10000129 | Ga0207690_1000012927 | 98 |
| 236 | 3300025932 | Ga0207690_10075218 | Ga0207690_100752182 | 98 |
| 237 | 3300025933 | Ga0207706_10111580 | Ga0207706_101115802 | 98 |
| 238 | 3300025933 | Ga0207706_10444125 | Ga0207706_104441252 | 98 |
| 239 | 3300025941 | Ga0207711_10022877 | Ga0207711_100228774 | 98 |
| 240 | 3300025941 | Ga0207711_10024435 | Ga0207711_100244354 | 98 |
| 241 | 3300025941 | Ga0207711_10106029 | Ga0207711_101060293 | 98 |
| 242 | 3300025941 | Ga0207711_10394789 | Ga0207711_103947892 | 98 |
| 243 | 3300025941 | Ga0207711_10411358 | Ga0207711_104113582 | 98 |
| 244 | 3300025942 | Ga0207689_10155093 | Ga0207689_101550932 | 98 |
| 245 | 3300025942 | Ga0207689_10432256 | Ga0207689_104322562 | 98 |
| 246 | 3300025944 | Ga0207661_11064949 | Ga0207661_110649492 | 98 |
| 247 | 3300025944 | Ga0207661_11266424 | Ga0207661_112664242 | 98 |
| 248 | 3300025944 | Ga0207661_11739239 | Ga0207661_117392391 | 98 |
| 249 | 3300025945 | Ga0207679_10013998 | Ga0207679_100139987 | 98 |
| 250 | 3300025945 | Ga0207679_10112370 | Ga0207679_101123702 | 98 |
| 251 | 3300025945 | Ga0207679_10955602 | Ga0207679_109556022 | 98 |
| 252 | 3300025949 | Ga0207667_10043300 | Ga0207667_100433006 | 98 |
| 253 | 3300025949 | Ga0207667_10634029 | Ga0207667_106340292 | 98 |
| 254 | 3300025949 | Ga0207667_10962401 | Ga0207667_109624011 | 98 |
| 255 | 3300025949 | Ga0207667_11327801 | Ga0207667_113278012 | 98 |
| 256 | 3300025960 | Ga0207651_10106194 | Ga0207651_101061942 | 98 |
| 257 | 3300025961 | Ga0207712_10001004 | Ga0207712_100010049 | 98 |
| 258 | 3300025961 | Ga0207712_10111886 | Ga0207712_101118862 | 98 |
| 259 | 3300025972 | Ga0207668_10000028 | Ga0207668_1000002859 | 98 |
| 260 | 3300025972 | Ga0207668_10000507 | Ga0207668_100005077 | 98 |
| 261 | 3300025972 | Ga0207668_10005956 | Ga0207668_100059566 | 98 |
| 262 | 3300025981 | Ga0207640_10459030 | Ga0207640_104590302 | 98 |
| 263 | 3300025981 | Ga0207640_11187004 | Ga0207640_111870041 | 98 |
| 264 | 3300025981 | Ga0207640_11646854 | Ga0207640_116468541 | 98 |
| 265 | 3300025986 | Ga0207658_10000209 | Ga0207658_1000020940 | 98 |
| 266 | 3300025986 | Ga0207658_10049046 | Ga0207658_100490463 | 98 |
| 267 | 3300025986 | Ga0207658_10359415 | Ga0207658_103594152 | 98 |
| 268 | 3300025986 | Ga0207658_10443625 | Ga0207658_104436252 | 98 |
| 269 | 3300026023 | Ga0207677_10112672 | Ga0207677_101126723 | 98 |
| 270 | 3300026035 | Ga0207703_10000038 | Ga0207703_1000003898 | 98 |
| 271 | 3300026035 | Ga0207703_10003500 | Ga0207703_100035003 | 98 |
| 272 | 3300026035 | Ga0207703_10263749 | Ga0207703_102637492 | 98 |
| 273 | 3300026041 | Ga0207639_10034165 | Ga0207639_100341652 | 98 |
| 274 | 3300026041 | Ga0207639_10134102 | Ga0207639_101341022 | 98 |
| 275 | 3300026041 | Ga0207639_10261768 | Ga0207639_102617682 | 98 |
| 276 | 3300026041 | Ga0207639_10340443 | Ga0207639_103404432 | 98 |
| 277 | 3300026041 | Ga0207639_11174242 | Ga0207639_111742422 | 98 |
| 278 | 3300026067 | Ga0207678_10239484 | Ga0207678_102394842 | 98 |
| 279 | 3300026067 | Ga0207678_10665928 | Ga0207678_106659281 | 98 |
| 280 | 3300026067 | Ga0207678_11386480 | Ga0207678_113864802 | 98 |
| 281 | 3300026075 | Ga0207708_11142745 | Ga0207708_111427452 | 98 |
| 282 | 3300026078 | Ga0207702_10381961 | Ga0207702_103819612 | 98 |
| 283 | 3300026078 | Ga0207702_10472207 | Ga0207702_104722072 | 98 |
| 284 | 3300026078 | Ga0207702_11876756 | Ga0207702_118767561 | 98 |
| 285 | 3300026078 | Ga0207702_12305779 | Ga0207702_123057791 | 98 |
| 286 | 3300026088 | Ga0207641_10000012 | Ga0207641_10000012160 | 98 |
| 287 | 3300026088 | Ga0207641_10000341 | Ga0207641_1000034125 | 98 |
| 288 | 3300026088 | Ga0207641_11356611 | Ga0207641_113566111 | 98 |
| 289 | 3300026088 | Ga0207641_12459287 | Ga0207641_124592871 | 98 |
| 290 | 3300026095 | Ga0207676_10000255 | Ga0207676_1000025519 | 98 |
| 291 | 3300026095 | Ga0207676_10000797 | Ga0207676_1000079713 | 98 |
| 292 | 3300026095 | Ga0207676_10005948 | Ga0207676_100059483 | 98 |
| 293 | 3300026116 | Ga0207674_11502596 | Ga0207674_115025961 | 98 |
| 294 | 3300026118 | Ga0207675_100572587 | Ga0207675_1005725872 | 98 |
| 295 | 3300026121 | Ga0207683_10049180 | Ga0207683_100491803 | 98 |
| 296 | 3300026142 | Ga0207698_10771449 | Ga0207698_107714491 | 98 |
| 297 | 3300026142 | Ga0207698_11655590 | Ga0207698_116555902 | 98 |
| 298 | 3300027364 | Ga0209967_1022439 | Ga0209967_10224392 | 98 |
| 299 | 3300027378 | Ga0209981_1000976 | Ga0209981_10009762 | 98 |
| 300 | 3300027543 | Ga0209999_1003416 | Ga0209999_10034164 | 98 |
| 301 | 3300027665 | Ga0209983_1015357 | Ga0209983_10153572 | 98 |
| 302 | 3300027876 | Ga0209974_10271765 | Ga0209974_102717652 | 98 |
| 303 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064171 | 98 |
| 304 | 3300028379 | Ga0268266_10001340 | Ga0268266_1000134013 | 98 |
| 305 | 3300028379 | Ga0268266_10009825 | Ga0268266_100098252 | 98 |
| 306 | 3300028379 | Ga0268266_10443169 | Ga0268266_104431692 | 98 |
| 307 | 3300028380 | Ga0268265_10001646 | Ga0268265_1000164617 | 98 |
| 308 | 3300028380 | Ga0268265_10005054 | Ga0268265_100050544 | 98 |
| 309 | 3300028380 | Ga0268265_10016564 | Ga0268265_100165642 | 98 |
| 310 | 3300028380 | Ga0268265_10970078 | Ga0268265_109700782 | 98 |
| 311 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046133 | 98 |
| 312 | 3300028381 | Ga0268264_10028586 | Ga0268264_100285863 | 98 |
| 313 | 3300028381 | Ga0268264_11121999 | Ga0268264_111219992 | 98 |
| 314 | 3300028786 | Ga0307517_10082580 | Ga0307517_100825802 | 98 |
| 315 | 3300028786 | Ga0307517_10121079 | Ga0307517_101210792 | 98 |
| 316 | 3300028786 | Ga0307517_10175489 | Ga0307517_101754892 | 98 |
| 317 | 3300028794 | Ga0307515_10054933 | Ga0307515_100549336 | 98 |
| 318 | 3300028794 | Ga0307515_10123962 | Ga0307515_101239622 | 98 |
| 319 | 3300031251 | Ga0265327_10101553 | Ga0265327_101015532 | 98 |
| 320 | 3300031456 | Ga0307513_10000448 | Ga0307513_1000044819 | 98 |
| 321 | 3300031456 | Ga0307513_10009333 | Ga0307513_1000933311 | 98 |
| 322 | 3300031456 | Ga0307513_10014931 | Ga0307513_100149313 | 98 |
| 323 | 3300031456 | Ga0307513_10021685 | Ga0307513_100216853 | 98 |
| 324 | 3300031456 | Ga0307513_10241068 | Ga0307513_102410682 | 98 |
| 325 | 3300031711 | Ga0265314_10313776 | Ga0265314_103137762 | 98 |
| 326 | 3300031730 | Ga0307516_10000004 | Ga0307516_10000004336 | 98 |
| 327 | 3300031824 | Ga0307413_10682006 | Ga0307413_106820062 | 98 |
| 328 | 3300031824 | Ga0307413_11759838 | Ga0307413_117598382 | 98 |
| 329 | 3300031852 | Ga0307410_10333517 | Ga0307410_103335172 | 98 |
| 330 | 3300031901 | Ga0307406_10665721 | Ga0307406_106657212 | 98 |
| 331 | 3300031901 | Ga0307406_11094156 | Ga0307406_110941561 | 98 |
| 332 | 3300031903 | Ga0307407_10238519 | Ga0307407_102385192 | 98 |
| 333 | 3300031911 | Ga0307412_10459566 | Ga0307412_104595661 | 98 |
| 334 | 3300031911 | Ga0307412_10942731 | Ga0307412_109427312 | 98 |
| 335 | 3300031995 | Ga0307409_100750868 | Ga0307409_1007508682 | 98 |
| 336 | 3300032004 | Ga0307414_10316441 | Ga0307414_103164412 | 98 |
| 337 | 3300032004 | Ga0307414_10461054 | Ga0307414_104610542 | 98 |
| 338 | 3300033180 | Ga0307510_10013265 | Ga0307510_100132654 | 98 |
| 339 | 3300035089 | Ga0373944_0243141 | Ga0373944_0243141_198_494 | 98 |
| 340 | 3300035111 | Ga0373923_0606409 | Ga0373923_0606409_39_335 | 98 |
| 341 | 3300035113 | Ga0373936_0000998 | Ga0373936_0000998_4200_4496 | 98 |
| 342 | 3300035113 | Ga0373936_0635685 | Ga0373936_0635685_129_425 | 98 |
| 343 | 3300035116 | Ga0373945_0053890 | Ga0373945_0053890_835_1131 | 98 |
| 344 | 3300035170 | Ga0373943_0387399 | Ga0373943_0387399_426_722 | 98 |
| 345 | 3300035171 | Ga0373946_0223865 | Ga0373946_0223865_380_676 | 98 |
| 346 | 3300035171 | Ga0373946_0341531 | Ga0373946_0341531_209_505 | 98 |
| 347 | 3300035171 | Ga0373946_0567125 | Ga0373946_0567125_196_492 | 98 |
| 348 | 3300035692 | Ga0373935_0094806 | Ga0373935_0094806_1177_1473 | 98 |
| 349 | 3300035695 | Ga0373927_0001126 | Ga0373927_0001126_14659_14955 | 98 |
| 350 | 3300035725 | Ga0373947_0285365 | Ga0373947_0285365_567_863 | 98 |
| 351 | 3300035725 | Ga0373947_0353720 | Ga0373947_0353720_532_828 | 98 |
| 352 | 3300037068 | Ga0373925_0000061 | Ga0373925_0000061_2611_2907 | 98 |
| 353 | 3300037068 | Ga0373925_0167244 | Ga0373925_0167244_1347_1643 | 98 |
| 354 | 3300037068 | Ga0373925_1178609 | Ga0373925_1178609_77_373 | 98 |
| 355 | 3300037312 | Ga0395899_0001481 | Ga0395899_0001481_16684_16980 | 98 |
| 356 | 3300037312 | Ga0395899_0114434 | Ga0395899_0114434_1118_1414 | 98 |
| 357 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_288552_288848 | 98 |
| 358 | 3300037418 | Ga0395900_0127010 | Ga0395900_0127010_308_604 | 98 |
| 359 | 3300037471 | Ga0395905_0009333 | Ga0395905_0009333_1373_1669 | 98 |
| 360 | 3300037471 | Ga0395905_0103332 | Ga0395905_0103332_56_352 | 98 |
| 361 | 3300037471 | Ga0395905_0214382 | Ga0395905_0214382_850_1146 | 98 |
| 362 | 3300037471 | Ga0395905_0354476 | Ga0395905_0354476_921_1217 | 98 |
| 363 | 3300037853 | Ga0436364_0652191 | Ga0436364_0652191_631_936 | 98 |
| 364 | 3300038443 | Ga0395901_0000014 | Ga0395901_0000014_239757_240053 | 98 |
| 365 | 3300038443 | Ga0395901_0214846 | Ga0395901_0214846_1058_1354 | 98 |
| 366 | 3300038443 | Ga0395901_0354836 | Ga0395901_0354836_773_1069 | 98 |
| 367 | 3300039145 | Ga0237816_05968 | Ga0237816_05968_445_741 | 98 |
| 368 | 3300039437 | Ga0436365_0029920 | Ga0436365_0029920_635_931 | 98 |
| 369 | 3300039437 | Ga0436365_0126971 | Ga0436365_0126971_536_841 | 98 |
| 370 | 3300039447 | Ga0436361_1006839 | Ga0436361_1006839_173_469 | 98 |
| 371 | 3300039453 | Ga0436362_0910244 | Ga0436362_0910244_111_422 | 98 |
| 372 | 3300041443 | Ga0451789_0839542 | Ga0451789_0839542_490_786 | 98 |
| 373 | 3300041451 | Ga0451791_1410250 | Ga0451791_1410250_137_433 | 98 |
| 374 | 3300041496 | Ga0451839_0561046 | Ga0451839_0561046_251_547 | 98 |
| 375 | 3300041505 | Ga0451849_1292768 | Ga0451849_1292768_364_660 | 98 |
| 376 | 3300041512 | Ga0451853_1309221 | Ga0451853_1309221_364_666 | 98 |
| 377 | 3300041997 | Ga0439431_0158908 | Ga0439431_0158908_207_503 | 98 |
| 378 | 3300042000 | Ga0439437_013840 | Ga0439437_013840_310_606 | 98 |
| 379 | 3300042001 | Ga0439441_067702 | Ga0439441_067702_251_547 | 98 |
| 380 | 3300042004 | Ga0439445_0159551 | Ga0439445_0159551_13_309 | 98 |
| 381 | 3300042125 | Ga0450923_193527 | Ga0450923_193527_181_477 | 98 |
| 382 | 3300042156 | Ga0439446_0011949 | Ga0439446_0011949_706_1002 | 98 |
| 383 | 3300042438 | Ga0439459_0031974 | Ga0439459_0031974_574_870 | 98 |
| 384 | 3300044735 | Ga0466968_0072883 | Ga0466968_0072883_1110_1406 | 98 |
| 385 | 3300044842 | Ga0466957_0593099 | Ga0466957_0593099_436_732 | 98 |
| 386 | 3300044842 | Ga0466957_0754530 | Ga0466957_0754530_348_644 | 98 |
| 387 | 3300045049 | Ga0466959_0932265 | Ga0466959_0932265_254_550 | 98 |
| 388 | 3300045976 | Ga0466967_2423307 | Ga0466967_2423307_190_486 | 98 |
| 389 | 3300046453 | Ga0495627_001515 | Ga0495627_001515_7973_8269 | 98 |
| 390 | 3300046457 | Ga0495590_0001875 | Ga0495590_0001875_7547_7843 | 98 |
| 391 | 3300046459 | Ga0495629_0047462 | Ga0495629_0047462_2275_2571 | 98 |
| 392 | 3300046460 | Ga0495638_0000260 | Ga0495638_0000260_63963_64259 | 98 |
| 393 | 3300046460 | Ga0495638_0000585 | Ga0495638_0000585_33137_33433 | 98 |
| 394 | 3300046460 | Ga0495638_0010056 | Ga0495638_0010056_3158_3454 | 98 |
| 395 | 3300046460 | Ga0495638_0022004 | Ga0495638_0022004_330_626 | 98 |
| 396 | 3300046460 | Ga0495638_0115689 | Ga0495638_0115689_468_764 | 98 |
| 397 | 3300046471 | Ga0495650_0000017 | Ga0495650_0000017_79881_80177 | 98 |
| 398 | 3300046471 | Ga0495650_0113444 | Ga0495650_0113444_63_359 | 98 |
| 399 | 3300046474 | Ga0495605_0490210 | Ga0495605_0490210_173_481 | 98 |
| 400 | 3300046492 | Ga0495585_0537802 | Ga0495585_0537802_92_388 | 98 |
| 401 | 3300046501 | Ga0495607_0327832 | Ga0495607_0327832_35_331 | 98 |
| 402 | 3300046506 | Ga0495583_0000020 | Ga0495583_0000020_193399_193695 | 98 |
| 403 | 3300046507 | Ga0495606_0020511 | Ga0495606_0020511_301_597 | 98 |
| 404 | 3300046507 | Ga0495606_0475788 | Ga0495606_0475788_235_531 | 98 |
| 405 | 3300046507 | Ga0495606_0520705 | Ga0495606_0520705_252_548 | 98 |
| 406 | 3300046512 | Ga0495610_0014650 | Ga0495610_0014650_748_1044 | 98 |
| 407 | 3300046512 | Ga0495610_0021498 | Ga0495610_0021498_744_1040 | 98 |
| 408 | 3300046512 | Ga0495610_0083317 | Ga0495610_0083317_1101_1397 | 98 |
| 409 | 3300046513 | Ga0495616_0005319 | Ga0495616_0005319_7593_7889 | 98 |
| 410 | 3300046515 | Ga0495620_0031152 | Ga0495620_0031152_1410_1706 | 98 |
| 411 | 3300046515 | Ga0495620_0038413 | Ga0495620_0038413_491_787 | 98 |
| 412 | 3300046515 | Ga0495620_0301563 | Ga0495620_0301563_150_446 | 98 |
| 413 | 3300046516 | Ga0495628_0047510 | Ga0495628_0047510_2785_3123 | 98 |
| 414 | 3300046517 | Ga0495630_0712891 | Ga0495630_0712891_302_640 | 98 |
| 415 | 3300046518 | Ga0495631_0046830 | Ga0495631_0046830_1001_1297 | 98 |
| 416 | 3300046519 | Ga0495632_0023633 | Ga0495632_0023633_2633_2929 | 98 |
| 417 | 3300046519 | Ga0495632_0156522 | Ga0495632_0156522_693_992 | 98 |
| 418 | 3300046519 | Ga0495632_0207254 | Ga0495632_0207254_244_540 | 98 |
| 419 | 3300046520 | Ga0495637_0036818 | Ga0495637_0036818_1184_1480 | 98 |
| 420 | 3300046520 | Ga0495637_0063819 | Ga0495637_0063819_206_502 | 98 |
| 421 | 3300046520 | Ga0495637_0118152 | Ga0495637_0118152_471_767 | 98 |
| 422 | 3300046522 | Ga0495643_0009536 | Ga0495643_0009536_5319_5615 | 98 |
| 423 | 3300046522 | Ga0495643_0348226 | Ga0495643_0348226_304_600 | 98 |
| 424 | 3300046524 | Ga0495648_0000029 | Ga0495648_0000029_170509_170805 | 98 |
| 425 | 3300046524 | Ga0495648_0128996 | Ga0495648_0128996_492_788 | 98 |
| 426 | 3300046525 | Ga0495663_0052032 | Ga0495663_0052032_391_687 | 98 |
| 427 | 3300046525 | Ga0495663_0371085 | Ga0495663_0371085_165_473 | 98 |
| 428 | 3300046528 | Ga0495642_0003852 | Ga0495642_0003852_4731_5039 | 98 |
| 429 | 3300046528 | Ga0495642_0218939 | Ga0495642_0218939_408_716 | 98 |
| 430 | 3300046528 | Ga0495642_0472495 | Ga0495642_0472495_225_536 | 98 |
| 431 | 3300046530 | Ga0495654_0000126 | Ga0495654_0000126_4423_4719 | 98 |
| 432 | 3300046530 | Ga0495654_0037471 | Ga0495654_0037471_671_967 | 98 |
| 433 | 3300046530 | Ga0495654_0349936 | Ga0495654_0349936_199_495 | 98 |
| 434 | 3300046542 | Ga0495597_0001737 | Ga0495597_0001737_2924_3220 | 98 |
| 435 | 3300046542 | Ga0495597_0075882 | Ga0495597_0075882_672_968 | 98 |
| 436 | 3300046542 | Ga0495597_0100064 | Ga0495597_0100064_890_1186 | 98 |
| 437 | 3300046543 | Ga0495645_0111590 | Ga0495645_0111590_726_1064 | 98 |
| 438 | 3300046557 | Ga0495622_0091706 | Ga0495622_0091706_298_594 | 98 |
| 439 | 3300046558 | Ga0495633_0224570 | Ga0495633_0224570_514_810 | 98 |
| 440 | 3300046616 | Ga0495668_0004748 | Ga0495668_0004748_3263_3559 | 98 |
| 441 | 3300046616 | Ga0495668_0006966 | Ga0495668_0006966_1281_1577 | 98 |
| 442 | 3300046616 | Ga0495668_0062435 | Ga0495668_0062435_161_457 | 98 |
| 443 | 3300046616 | Ga0495668_0206944 | Ga0495668_0206944_725_1021 | 98 |
| 444 | 3300046616 | Ga0495668_0403615 | Ga0495668_0403615_228_533 | 98 |
| 445 | 3300046616 | Ga0495668_0784743 | Ga0495668_0784743_58_369 | 98 |
| 446 | 3300046648 | Ga0495611_0001817 | Ga0495611_0001817_5795_6106 | 98 |
| 447 | 3300046660 | Ga0495625_0008503 | Ga0495625_0008503_2010_2306 | 98 |
| 448 | 3300046660 | Ga0495625_0028887 | Ga0495625_0028887_3081_3377 | 98 |
| 449 | 3300046660 | Ga0495625_0096766 | Ga0495625_0096766_1147_1443 | 98 |
| 450 | 3300046660 | Ga0495625_0219743 | Ga0495625_0219743_78_374 | 98 |
| 451 | 3300046660 | Ga0495625_0270219 | Ga0495625_0270219_58_354 | 98 |
| 452 | 3300046660 | Ga0495625_0662794 | Ga0495625_0662794_195_491 | 98 |
| 453 | 3300046664 | Ga0495659_0455861 | Ga0495659_0455861_174_470 | 98 |
| 454 | 3300046664 | Ga0495659_0552665 | Ga0495659_0552665_152_463 | 98 |
| 455 | 3300046683 | Ga0495658_0916199 | Ga0495658_0916199_153_449 | 98 |
| 456 | 3300046684 | Ga0495669_0000114 | Ga0495669_0000114_48318_48614 | 98 |
| 457 | 3300046684 | Ga0495669_0000375 | Ga0495669_0000375_1232_1540 | 98 |
| 458 | 3300046684 | Ga0495669_0032254 | Ga0495669_0032254_1968_2264 | 98 |
| 459 | 3300046684 | Ga0495669_0435346 | Ga0495669_0435346_291_587 | 98 |
| 460 | 3300046690 | Ga0495624_0064980 | Ga0495624_0064980_1934_2230 | 98 |
| 461 | 3300046691 | Ga0495670_0607589 | Ga0495670_0607589_102_413 | 98 |
| 462 | 3300046692 | Ga0495671_0197556 | Ga0495671_0197556_569_865 | 98 |
| 463 | 3300046794 | Ga0495589_0036990 | Ga0495589_0036990_2134_2430 | 98 |
| 464 | 3300046810 | Ga0495660_0033231 | Ga0495660_0033231_203_499 | 98 |
| 465 | 3300046810 | Ga0495660_0199554 | Ga0495660_0199554_330_626 | 98 |
| 466 | 3300046810 | Ga0495660_0336714 | Ga0495660_0336714_353_649 | 98 |
| 467 | 3300047315 | Ga0495581_0085549 | Ga0495581_0085549_1430_1726 | 98 |
| 468 | 3300047315 | Ga0495581_0428986 | Ga0495581_0428986_270_566 | 98 |
| 469 | 3300047318 | Ga0495636_0336167 | Ga0495636_0336167_335_646 | 98 |
| 470 | 3300047320 | Ga0495672_0000647 | Ga0495672_0000647_35543_35839 | 98 |
| 471 | 3300047320 | Ga0495672_0268436 | Ga0495672_0268436_104_415 | 98 |
| 472 | 3300047323 | Ga0495683_0071213 | Ga0495683_0071213_89_385 | 98 |
| 473 | 3300047445 | Ga0495677_0064579 | Ga0495677_0064579_210_518 | 98 |
| 474 | 3300047446 | Ga0495679_007054 | Ga0495679_007054_3868_4164 | 98 |
| 475 | 3300047469 | Ga0495673_0000078 | Ga0495673_0000078_134189_134485 | 98 |
| 476 | 3300047469 | Ga0495673_0000330 | Ga0495673_0000330_7152_7448 | 98 |
| 477 | 3300047469 | Ga0495673_0015305 | Ga0495673_0015305_512_808 | 98 |
| 478 | 3300047470 | Ga0495681_0120479 | Ga0495681_0120479_86_382 | 98 |
| 479 | 3300047472 | Ga0495686_0000525 | Ga0495686_0000525_37773_38069 | 98 |
| 480 | 3300047472 | Ga0495686_0008089 | Ga0495686_0008089_1016_1312 | 98 |
| 481 | 3300047472 | Ga0495686_0174098 | Ga0495686_0174098_405_701 | 98 |
| 482 | 3300047472 | Ga0495686_0398726 | Ga0495686_0398726_223_519 | 98 |
| 483 | 3300047472 | Ga0495686_0509984 | Ga0495686_0509984_29_334 | 98 |
| 484 | 3300047673 | Ga0495593_0019427 | Ga0495593_0019427_3313_3609 | 98 |
| 485 | 3300048088 | Ga0495602_0449010 | Ga0495602_0449010_555_851 | 98 |
| 486 | 3300048903 | Ga0496100_0187330 | Ga0496100_0187330_288_599 | 98 |
| 487 | 3300048904 | Ga0496101_0196674 | Ga0496101_0196674_690_986 | 98 |
| 488 | 3300048904 | Ga0496101_0397153 | Ga0496101_0397153_190_501 | 98 |
| 489 | 3300048905 | Ga0496102_0010654 | Ga0496102_0010654_570_878 | 98 |
| 490 | 3300048905 | Ga0496102_0078602 | Ga0496102_0078602_1219_1530 | 98 |
| 491 | 3300048905 | Ga0496102_1164745 | Ga0496102_1164745_92_388 | 98 |
| 492 | 3300048906 | Ga0496103_0056762 | Ga0496103_0056762_1292_1603 | 98 |
| 493 | 3300048906 | Ga0496103_0198133 | Ga0496103_0198133_663_971 | 98 |
| 494 | 3300048907 | Ga0496104_0796591 | Ga0496104_0796591_489_797 | 98 |
| 495 | 3300048907 | Ga0496104_1885387 | Ga0496104_1885387_136_432 | 98 |
| 496 | 3300048908 | Ga0496105_0561225 | Ga0496105_0561225_345_653 | 98 |
| 497 | 3300048909 | Ga0496106_0024831 | Ga0496106_0024831_864_1160 | 98 |
| 498 | 3300048909 | Ga0496106_0722403 | Ga0496106_0722403_286_582 | 98 |
| 499 | 3300048910 | Ga0496107_0000023 | Ga0496107_0000023_118827_119123 | 98 |
| 500 | 3300048910 | Ga0496107_0314174 | Ga0496107_0314174_612_908 | 98 |
| 501 | 3300048911 | Ga0496108_0668921 | Ga0496108_0668921_539_835 | 98 |
| 502 | 3300048912 | Ga0496109_0023216 | Ga0496109_0023216_2441_2752 | 98 |
| 503 | 3300048915 | Ga0496112_1003981 | Ga0496112_1003981_318_629 | 98 |
| 504 | 3300048916 | Ga0496113_0086491 | Ga0496113_0086491_1411_1722 | 98 |
| 505 | 3300048918 | Ga0496115_0056404 | Ga0496115_0056404_1703_2017 | 98 |
| 506 | 3300048918 | Ga0496115_0096783 | Ga0496115_0096783_793_1104 | 98 |
| 507 | 3300048918 | Ga0496115_0105546 | Ga0496115_0105546_664_960 | 98 |
| 508 | 3300048919 | Ga0496116_0161558 | Ga0496116_0161558_92_388 | 98 |
| 509 | 3300048921 | Ga0496118_0045404 | Ga0496118_0045404_1158_1454 | 98 |
| 510 | 3300048922 | Ga0496119_0101551 | Ga0496119_0101551_652_948 | 98 |
| 511 | 3300048922 | Ga0496119_0364199 | Ga0496119_0364199_198_494 | 98 |
| 512 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_38903_39199 | 98 |
| 513 | 3300048924 | Ga0496121_0017079 | Ga0496121_0017079_2223_2519 | 98 |
| 514 | 3300048925 | Ga0496122_0290588 | Ga0496122_0290588_285_581 | 98 |
| 515 | 3300048927 | Ga0496124_0220272 | Ga0496124_0220272_775_1071 | 98 |
| 516 | 3300048927 | Ga0496124_0235005 | Ga0496124_0235005_784_1116 | 98 |
| 517 | 3300048928 | Ga0496125_0505751 | Ga0496125_0505751_354_650 | 98 |
| 518 | 3300048929 | Ga0496126_0315991 | Ga0496126_0315991_232_528 | 98 |
| 519 | 3300049459 | Ga0495678_002702 | Ga0495678_002702_10509_10805 | 98 |
| 520 | 3300049459 | Ga0495678_134065 | Ga0495678_134065_349_645 | 98 |
| 521 | 3300049460 | Ga0495682_0057491 | Ga0495682_0057491_1021_1317 | 98 |
| 522 | 3300049571 | Ga0501034_0002380 | Ga0501034_0002380_844_1158 | 98 |
| 523 | 3300049573 | Ga0501037_0255526 | Ga0501037_0255526_507_824 | 98 |
| 524 | 3300049574 | Ga0501038_0395005 | Ga0501038_0395005_382_696 | 98 |
| 525 | 3300049574 | Ga0501038_0878138 | Ga0501038_0878138_30_347 | 98 |
| 526 | 3300049579 | Ga0501043_1177919 | Ga0501043_1177919_67_363 | 98 |
| 527 | 3300049581 | Ga0501047_0005360 | Ga0501047_0005360_2068_2364 | 98 |
| 528 | 3300049581 | Ga0501047_0015925 | Ga0501047_0015925_4012_4308 | 98 |
| 529 | 3300049581 | Ga0501047_0072292 | Ga0501047_0072292_36_332 | 98 |
| 530 | 3300049581 | Ga0501047_0468006 | Ga0501047_0468006_259_555 | 98 |
| 531 | 3300049581 | Ga0501047_0518541 | Ga0501047_0518541_451_747 | 98 |
| 532 | 3300049581 | Ga0501047_0605530 | Ga0501047_0605530_15_311 | 98 |
| 533 | 3300049671 | Ga0501238_000728 | Ga0501238_000728_2758_3054 | 98 |
| 534 | 3300049671 | Ga0501238_006716 | Ga0501238_006716_1089_1385 | 98 |
| 535 | 3300049686 | Ga0501257_003780 | Ga0501257_003780_1979_2275 | 98 |
| 536 | 3300049686 | Ga0501257_190253 | Ga0501257_190253_152_502 | 98 |
| 537 | 3300049742 | Ga0501080_1778774 | Ga0501080_1778774_111_425 | 98 |
| 538 | 3300049822 | Ga0501035_0731082 | Ga0501035_0731082_451_747 | 98 |
| 539 | 3300049823 | Ga0501044_0000504 | Ga0501044_0000504_16323_16640 | 98 |
| 540 | 3300049823 | Ga0501044_0005853 | Ga0501044_0005853_3545_3841 | 98 |
| 541 | 3300049823 | Ga0501044_0260458 | Ga0501044_0260458_112_471 | 98 |
| 542 | 3300049823 | Ga0501044_0350158 | Ga0501044_0350158_664_960 | 98 |
| 543 | 3300049823 | Ga0501044_1139595 | Ga0501044_1139595_79_375 | 98 |
| 544 | 3300049823 | Ga0501044_1351592 | Ga0501044_1351592_96_392 | 98 |
| 545 | 3300050493 | nmdc:mga0k408_19270_c1 | nmdc:mga0k408_19270_c1_1655_1951 | 98 |
| 546 | 3300050493 | nmdc:mga0k408_88519_c1 | nmdc:mga0k408_88519_c1_141_437 | 98 |
| 547 | 3300050496 | nmdc:mga07m45_747425_c1 | nmdc:mga07m45_747425_c1_83_379 | 98 |
| 548 | 3300053077 | Ga0495601_0482140 | Ga0495601_0482140_418_756 | 98 |
| 549 | 3300053080 | Ga0500635_0000302 | Ga0500635_0000302_13361_13657 | 98 |
| 550 | 3300053086 | Ga0500578_0000008 | Ga0500578_0000008_7597_7893 | 98 |
| 551 | 3300053086 | Ga0500578_0271497 | Ga0500578_0271497_527_823 | 98 |
| 552 | 3300053087 | Ga0500643_006804 | Ga0500643_006804_2935_3231 | 98 |
| 553 | 3300053087 | Ga0500643_017285 | Ga0500643_017285_604_900 | 98 |
| 554 | 3300053087 | Ga0500643_092806 | Ga0500643_092806_471_767 | 98 |
| 555 | 3300053088 | Ga0500644_0000028 | Ga0500644_0000028_85825_86121 | 98 |
| 556 | 3300053090 | Ga0500646_0132559 | Ga0500646_0132559_459_755 | 98 |
| 557 | 3300053090 | Ga0500646_0224708 | Ga0500646_0224708_314_610 | 98 |
| 558 | 3300053091 | Ga0500647_0045013 | Ga0500647_0045013_1230_1526 | 98 |
| 559 | 3300053093 | Ga0500651_0038819 | Ga0500651_0038819_192_488 | 98 |
| 560 | 3300053093 | Ga0500651_0200404 | Ga0500651_0200404_299_595 | 98 |
| 561 | 3300053094 | Ga0500566_0089867 | Ga0500566_0089867_515_811 | 98 |
| 562 | 3300053096 | Ga0500641_0072090 | Ga0500641_0072090_951_1247 | 98 |
| 563 | 3300053096 | Ga0500641_0163247 | Ga0500641_0163247_616_912 | 98 |
| 564 | 3300053102 | Ga0500554_084004 | Ga0500554_084004_202_498 | 98 |
| 565 | 3300053103 | Ga0500555_001817 | Ga0500555_001817_1731_2027 | 98 |
| 566 | 3300053103 | Ga0500555_115700 | Ga0500555_115700_347_643 | 98 |
| 567 | 3300053104 | Ga0500556_0003050 | Ga0500556_0003050_3512_3808 | 98 |
| 568 | 3300053104 | Ga0500556_0048840 | Ga0500556_0048840_638_934 | 98 |
| 569 | 3300053104 | Ga0500556_0100926 | Ga0500556_0100926_752_1048 | 98 |
| 570 | 3300053108 | Ga0500562_002026 | Ga0500562_002026_3813_4238 | 98 |
| 571 | 3300053108 | Ga0500562_004573 | Ga0500562_004573_1798_2094 | 98 |
| 572 | 3300053109 | Ga0500569_102730 | Ga0500569_102730_545_841 | 98 |
| 573 | 3300053111 | Ga0500572_099153 | Ga0500572_099153_569_865 | 98 |
| 574 | 3300053118 | Ga0500594_0000309 | Ga0500594_0000309_7551_7847 | 98 |
| 575 | 3300053119 | Ga0500595_004249 | Ga0500595_004249_2851_3147 | 98 |
| 576 | 3300053121 | Ga0500607_040329 | Ga0500607_040329_1021_1317 | 98 |
| 577 | 3300053121 | Ga0500607_233215 | Ga0500607_233215_443_739 | 98 |
| 578 | 3300053122 | Ga0500608_000573 | Ga0500608_000573_1605_1901 | 98 |
| 579 | 3300053122 | Ga0500608_060706 | Ga0500608_060706_897_1193 | 98 |
| 580 | 3300053122 | Ga0500608_179056 | Ga0500608_179056_325_621 | 98 |
| 581 | 3300053123 | Ga0500614_010544 | Ga0500614_010544_537_833 | 98 |
| 582 | 3300053123 | Ga0500614_013483 | Ga0500614_013483_629_925 | 98 |
| 583 | 3300053125 | Ga0500618_000060 | Ga0500618_000060_31882_32178 | 98 |
| 584 | 3300053130 | Ga0500642_0097207 | Ga0500642_0097207_306_602 | 98 |
| 585 | 3300053130 | Ga0500642_0109215 | Ga0500642_0109215_68_364 | 98 |
| 586 | 3300053133 | Ga0500655_021803 | Ga0500655_021803_637_933 | 98 |
| 587 | 3300053133 | Ga0500655_025521 | Ga0500655_025521_278_574 | 98 |
| 588 | 3300053134 | Ga0500658_0073550 | Ga0500658_0073550_858_1154 | 98 |
| 589 | 3300053134 | Ga0500658_0127586 | Ga0500658_0127586_461_757 | 98 |
| 590 | 3300053134 | Ga0500658_0419095 | Ga0500658_0419095_11_307 | 98 |
| 591 | 3300053136 | Ga0500559_0000005 | Ga0500559_0000005_198499_198795 | 98 |
| 592 | 3300053136 | Ga0500559_0012527 | Ga0500559_0012527_230_526 | 98 |
| 593 | 3300053136 | Ga0500559_0294342 | Ga0500559_0294342_78_374 | 98 |
| 594 | 3300053138 | Ga0500564_001092 | Ga0500564_001092_6970_7266 | 98 |
| 595 | 3300053142 | Ga0500577_0003928 | Ga0500577_0003928_2052_2348 | 98 |
| 596 | 3300053148 | Ga0500590_014706 | Ga0500590_014706_3326_3622 | 98 |
| 597 | 3300053148 | Ga0500590_319095 | Ga0500590_319095_263_559 | 98 |
| 598 | 3300053153 | Ga0500616_0006751 | Ga0500616_0006751_6294_6590 | 98 |
| 599 | 3300053153 | Ga0500616_0404338 | Ga0500616_0404338_30_326 | 98 |
| 600 | 3300053154 | Ga0500619_002486 | Ga0500619_002486_1846_2142 | 98 |
| 601 | 3300053156 | Ga0500622_0000105 | Ga0500622_0000105_24577_24873 | 98 |
| 602 | 3300053156 | Ga0500622_0024588 | Ga0500622_0024588_1190_1486 | 98 |
| 603 | 3300053158 | Ga0500627_0032197 | Ga0500627_0032197_1153_1449 | 98 |
| 604 | 3300053160 | Ga0500633_0203022 | Ga0500633_0203022_373_669 | 98 |
| 605 | 3300053162 | Ga0500638_162590 | Ga0500638_162590_664_960 | 98 |
| 606 | 3300053162 | Ga0500638_174350 | Ga0500638_174350_356_652 | 98 |
| 607 | 3300053177 | Ga0500636_0078861 | Ga0500636_0078861_1355_1651 | 98 |
| 608 | 3300053177 | Ga0500636_0127369 | Ga0500636_0127369_897_1193 | 98 |
| 609 | 3300053178 | Ga0500637_0061730 | Ga0500637_0061730_1240_1536 | 98 |
| 610 | 3300053178 | Ga0500637_0087263 | Ga0500637_0087263_507_803 | 98 |
| 611 | 3300053725 | Ga0500576_044374 | Ga0500576_044374_698_994 | 98 |
| 612 | 3300053727 | Ga0500611_010295 | Ga0500611_010295_867_1163 | 98 |
| 613 | 3300053729 | Ga0500625_015994 | Ga0500625_015994_565_861 | 98 |
| 614 | 3300053730 | Ga0500645_005969 | Ga0500645_005969_798_1094 | 98 |
| 615 | 3300053731 | Ga0500609_006570 | Ga0500609_006570_826_1122 | 98 |
| 616 | 3300053735 | Ga0500596_000489 | Ga0500596_000489_3972_4268 | 98 |
| 617 | 3300055283 | Ga0500661_101066 | Ga0500661_101066_187_483 | 98 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar