F469393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 614 | 355 | 581 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0015064|Ga0501034_0015064_2069_2803 |
| Length | 244 |
| Sequence | MTPPPPYDGDTSPAELGRKENVAIMIIVGLTGSIGMGKSTAAKMLRQMGVPVYDADAAVHRLQAPGGLALPPIEAAFPGVVKNGVLDRQALGGRVFGDKAALRRLEAIVHPLVQQQQRLFVRRAALRSAPMVVLDIPLLFEGLGERRVDGVLVVSAPAFLQRQRVMARPGMTAEKFAGILRQQVPDSLKRRKATVVIPTGLGLAPTRTALAKAVRSLKKKQGRSWPANPWRDRFTARLARAKRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 3 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 4 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 5 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 6 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 7 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 8 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 9 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 10 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 11 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 12 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 13 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 14 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 15 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 16 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 17 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 97 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 98 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 111 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 279 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 306 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 307 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 314 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 315 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 317 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 318 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 319 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 320 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 321 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 324 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 325 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 330 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 331 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 333 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 335 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 337 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 338 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 341 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 342 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 343 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 344 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 345 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 346 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 347 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 348 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 349 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 350 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 351 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 352 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 353 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 354 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 355 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.46 |
| Metatranscriptomes | 0.16 |
| Isolates | 5.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.29 |
| Nodule | 3.09 |
| Rhizoplane | 4.07 |
| Rhizosphere | 70.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000010 | 3300003214 | Bacteria | 442113 |
| 2 | Ga0055528_1006962 | 3300003790 | Bacteria | 5061 |
| 3 | Ga0055530_10000313 | 3300003791 | Bacteria | 44170 |
| 4 | Ga0055530_10002661 | 3300003791 | Bacteria | 11168 |
| 5 | Ga0055530_10011004 | 3300003791 | Bacteria | 3285 |
| 6 | Ga0055531_10002220 | 3300003794 | Bacteria | 13181 |
| 7 | Ga0055531_10002388 | 3300003794 | Bacteria | 12617 |
| 8 | Ga0055543_1033061 | 3300004625 | Bacteria | 896 |
| 9 | Ga0065165_1004438 | 3300005262 | Bacteria | 8701 |
| 10 | Ga0065165_1005530 | 3300005262 | Bacteria | 7058 |
| 11 | Ga0065714_10070296 | 3300005288 | Bacteria | 3907 |
| 12 | Ga0065704_10095571 | 3300005289 | Bacteria | 2482 |
| 13 | Ga0070658_10312691 | 3300005327 | Bacteria | 1340 |
| 14 | Ga0070658_10704365 | 3300005327 | Bacteria | 876 |
| 15 | Ga0070676_10079147 | 3300005328 | Bacteria | 1990 |
| 16 | Ga0070683_100084538 | 3300005329 | Bacteria | 2973 |
| 17 | Ga0070690_100177317 | 3300005330 | Bacteria | 1471 |
| 18 | Ga0070670_100373687 | 3300005331 | Bacteria | 1255 |
| 19 | Ga0068869_100226785 | 3300005334 | Bacteria | 1483 |
| 20 | Ga0070680_100001568 | 3300005336 | Bacteria | 16671 |
| 21 | Ga0068868_100052577 | 3300005338 | Bacteria | 3207 |
| 22 | Ga0070660_100019186 | 3300005339 | Bacteria | 5006 |
| 23 | Ga0070660_100100854 | 3300005339 | Bacteria | 2287 |
| 24 | Ga0070660_100240389 | 3300005339 | Bacteria | 1475 |
| 25 | Ga0070689_100072602 | 3300005340 | Bacteria | 2690 |
| 26 | Ga0070689_100110657 | 3300005340 | Bacteria | 2184 |
| 27 | Ga0070661_100101670 | 3300005344 | Bacteria | 2139 |
| 28 | Ga0070668_100011541 | 3300005347 | Bacteria | 6578 |
| 29 | Ga0070669_100013132 | 3300005353 | Bacteria | 5886 |
| 30 | Ga0070669_100214729 | 3300005353 | Bacteria | 1519 |
| 31 | Ga0070669_100308543 | 3300005353 | Bacteria | 1275 |
| 32 | Ga0070669_100584435 | 3300005353 | Bacteria | 934 |
| 33 | Ga0070671_100045879 | 3300005355 | Bacteria | 3633 |
| 34 | Ga0070671_100079556 | 3300005355 | Bacteria | 2740 |
| 35 | Ga0070671_100355050 | 3300005355 | Bacteria | 1251 |
| 36 | Ga0070673_100022431 | 3300005364 | Bacteria | 4595 |
| 37 | Ga0070688_100134573 | 3300005365 | Bacteria | 1672 |
| 38 | Ga0070659_100000552 | 3300005366 | Bacteria | 27366 |
| 39 | Ga0070659_100006406 | 3300005366 | Bacteria | 8500 |
| 40 | Ga0070709_10875616 | 3300005434 | Bacteria | 709 |
| 41 | Ga0070714_100088018 | 3300005435 | Bacteria | 2717 |
| 42 | Ga0070713_100026964 | 3300005436 | Bacteria | 4518 |
| 43 | Ga0070713_100050973 | 3300005436 | Bacteria | 3422 |
| 44 | Ga0070710_10367711 | 3300005437 | Bacteria | 956 |
| 45 | Ga0070708_100075119 | 3300005445 | Bacteria | 3050 |
| 46 | Ga0070708_100112540 | 3300005445 | Bacteria | 2503 |
| 47 | Ga0070678_101132543 | 3300005456 | Bacteria | 723 |
| 48 | Ga0070681_10006651 | 3300005458 | Bacteria | 11252 |
| 49 | Ga0070681_10082542 | 3300005458 | Bacteria | 3169 |
| 50 | Ga0070681_11096181 | 3300005458 | Bacteria | 717 |
| 51 | Ga0068867_100006768 | 3300005459 | Bacteria | 8100 |
| 52 | Ga0070706_100282305 | 3300005467 | Bacteria | 1550 |
| 53 | Ga0070707_100091862 | 3300005468 | Bacteria | 2939 |
| 54 | Ga0070698_100025801 | 3300005471 | Bacteria | 6124 |
| 55 | Ga0070698_100912634 | 3300005471 | Bacteria | 824 |
| 56 | Ga0070679_100007418 | 3300005530 | Bacteria | 10249 |
| 57 | Ga0070679_100009290 | 3300005530 | Bacteria | 9295 |
| 58 | Ga0070684_100024078 | 3300005535 | Bacteria | 5103 |
| 59 | Ga0068853_100011535 | 3300005539 | Bacteria | 7185 |
| 60 | Ga0068853_100466573 | 3300005539 | Bacteria | 1189 |
| 61 | Ga0070696_100227093 | 3300005546 | Bacteria | 1403 |
| 62 | Ga0070665_100000721 | 3300005548 | Bacteria | 44003 |
| 63 | Ga0070665_100109205 | 3300005548 | Bacteria | 2768 |
| 64 | Ga0070665_100186845 | 3300005548 | Bacteria | 2073 |
| 65 | Ga0068855_100000106 | 3300005563 | Bacteria | 103864 |
| 66 | Ga0068855_100024646 | 3300005563 | Bacteria | 7197 |
| 67 | Ga0068855_100044020 | 3300005563 | Bacteria | 5285 |
| 68 | Ga0068855_100126544 | 3300005563 | Bacteria | 2921 |
| 69 | Ga0068855_100257990 | 3300005563 | Bacteria | 1943 |
| 70 | Ga0068855_100310443 | 3300005563 | Bacteria | 1745 |
| 71 | Ga0068855_100783661 | 3300005563 | Bacteria | 1014 |
| 72 | Ga0068855_100864294 | 3300005563 | Bacteria | 957 |
| 73 | Ga0070664_100120880 | 3300005564 | Bacteria | 2293 |
| 74 | Ga0068857_100078940 | 3300005577 | Bacteria | 2938 |
| 75 | Ga0068857_100121908 | 3300005577 | Bacteria | 2348 |
| 76 | Ga0068854_100607081 | 3300005578 | Bacteria | 935 |
| 77 | Ga0068854_101139563 | 3300005578 | Unclassified | 696 |
| 78 | Ga0068856_100072284 | 3300005614 | Bacteria | 3415 |
| 79 | Ga0068856_100146970 | 3300005614 | Bacteria | 2365 |
| 80 | Ga0068852_100087292 | 3300005616 | Bacteria | 2783 |
| 81 | Ga0068859_100315980 | 3300005617 | Bacteria | 1656 |
| 82 | Ga0068859_100518643 | 3300005617 | Bacteria | 1287 |
| 83 | Ga0068864_100000145 | 3300005618 | Bacteria | 68040 |
| 84 | Ga0068864_100062794 | 3300005618 | Bacteria | 3219 |
| 85 | Ga0068864_100106924 | 3300005618 | Bacteria | 2488 |
| 86 | Ga0068864_100550283 | 3300005618 | Bacteria | 1115 |
| 87 | Ga0068870_10289216 | 3300005840 | Bacteria | 1030 |
| 88 | Ga0068863_100103825 | 3300005841 | Bacteria | 2704 |
| 89 | Ga0068863_100234406 | 3300005841 | Bacteria | 1771 |
| 90 | Ga0068863_100435322 | 3300005841 | Bacteria | 1286 |
| 91 | Ga0068858_100000268 | 3300005842 | Bacteria | 55747 |
| 92 | Ga0068858_100000370 | 3300005842 | Bacteria | 47225 |
| 93 | Ga0068858_100328887 | 3300005842 | Bacteria | 1462 |
| 94 | Ga0068860_100293462 | 3300005843 | Bacteria | 1591 |
| 95 | Ga0081455_10004620 | 3300005937 | Bacteria | 15371 |
| 96 | Ga0081455_10025838 | 3300005937 | Bacteria | 5413 |
| 97 | Ga0081539_10004087 | 3300005985 | Bacteria | 16680 |
| 98 | Ga0070717_11097182 | 3300006028 | Bacteria | 725 |
| 99 | Ga0075363_100008814 | 3300006048 | Bacteria | 4717 |
| 100 | Ga0075363_100308207 | 3300006048 | Bacteria | 920 |
| 101 | Ga0075364_10199401 | 3300006051 | Bacteria | 1356 |
| 102 | Ga0075432_10103145 | 3300006058 | Bacteria | 1056 |
| 103 | Ga0070712_100233774 | 3300006175 | Bacteria | 1461 |
| 104 | Ga0075362_10004771 | 3300006177 | Bacteria | 4896 |
| 105 | Ga0075362_10081232 | 3300006177 | Bacteria | 1494 |
| 106 | Ga0075362_10088078 | 3300006177 | Bacteria | 1438 |
| 107 | Ga0075367_10051804 | 3300006178 | Bacteria | 2427 |
| 108 | Ga0075369_10001444 | 3300006186 | Bacteria | 8107 |
| 109 | Ga0075369_10109805 | 3300006186 | Bacteria | 1243 |
| 110 | Ga0075369_10163993 | 3300006186 | Bacteria | 1019 |
| 111 | Ga0075366_10018266 | 3300006195 | Bacteria | 4047 |
| 112 | Ga0068871_100687960 | 3300006358 | Bacteria | 936 |
| 113 | Ga0068865_100012939 | 3300006881 | Bacteria | 5262 |
| 114 | Ga0097620_100315967 | 3300006931 | Bacteria | 1656 |
| 115 | Ga0097620_100518625 | 3300006931 | Bacteria | 1287 |
| 116 | Ga0099795_10008993 | 3300007788 | Bacteria | 2879 |
| 117 | Ga0105240_10000653 | 3300009093 | Bacteria | 63948 |
| 118 | Ga0105240_10001036 | 3300009093 | Bacteria | 49427 |
| 119 | Ga0105240_10026858 | 3300009093 | Bacteria | 7549 |
| 120 | Ga0105240_10197974 | 3300009093 | Bacteria | 2357 |
| 121 | Ga0105240_10279200 | 3300009093 | Bacteria | 1920 |
| 122 | Ga0105240_10279462 | 3300009093 | Bacteria | 1919 |
| 123 | Ga0105240_10873512 | 3300009093 | Bacteria | 969 |
| 124 | Ga0105245_10074248 | 3300009098 | Bacteria | 3094 |
| 125 | Ga0105245_10235411 | 3300009098 | Bacteria | 1773 |
| 126 | Ga0105245_10816277 | 3300009098 | Bacteria | 971 |
| 127 | Ga0114129_10158182 | 3300009147 | Bacteria | 3097 |
| 128 | Ga0105243_10004582 | 3300009148 | Bacteria | 10901 |
| 129 | Ga0105243_10038746 | 3300009148 | Bacteria | 3712 |
| 130 | Ga0105243_10133977 | 3300009148 | Bacteria | 2106 |
| 131 | Ga0105241_10372821 | 3300009174 | Bacteria | 1245 |
| 132 | Ga0105242_10032335 | 3300009176 | Bacteria | 4183 |
| 133 | Ga0105242_10652101 | 3300009176 | Bacteria | 1024 |
| 134 | Ga0105242_10653111 | 3300009176 | Bacteria | 1023 |
| 135 | Ga0105248_10000650 | 3300009177 | Bacteria | 39474 |
| 136 | Ga0105248_10108725 | 3300009177 | Bacteria | 3127 |
| 137 | Ga0105248_11026339 | 3300009177 | Bacteria | 932 |
| 138 | Ga0105237_10022290 | 3300009545 | Bacteria | 6498 |
| 139 | Ga0105237_10567538 | 3300009545 | Bacteria | 1141 |
| 140 | Ga0105238_10024421 | 3300009551 | Bacteria | 6161 |
| 141 | Ga0105238_10070858 | 3300009551 | Bacteria | 3484 |
| 142 | Ga0105249_10503820 | 3300009553 | Bacteria | 1256 |
| 143 | Ga0105148_100032 | 3300009978 | Bacteria | 20199 |
| 144 | Ga0105147_101839 | 3300009982 | Bacteria | 1736 |
| 145 | Ga0105035_103614 | 3300009988 | Bacteria | 1198 |
| 146 | Ga0105239_10000319 | 3300010375 | Bacteria | 70995 |
| 147 | Ga0105239_10001093 | 3300010375 | Bacteria | 37498 |
| 148 | Ga0105239_10010429 | 3300010375 | Bacteria | 10390 |
| 149 | Ga0105239_10857585 | 3300010375 | Bacteria | 1042 |
| 150 | Ga0105239_11349662 | 3300010375 | Bacteria | 823 |
| 151 | Ga0157369_10001360 | 3300013105 | Bacteria | 30196 |
| 152 | Ga0157369_10022866 | 3300013105 | Bacteria | 6972 |
| 153 | Ga0157374_10464244 | 3300013296 | Bacteria | 1268 |
| 154 | Ga0157378_10058417 | 3300013297 | Bacteria | 3440 |
| 155 | Ga0157378_10920047 | 3300013297 | Bacteria | 906 |
| 156 | Ga0157378_11276722 | 3300013297 | Bacteria | 775 |
| 157 | Ga0163162_10010851 | 3300013306 | Bacteria | 8866 |
| 158 | Ga0163162_10684485 | 3300013306 | Bacteria | 1148 |
| 159 | Ga0157372_10090362 | 3300013307 | Bacteria | 3481 |
| 160 | Ga0157372_10441289 | 3300013307 | Bacteria | 1517 |
| 161 | Ga0163163_10050842 | 3300014325 | Bacteria | 4083 |
| 162 | Ga0157380_10106285 | 3300014326 | Bacteria | 2348 |
| 163 | Ga0157376_10438578 | 3300014969 | Bacteria | 1271 |
| 164 | Ga0157376_11278281 | 3300014969 | Bacteria | 763 |
| 165 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 166 | Ga0206353_11944051 | 3300020082 | Bacteria | 1134 |
| 167 | Ga0213873_10038716 | 3300021358 | Bacteria | 1219 |
| 168 | Ga0213872_10001875 | 3300021361 | Bacteria | 12982 |
| 169 | Ga0209148_1013603 | 3300025254 | Bacteria | 1459 |
| 170 | Ga0209233_1000044 | 3300025261 | Bacteria | 489783 |
| 171 | Ga0209565_1001350 | 3300025263 | Bacteria | 11140 |
| 172 | Ga0209673_1000732 | 3300025273 | Bacteria | 45546 |
| 173 | Ga0209673_1037096 | 3300025273 | Bacteria | 1436 |
| 174 | Ga0209675_1008215 | 3300025291 | Bacteria | 3872 |
| 175 | Ga0209676_1000257 | 3300025292 | Bacteria | 112662 |
| 176 | Ga0209676_1000316 | 3300025292 | Bacteria | 94380 |
| 177 | Ga0209564_1004512 | 3300025295 | Bacteria | 8472 |
| 178 | Ga0209564_1033760 | 3300025295 | Bacteria | 1515 |
| 179 | Ga0209758_1002581 | 3300025297 | Bacteria | 18179 |
| 180 | Ga0209758_1002904 | 3300025297 | Bacteria | 16541 |
| 181 | Ga0209758_1004448 | 3300025297 | Bacteria | 11655 |
| 182 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 183 | Ga0209050_1003986 | 3300025298 | Bacteria | 10412 |
| 184 | Ga0209050_1012713 | 3300025298 | Bacteria | 3827 |
| 185 | Ga0209256_1003727 | 3300025299 | Bacteria | 10317 |
| 186 | Ga0209256_1004379 | 3300025299 | Bacteria | 8921 |
| 187 | Ga0209256_1017316 | 3300025299 | Bacteria | 2401 |
| 188 | Ga0207426_1068214 | 3300025302 | Bacteria | 1000 |
| 189 | Ga0209051_1024329 | 3300025303 | Bacteria | 2492 |
| 190 | Ga0209257_1000419 | 3300025304 | Bacteria | 81956 |
| 191 | Ga0209257_1000624 | 3300025304 | Bacteria | 56974 |
| 192 | Ga0209257_1004976 | 3300025304 | Bacteria | 9723 |
| 193 | Ga0209257_1012949 | 3300025304 | Bacteria | 3773 |
| 194 | Ga0207697_10003663 | 3300025315 | Bacteria | 7527 |
| 195 | Ga0207656_10167158 | 3300025321 | Bacteria | 1050 |
| 196 | Ga0207642_10099987 | 3300025899 | Bacteria | 1454 |
| 197 | Ga0207685_10095357 | 3300025905 | Bacteria | 1262 |
| 198 | Ga0207699_10181880 | 3300025906 | Bacteria | 1414 |
| 199 | Ga0207645_10011653 | 3300025907 | Bacteria | 5995 |
| 200 | Ga0207643_10134643 | 3300025908 | Bacteria | 1472 |
| 201 | Ga0207705_10001218 | 3300025909 | Bacteria | 20813 |
| 202 | Ga0207705_10035160 | 3300025909 | Bacteria | 3584 |
| 203 | Ga0207705_10181237 | 3300025909 | Bacteria | 1590 |
| 204 | Ga0207654_10059863 | 3300025911 | Bacteria | 2223 |
| 205 | Ga0207707_10004282 | 3300025912 | Bacteria | 12629 |
| 206 | Ga0207707_10027285 | 3300025912 | Bacteria | 4994 |
| 207 | Ga0207707_10840626 | 3300025912 | Bacteria | 762 |
| 208 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 209 | Ga0207695_10000867 | 3300025913 | Bacteria | 55339 |
| 210 | Ga0207695_10134575 | 3300025913 | Bacteria | 2426 |
| 211 | Ga0207695_10189443 | 3300025913 | Bacteria | 1975 |
| 212 | Ga0207695_10299135 | 3300025913 | Bacteria | 1500 |
| 213 | Ga0207695_10333651 | 3300025913 | Bacteria | 1405 |
| 214 | Ga0207671_10000924 | 3300025914 | Bacteria | 36861 |
| 215 | Ga0207671_10075442 | 3300025914 | Bacteria | 2522 |
| 216 | Ga0207663_10451518 | 3300025916 | Bacteria | 991 |
| 217 | Ga0207660_10001115 | 3300025917 | Bacteria | 17946 |
| 218 | Ga0207660_10021743 | 3300025917 | Bacteria | 4316 |
| 219 | Ga0207657_10000235 | 3300025919 | Bacteria | 58394 |
| 220 | Ga0207657_10136206 | 3300025919 | Bacteria | 2009 |
| 221 | Ga0207657_10156761 | 3300025919 | Bacteria | 1851 |
| 222 | Ga0207649_10039885 | 3300025920 | Bacteria | 2850 |
| 223 | Ga0207649_10042655 | 3300025920 | Bacteria | 2769 |
| 224 | Ga0207652_10011897 | 3300025921 | Bacteria | 7020 |
| 225 | Ga0207652_10097115 | 3300025921 | Bacteria | 2596 |
| 226 | Ga0207646_10220796 | 3300025922 | Bacteria | 1712 |
| 227 | Ga0207681_10010984 | 3300025923 | Bacteria | 5562 |
| 228 | Ga0207681_10298999 | 3300025923 | Bacteria | 1273 |
| 229 | Ga0207681_10389112 | 3300025923 | Bacteria | 1124 |
| 230 | Ga0207681_10693573 | 3300025923 | Bacteria | 846 |
| 231 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 232 | Ga0207694_10040482 | 3300025924 | Bacteria | 3588 |
| 233 | Ga0207694_10252701 | 3300025924 | Bacteria | 1443 |
| 234 | Ga0207659_10038717 | 3300025926 | Bacteria | 3319 |
| 235 | Ga0207687_10023768 | 3300025927 | Bacteria | 4088 |
| 236 | Ga0207687_10566003 | 3300025927 | Bacteria | 955 |
| 237 | Ga0207700_10049644 | 3300025928 | Bacteria | 3122 |
| 238 | Ga0207700_10073302 | 3300025928 | Bacteria | 2644 |
| 239 | Ga0207664_10019693 | 3300025929 | Bacteria | 4993 |
| 240 | Ga0207644_10050854 | 3300025931 | Bacteria | 2972 |
| 241 | Ga0207644_10057973 | 3300025931 | Bacteria | 2797 |
| 242 | Ga0207690_10000031 | 3300025932 | Bacteria | 154724 |
| 243 | Ga0207690_10014019 | 3300025932 | Bacteria | 4831 |
| 244 | Ga0207686_10093195 | 3300025934 | Bacteria | 1993 |
| 245 | Ga0207670_10086377 | 3300025936 | Bacteria | 2207 |
| 246 | Ga0207670_10425825 | 3300025936 | Bacteria | 1066 |
| 247 | Ga0207704_10026283 | 3300025938 | Bacteria | 3192 |
| 248 | Ga0207711_10003775 | 3300025941 | Bacteria | 13046 |
| 249 | Ga0207711_10019608 | 3300025941 | Bacteria | 5630 |
| 250 | Ga0207711_10186618 | 3300025941 | Bacteria | 1888 |
| 251 | Ga0207711_10324013 | 3300025941 | Bacteria | 1424 |
| 252 | Ga0207689_10076936 | 3300025942 | Bacteria | 2743 |
| 253 | Ga0207661_10068810 | 3300025944 | Bacteria | 2884 |
| 254 | Ga0207679_10037465 | 3300025945 | Bacteria | 3447 |
| 255 | Ga0207679_10702340 | 3300025945 | Bacteria | 918 |
| 256 | Ga0207667_10000232 | 3300025949 | Bacteria | 77277 |
| 257 | Ga0207667_10020506 | 3300025949 | Bacteria | 7348 |
| 258 | Ga0207667_10094923 | 3300025949 | Bacteria | 3079 |
| 259 | Ga0207667_10174431 | 3300025949 | Bacteria | 2209 |
| 260 | Ga0207651_10022119 | 3300025960 | Bacteria | 3880 |
| 261 | Ga0207668_10005922 | 3300025972 | Bacteria | 7204 |
| 262 | Ga0207677_10044056 | 3300026023 | Bacteria | 2970 |
| 263 | Ga0207677_10315556 | 3300026023 | Bacteria | 1297 |
| 264 | Ga0207677_10360875 | 3300026023 | Bacteria | 1220 |
| 265 | Ga0207703_10000139 | 3300026035 | Bacteria | 86495 |
| 266 | Ga0207703_10018753 | 3300026035 | Bacteria | 5404 |
| 267 | Ga0207703_10939435 | 3300026035 | Bacteria | 829 |
| 268 | Ga0207639_10003312 | 3300026041 | Bacteria | 10846 |
| 269 | Ga0207639_10032885 | 3300026041 | Bacteria | 3822 |
| 270 | Ga0207708_10364087 | 3300026075 | Bacteria | 1189 |
| 271 | Ga0207702_10025007 | 3300026078 | Bacteria | 4953 |
| 272 | Ga0207702_10372379 | 3300026078 | Bacteria | 1371 |
| 273 | Ga0207641_10083786 | 3300026088 | Bacteria | 2774 |
| 274 | Ga0207641_10118764 | 3300026088 | Bacteria | 2356 |
| 275 | Ga0207648_10015507 | 3300026089 | Bacteria | 7006 |
| 276 | Ga0207676_10000072 | 3300026095 | Bacteria | 101978 |
| 277 | Ga0207676_10002933 | 3300026095 | Bacteria | 12151 |
| 278 | Ga0207676_10047480 | 3300026095 | Bacteria | 3328 |
| 279 | Ga0207676_10359021 | 3300026095 | Bacteria | 1350 |
| 280 | Ga0207676_10502047 | 3300026095 | Bacteria | 1152 |
| 281 | Ga0207674_10039095 | 3300026116 | Bacteria | 4920 |
| 282 | Ga0207674_10197160 | 3300026116 | Bacteria | 1963 |
| 283 | Ga0207674_10225711 | 3300026116 | Bacteria | 1821 |
| 284 | Ga0207683_10043941 | 3300026121 | Bacteria | 3905 |
| 285 | Ga0207683_10663012 | 3300026121 | Bacteria | 967 |
| 286 | Ga0207698_10570779 | 3300026142 | Bacteria | 1112 |
| 287 | Ga0209179_1001197 | 3300027512 | Bacteria | 3081 |
| 288 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 289 | Ga0268266_10169666 | 3300028379 | Bacteria | 1980 |
| 290 | Ga0268266_10237597 | 3300028379 | Bacteria | 1680 |
| 291 | Ga0268266_10562428 | 3300028379 | Bacteria | 1093 |
| 292 | Ga0265334_10019555 | 3300028573 | Bacteria | 2784 |
| 293 | Ga0265318_10051209 | 3300028577 | Bacteria | 1551 |
| 294 | Ga0307517_10014862 | 3300028786 | Bacteria | 10407 |
| 295 | Ga0307517_10078685 | 3300028786 | Bacteria | 2848 |
| 296 | Ga0307515_10278160 | 3300028794 | Bacteria | 1385 |
| 297 | Ga0307511_10124969 | 3300030521 | Bacteria | 1573 |
| 298 | Ga0265332_10009706 | 3300031238 | Bacteria | 4294 |
| 299 | Ga0265328_10015573 | 3300031239 | Bacteria | 2975 |
| 300 | Ga0265325_10009030 | 3300031241 | Bacteria | 5848 |
| 301 | Ga0265325_10053670 | 3300031241 | Bacteria | 2066 |
| 302 | Ga0265329_10085737 | 3300031242 | Bacteria | 998 |
| 303 | Ga0265340_10038743 | 3300031247 | Bacteria | 2356 |
| 304 | Ga0265339_10009621 | 3300031249 | Bacteria | 6054 |
| 305 | Ga0265339_10207300 | 3300031249 | Bacteria | 964 |
| 306 | Ga0265331_10052420 | 3300031250 | Bacteria | 1949 |
| 307 | Ga0265316_10019515 | 3300031344 | Bacteria | 5796 |
| 308 | Ga0265316_10062585 | 3300031344 | Bacteria | 2887 |
| 309 | Ga0265316_10064176 | 3300031344 | Bacteria | 2845 |
| 310 | Ga0265316_10104167 | 3300031344 | Bacteria | 2154 |
| 311 | Ga0307513_10067935 | 3300031456 | Bacteria | 3736 |
| 312 | Ga0307509_10164056 | 3300031507 | Bacteria | 2114 |
| 313 | Ga0265313_10018163 | 3300031595 | Bacteria | 3961 |
| 314 | Ga0307508_10000363 | 3300031616 | Bacteria | 55049 |
| 315 | Ga0265314_10002040 | 3300031711 | Bacteria | 21393 |
| 316 | Ga0265314_10193112 | 3300031711 | Bacteria | 1210 |
| 317 | Ga0265342_10011415 | 3300031712 | Bacteria | 6083 |
| 318 | Ga0265342_10311868 | 3300031712 | Bacteria | 826 |
| 319 | Ga0307516_10008284 | 3300031730 | Bacteria | 11788 |
| 320 | Ga0307406_10873694 | 3300031901 | Bacteria | 764 |
| 321 | Ga0307411_11144187 | 3300032005 | Bacteria | 703 |
| 322 | Ga0307510_10007759 | 3300033180 | Bacteria | 12800 |
| 323 | Ga0307510_10062006 | 3300033180 | Bacteria | 3825 |
| 324 | Ga0373932_0010219 | 3300035112 | Bacteria | 2269 |
| 325 | Ga0373936_0013344 | 3300035113 | Bacteria | 3135 |
| 326 | Ga0373936_0036750 | 3300035113 | Bacteria | 1954 |
| 327 | Ga0373941_0150430 | 3300035115 | Bacteria | 854 |
| 328 | Ga0373945_0121419 | 3300035116 | Bacteria | 1039 |
| 329 | Ga0373943_0192908 | 3300035170 | Bacteria | 1124 |
| 330 | Ga0373943_0307338 | 3300035170 | Bacteria | 901 |
| 331 | Ga0373946_0022218 | 3300035171 | Bacteria | 2467 |
| 332 | Ga0373935_0206502 | 3300035692 | Bacteria | 1360 |
| 333 | Ga0373927_0000111 | 3300035695 | Bacteria | 62031 |
| 334 | Ga0373927_0118702 | 3300035695 | Bacteria | 1726 |
| 335 | Ga0373933_0120575 | 3300035724 | Bacteria | 1642 |
| 336 | Ga0373933_0584888 | 3300035724 | Bacteria | 733 |
| 337 | Ga0373947_0457242 | 3300035725 | Bacteria | 865 |
| 338 | Ga0373937_0068079 | 3300036401 | Bacteria | 3282 |
| 339 | Ga0373937_0355868 | 3300036401 | Bacteria | 1387 |
| 340 | Ga0373937_0503916 | 3300036401 | Bacteria | 1150 |
| 341 | Ga0373937_0597210 | 3300036401 | Bacteria | 1048 |
| 342 | Ga0373925_0000209 | 3300037068 | Bacteria | 64086 |
| 343 | Ga0373925_0072856 | 3300037068 | Bacteria | 2599 |
| 344 | Ga0395899_0027888 | 3300037312 | Bacteria | 4253 |
| 345 | Ga0395899_0101588 | 3300037312 | Bacteria | 2075 |
| 346 | Ga0395899_0331687 | 3300037312 | Bacteria | 1022 |
| 347 | Ga0395900_0018770 | 3300037418 | Bacteria | 7052 |
| 348 | Ga0395900_0123260 | 3300037418 | Bacteria | 2658 |
| 349 | Ga0395898_0020960 | 3300037466 | Bacteria | 6632 |
| 350 | Ga0395905_0674269 | 3300037471 | Bacteria | 936 |
| 351 | Ga0395905_1402245 | 3300037471 | Bacteria | 603 |
| 352 | Ga0395901_0003268 | 3300038443 | Bacteria | 16314 |
| 353 | Ga0395901_0025165 | 3300038443 | Bacteria | 6110 |
| 354 | Ga0400483_051524 | 3300039062 | Bacteria | 48782 |
| 355 | Ga0400483_191709 | 3300039062 | Bacteria | 8235 |
| 356 | Ga0400483_292171 | 3300039062 | Bacteria | 65188 |
| 357 | Ga0436365_1045950 | 3300039437 | Bacteria | 1703 |
| 358 | Ga0436360_1158525 | 3300039438 | Bacteria | 6652 |
| 359 | Ga0436361_0264740 | 3300039447 | Bacteria | 3590 |
| 360 | Ga0436361_0713206 | 3300039447 | Bacteria | 50586 |
| 361 | Ga0436362_0322257 | 3300039453 | Bacteria | 1397 |
| 362 | Ga0436362_0969158 | 3300039453 | Bacteria | 1235 |
| 363 | Ga0451793_0054054 | 3300041452 | Bacteria | 819 |
| 364 | Ga0451837_0323595 | 3300041494 | Bacteria | 708 |
| 365 | Ga0466965_0027461 | 3300044683 | Bacteria | 2764 |
| 366 | Ga0466957_0087234 | 3300044842 | Bacteria | 1951 |
| 367 | Ga0495627_001129 | 3300046453 | Bacteria | 17294 |
| 368 | Ga0495638_0000283 | 3300046460 | Bacteria | 67742 |
| 369 | Ga0495638_0000402 | 3300046460 | Bacteria | 52910 |
| 370 | Ga0495638_0063422 | 3300046460 | Bacteria | 2278 |
| 371 | Ga0495650_0020126 | 3300046471 | Bacteria | 3262 |
| 372 | Ga0495650_0052121 | 3300046471 | Bacteria | 1681 |
| 373 | Ga0495664_0052829 | 3300046477 | Bacteria | 2416 |
| 374 | Ga0495607_0065814 | 3300046501 | Bacteria | 2042 |
| 375 | Ga0495583_0015556 | 3300046506 | Bacteria | 4133 |
| 376 | Ga0495606_0123365 | 3300046507 | Bacteria | 1548 |
| 377 | Ga0495606_0213940 | 3300046507 | Bacteria | 1090 |
| 378 | Ga0495610_0001080 | 3300046512 | Bacteria | 24952 |
| 379 | Ga0495610_0009812 | 3300046512 | Bacteria | 6008 |
| 380 | Ga0495616_0001277 | 3300046513 | Bacteria | 17673 |
| 381 | Ga0495616_0014302 | 3300046513 | Bacteria | 4446 |
| 382 | Ga0495628_0170453 | 3300046516 | Bacteria | 1651 |
| 383 | Ga0495632_0040673 | 3300046519 | Bacteria | 2340 |
| 384 | Ga0495637_0016533 | 3300046520 | Bacteria | 3448 |
| 385 | Ga0495643_0075995 | 3300046522 | Bacteria | 1757 |
| 386 | Ga0495648_0000107 | 3300046524 | Bacteria | 104376 |
| 387 | Ga0495648_0128901 | 3300046524 | Bacteria | 1348 |
| 388 | Ga0495663_0010031 | 3300046525 | Bacteria | 2629 |
| 389 | Ga0495642_0047425 | 3300046528 | Bacteria | 1760 |
| 390 | Ga0495642_0065568 | 3300046528 | Bacteria | 1512 |
| 391 | Ga0495652_0041492 | 3300046529 | Bacteria | 3972 |
| 392 | Ga0495654_0000085 | 3300046530 | Bacteria | 107010 |
| 393 | Ga0495654_0011867 | 3300046530 | Bacteria | 4700 |
| 394 | Ga0495609_0019546 | 3300046538 | Bacteria | 3133 |
| 395 | Ga0495621_0016449 | 3300046539 | Bacteria | 2375 |
| 396 | Ga0495597_0019658 | 3300046542 | Bacteria | 3157 |
| 397 | Ga0495645_0057285 | 3300046543 | Bacteria | 2829 |
| 398 | Ga0495645_0091145 | 3300046543 | Bacteria | 2177 |
| 399 | Ga0495622_0003645 | 3300046557 | Bacteria | 7228 |
| 400 | Ga0495668_0003283 | 3300046616 | Bacteria | 12284 |
| 401 | Ga0495668_0004662 | 3300046616 | Bacteria | 9624 |
| 402 | Ga0495668_0056179 | 3300046616 | Bacteria | 2173 |
| 403 | Ga0495668_0121010 | 3300046616 | Bacteria | 1432 |
| 404 | Ga0495668_0128845 | 3300046616 | Bacteria | 1385 |
| 405 | Ga0495611_0026073 | 3300046648 | Bacteria | 2550 |
| 406 | Ga0495625_0000094 | 3300046660 | Bacteria | 144517 |
| 407 | Ga0495625_0004558 | 3300046660 | Bacteria | 13033 |
| 408 | Ga0495625_0005125 | 3300046660 | Bacteria | 12110 |
| 409 | Ga0495625_0043451 | 3300046660 | Bacteria | 3258 |
| 410 | Ga0495669_0000007 | 3300046684 | Bacteria | 180797 |
| 411 | Ga0495669_0000548 | 3300046684 | Bacteria | 16774 |
| 412 | Ga0495669_0039434 | 3300046684 | Bacteria | 2092 |
| 413 | Ga0495670_0043271 | 3300046691 | Bacteria | 2247 |
| 414 | Ga0495671_0104953 | 3300046692 | Bacteria | 1380 |
| 415 | Ga0495671_0121032 | 3300046692 | Bacteria | 1277 |
| 416 | Ga0495671_0129725 | 3300046692 | Bacteria | 1229 |
| 417 | Ga0495649_0119151 | 3300046694 | Unclassified | 1396 |
| 418 | Ga0495660_0221685 | 3300046810 | Bacteria | 891 |
| 419 | Ga0495672_0001097 | 3300047320 | Bacteria | 27486 |
| 420 | Ga0495672_0010571 | 3300047320 | Bacteria | 6565 |
| 421 | Ga0495677_0051314 | 3300047445 | Bacteria | 1519 |
| 422 | Ga0495685_084547 | 3300047447 | Bacteria | 1055 |
| 423 | Ga0495673_0000341 | 3300047469 | Bacteria | 59080 |
| 424 | Ga0495673_0004118 | 3300047469 | Bacteria | 9214 |
| 425 | Ga0495673_0005953 | 3300047469 | Bacteria | 7264 |
| 426 | Ga0495681_0070282 | 3300047470 | Bacteria | 1588 |
| 427 | Ga0495686_0001488 | 3300047472 | Bacteria | 25389 |
| 428 | Ga0495686_0016399 | 3300047472 | Bacteria | 5024 |
| 429 | Ga0495686_0019971 | 3300047472 | Bacteria | 4471 |
| 430 | Ga0495686_0020535 | 3300047472 | Bacteria | 4402 |
| 431 | Ga0495686_0107263 | 3300047472 | Bacteria | 1678 |
| 432 | Ga0495686_0133047 | 3300047472 | Bacteria | 1473 |
| 433 | Ga0495626_0106649 | 3300048091 | Bacteria | 1217 |
| 434 | Ga0496100_0352809 | 3300048903 | Bacteria | 1111 |
| 435 | Ga0496101_0040526 | 3300048904 | Bacteria | 3317 |
| 436 | Ga0496102_0009500 | 3300048905 | Bacteria | 8362 |
| 437 | Ga0496102_0055568 | 3300048905 | Bacteria | 3610 |
| 438 | Ga0496102_0549056 | 3300048905 | Bacteria | 1078 |
| 439 | Ga0496102_0603393 | 3300048905 | Bacteria | 1021 |
| 440 | Ga0496103_0073496 | 3300048906 | Bacteria | 2142 |
| 441 | Ga0496105_0252394 | 3300048908 | Bacteria | 1429 |
| 442 | Ga0496106_0015315 | 3300048909 | Bacteria | 5674 |
| 443 | Ga0496106_0490437 | 3300048909 | Bacteria | 987 |
| 444 | Ga0496107_0000085 | 3300048910 | Bacteria | 44306 |
| 445 | Ga0496109_0072137 | 3300048912 | Bacteria | 3171 |
| 446 | Ga0496110_0287157 | 3300048913 | Bacteria | 1498 |
| 447 | Ga0496112_0035271 | 3300048915 | Bacteria | 4871 |
| 448 | Ga0496112_0178251 | 3300048915 | Bacteria | 2089 |
| 449 | Ga0496113_0091473 | 3300048916 | Bacteria | 2345 |
| 450 | Ga0496113_0498165 | 3300048916 | Bacteria | 978 |
| 451 | Ga0496115_0000460 | 3300048918 | Bacteria | 32584 |
| 452 | Ga0496115_0001891 | 3300048918 | Bacteria | 14988 |
| 453 | Ga0496115_0004365 | 3300048918 | Bacteria | 10236 |
| 454 | Ga0496115_0035271 | 3300048918 | Bacteria | 3957 |
| 455 | Ga0496115_0118132 | 3300048918 | Bacteria | 2181 |
| 456 | Ga0496115_0164218 | 3300048918 | Bacteria | 1836 |
| 457 | Ga0496115_0556584 | 3300048918 | Bacteria | 916 |
| 458 | Ga0496117_0024048 | 3300048920 | Bacteria | 4832 |
| 459 | Ga0496117_0147720 | 3300048920 | Bacteria | 1396 |
| 460 | Ga0496118_0012069 | 3300048921 | Bacteria | 8340 |
| 461 | Ga0496119_0033642 | 3300048922 | Bacteria | 3394 |
| 462 | Ga0496121_0001169 | 3300048924 | Bacteria | 46049 |
| 463 | Ga0496121_0002347 | 3300048924 | Bacteria | 29197 |
| 464 | Ga0496121_0002899 | 3300048924 | Bacteria | 25178 |
| 465 | Ga0496121_0330283 | 3300048924 | Bacteria | 1023 |
| 466 | Ga0496124_0009364 | 3300048927 | Bacteria | 10093 |
| 467 | Ga0496126_0021909 | 3300048929 | Bacteria | 6232 |
| 468 | Ga0496126_0023104 | 3300048929 | Bacteria | 6029 |
| 469 | Ga0495682_0005183 | 3300049460 | Bacteria | 5448 |
| 470 | Ga0501031_0129082 | 3300049568 | Bacteria | 1651 |
| 471 | Ga0501032_0002943 | 3300049569 | Bacteria | 13244 |
| 472 | Ga0501032_0214904 | 3300049569 | Bacteria | 1252 |
| 473 | Ga0501033_0049119 | 3300049570 | Bacteria | 3132 |
| 474 | Ga0501034_0003075 | 3300049571 | Bacteria | 19246 |
| 475 | Ga0501034_0015064 | 3300049571 | Bacteria | 7949 |
| 476 | Ga0501034_0035945 | 3300049571 | Bacteria | 5022 |
| 477 | Ga0501034_0044338 | 3300049571 | Bacteria | 4499 |
| 478 | Ga0501034_0050687 | 3300049571 | Bacteria | 4186 |
| 479 | Ga0501034_0111394 | 3300049571 | Bacteria | 2727 |
| 480 | Ga0501034_0163202 | 3300049571 | Bacteria | 2198 |
| 481 | Ga0501034_0182488 | 3300049571 | Bacteria | 2063 |
| 482 | Ga0501034_0305931 | 3300049571 | Bacteria | 1525 |
| 483 | Ga0501036_0313510 | 3300049572 | Bacteria | 1311 |
| 484 | Ga0501036_0454722 | 3300049572 | Bacteria | 1067 |
| 485 | Ga0501037_0038198 | 3300049573 | Bacteria | 3538 |
| 486 | Ga0501037_0077995 | 3300049573 | Bacteria | 2404 |
| 487 | Ga0501038_0006869 | 3300049574 | Bacteria | 10512 |
| 488 | Ga0501038_0045822 | 3300049574 | Bacteria | 3794 |
| 489 | Ga0501038_0297642 | 3300049574 | Bacteria | 1267 |
| 490 | Ga0501038_0414885 | 3300049574 | Bacteria | 1040 |
| 491 | Ga0501039_0096681 | 3300049575 | Bacteria | 2302 |
| 492 | Ga0501039_0861865 | 3300049575 | Bacteria | 706 |
| 493 | Ga0501043_0021727 | 3300049579 | Bacteria | 5031 |
| 494 | Ga0501043_0022014 | 3300049579 | Bacteria | 5000 |
| 495 | Ga0501043_0113950 | 3300049579 | Bacteria | 2123 |
| 496 | Ga0501043_0216567 | 3300049579 | Bacteria | 1483 |
| 497 | Ga0501046_0225343 | 3300049580 | Bacteria | 1387 |
| 498 | Ga0501046_0586401 | 3300049580 | Bacteria | 792 |
| 499 | Ga0501047_0002245 | 3300049581 | Bacteria | 18488 |
| 500 | Ga0501047_0008627 | 3300049581 | Bacteria | 9626 |
| 501 | Ga0501047_0039366 | 3300049581 | Bacteria | 4573 |
| 502 | Ga0501047_0065286 | 3300049581 | Bacteria | 3509 |
| 503 | Ga0501047_0103394 | 3300049581 | Bacteria | 2729 |
| 504 | Ga0501047_0294001 | 3300049581 | Bacteria | 1468 |
| 505 | Ga0501048_0697761 | 3300049582 | Bacteria | 729 |
| 506 | Ga0501067_0000151 | 3300049583 | Bacteria | 38386 |
| 507 | Ga0501068_0004552 | 3300049584 | Bacteria | 7543 |
| 508 | Ga0501070_0288105 | 3300049586 | Bacteria | 1339 |
| 509 | Ga0501072_0255156 | 3300049588 | Bacteria | 1396 |
| 510 | Ga0501073_0000002 | 3300049589 | Bacteria | 323865 |
| 511 | Ga0501077_0000002 | 3300049593 | Bacteria | 159855 |
| 512 | Ga0501223_000016 | 3300049663 | Bacteria | 68443 |
| 513 | Ga0501225_0000013 | 3300049705 | Bacteria | 71839 |
| 514 | Ga0501079_0122464 | 3300049741 | Bacteria | 2023 |
| 515 | Ga0501080_0007490 | 3300049742 | Bacteria | 9856 |
| 516 | Ga0501080_0008841 | 3300049742 | Bacteria | 9157 |
| 517 | Ga0501080_0150946 | 3300049742 | Bacteria | 2147 |
| 518 | Ga0501080_0417665 | 3300049742 | Bacteria | 1205 |
| 519 | Ga0501035_0098701 | 3300049822 | Bacteria | 2564 |
| 520 | Ga0501035_0177734 | 3300049822 | Bacteria | 1835 |
| 521 | Ga0501044_0002054 | 3300049823 | Bacteria | 23229 |
| 522 | Ga0501044_0011991 | 3300049823 | Bacteria | 9391 |
| 523 | Ga0501044_0142097 | 3300049823 | Bacteria | 2388 |
| 524 | Ga0501044_0572839 | 3300049823 | Bacteria | 1024 |
| 525 | Ga0501045_0317586 | 3300049824 | Bacteria | 1159 |
| 526 | nmdc:mga03683_677_c1 | 3300050489 | Bacteria | 9814 |
| 527 | nmdc:mga03683_81581_c1 | 3300050489 | Bacteria | 1397 |
| 528 | nmdc:mga03683_94934_c2 | 3300050489 | Bacteria | 1104 |
| 529 | nmdc:mga03n38_501027_c1 | 3300050490 | Bacteria | 681 |
| 530 | nmdc:mga00v17_205339_c2 | 3300050491 | Bacteria | 953 |
| 531 | nmdc:mga0yw44_146900_c1 | 3300050492 | Bacteria | 1536 |
| 532 | nmdc:mga0yw44_50534_c1 | 3300050492 | Bacteria | 2514 |
| 533 | nmdc:mga0yw44_6639_c1 | 3300050492 | Bacteria | 5609 |
| 534 | nmdc:mga0k408_60678_c1 | 3300050493 | Bacteria | 2198 |
| 535 | nmdc:mga06z11_12916_c1 | 3300050494 | Bacteria | 3647 |
| 536 | nmdc:mga06z11_302940_c1 | 3300050494 | Bacteria | 950 |
| 537 | nmdc:mga07m45_29809_c1 | 3300050496 | Bacteria | 3020 |
| 538 | nmdc:mga07m45_49578_c1 | 3300050496 | Bacteria | 2363 |
| 539 | nmdc:mga0sz30_157021_c1 | 3300050516 | Bacteria | 1007 |
| 540 | nmdc:mga0sz30_365228_c1 | 3300050516 | Bacteria | 646 |
| 541 | nmdc:mga0sz30_51994_c1 | 3300050516 | Bacteria | 733 |
| 542 | Ga0500635_0077720 | 3300053080 | Bacteria | 1187 |
| 543 | Ga0500578_0001569 | 3300053086 | Bacteria | 22315 |
| 544 | Ga0500644_0000124 | 3300053088 | Bacteria | 47262 |
| 545 | Ga0500644_0011700 | 3300053088 | Bacteria | 2406 |
| 546 | Ga0500647_0059977 | 3300053091 | Bacteria | 1830 |
| 547 | Ga0500641_0001391 | 3300053096 | Bacteria | 8622 |
| 548 | Ga0500641_0002845 | 3300053096 | Bacteria | 6134 |
| 549 | Ga0500641_0207998 | 3300053096 | Bacteria | 833 |
| 550 | Ga0500557_000037 | 3300053105 | Bacteria | 71114 |
| 551 | Ga0500595_013338 | 3300053119 | Bacteria | 3151 |
| 552 | Ga0500595_045822 | 3300053119 | Bacteria | 1379 |
| 553 | Ga0500597_187287 | 3300053120 | Bacteria | 875 |
| 554 | Ga0500608_109785 | 3300053122 | Bacteria | 1266 |
| 555 | Ga0500618_000159 | 3300053125 | Bacteria | 56114 |
| 556 | Ga0500642_0000062 | 3300053130 | Bacteria | 58970 |
| 557 | Ga0500642_0234454 | 3300053130 | Bacteria | 847 |
| 558 | Ga0500655_002616 | 3300053133 | Bacteria | 3265 |
| 559 | Ga0500658_0000535 | 3300053134 | Bacteria | 16034 |
| 560 | Ga0500658_0002725 | 3300053134 | Bacteria | 6792 |
| 561 | Ga0500658_0055148 | 3300053134 | Bacteria | 1635 |
| 562 | Ga0500559_0004938 | 3300053136 | Bacteria | 6202 |
| 563 | Ga0500564_000063 | 3300053138 | Bacteria | 28411 |
| 564 | Ga0500568_0008465 | 3300053139 | Bacteria | 4951 |
| 565 | Ga0500568_0087537 | 3300053139 | Bacteria | 1177 |
| 566 | Ga0500577_0016443 | 3300053142 | Bacteria | 2332 |
| 567 | Ga0500588_0017563 | 3300053146 | Bacteria | 1870 |
| 568 | Ga0500616_0001113 | 3300053153 | Bacteria | 27764 |
| 569 | Ga0500616_0005558 | 3300053153 | Bacteria | 8531 |
| 570 | Ga0500616_0028588 | 3300053153 | Bacteria | 3071 |
| 571 | Ga0500616_0040457 | 3300053153 | Bacteria | 2507 |
| 572 | Ga0500622_0000643 | 3300053156 | Bacteria | 31235 |
| 573 | Ga0500622_0051446 | 3300053156 | Bacteria | 2120 |
| 574 | Ga0500622_0137762 | 3300053156 | Bacteria | 1167 |
| 575 | Ga0500627_0024296 | 3300053158 | Bacteria | 2478 |
| 576 | Ga0500625_001277 | 3300053729 | Bacteria | 8427 |
| 577 | Ga0500645_020054 | 3300053730 | Bacteria | 2074 |
| 578 | Ga0500552_000050 | 3300053733 | Bacteria | 9891 |
| 579 | Ga0500601_004278 | 3300053737 | Bacteria | 1552 |
| 580 | Ga0501084_0656549 | 3300054114 | Bacteria | 885 |
| 581 | Ga0501082_0266158 | 3300060353 | Bacteria | 1492 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053120 | Ga0500597_187287 | Ga0500597_187287_290_850 | 162 |
| 2 | 3300049575 | Ga0501039_0861865 | Ga0501039_0861865_77_685 | 167 |
| 3 | 3300005618 | Ga0068864_100000145 | Ga0068864_10000014553 | 169 |
| 4 | 3300005842 | Ga0068858_100000268 | Ga0068858_1000002687 | 169 |
| 5 | 3300013306 | Ga0163162_10010851 | Ga0163162_100108517 | 169 |
| 6 | 3300025315 | Ga0207697_10003663 | Ga0207697_100036634 | 169 |
| 7 | 3300025941 | Ga0207711_10003775 | Ga0207711_100037759 | 169 |
| 8 | 3300026035 | Ga0207703_10000139 | Ga0207703_1000013935 | 169 |
| 9 | 3300026095 | Ga0207676_10000072 | Ga0207676_1000007281 | 169 |
| 10 | 3300048905 | Ga0496102_0603393 | Ga0496102_0603393_176_781 | 169 |
| 11 | 3300048920 | Ga0496117_0147720 | Ga0496117_0147720_818_1384 | 169 |
| 12 | 3300053091 | Ga0500647_0059977 | Ga0500647_0059977_610_1203 | 173 |
| 13 | 3300053105 | Ga0500557_000037 | Ga0500557_000037_58009_58602 | 173 |
| 14 | 3300053130 | Ga0500642_0000062 | Ga0500642_0000062_37480_38073 | 173 |
| 15 | 3300053139 | Ga0500568_0087537 | Ga0500568_0087537_625_1161 | 175 |
| 16 | 3300025907 | Ga0207645_10011653 | Ga0207645_100116533 | 179 |
| 17 | 3300025934 | Ga0207686_10093195 | Ga0207686_100931953 | 179 |
| 18 | 3300025936 | Ga0207670_10086377 | Ga0207670_100863772 | 179 |
| 19 | 3300026089 | Ga0207648_10015507 | Ga0207648_100155075 | 179 |
| 20 | 3300035112 | Ga0373932_0010219 | Ga0373932_0010219_726_1388 | 179 |
| 21 | 3300035170 | Ga0373943_0192908 | Ga0373943_0192908_18_680 | 179 |
| 22 | 3300035695 | Ga0373927_0118702 | Ga0373927_0118702_435_1097 | 179 |
| 23 | 3300035724 | Ga0373933_0120575 | Ga0373933_0120575_879_1541 | 179 |
| 24 | 3300036401 | Ga0373937_0355868 | Ga0373937_0355868_14_676 | 179 |
| 25 | 3300005436 | Ga0070713_100050973 | Ga0070713_1000509733 | 180 |
| 26 | 3300005841 | Ga0068863_100435322 | Ga0068863_1004353222 | 180 |
| 27 | 3300005843 | Ga0068860_100293462 | Ga0068860_1002934622 | 180 |
| 28 | 3300005937 | Ga0081455_10025838 | Ga0081455_100258384 | 180 |
| 29 | 3300025928 | Ga0207700_10049644 | Ga0207700_100496443 | 180 |
| 30 | 3300035692 | Ga0373935_0206502 | Ga0373935_0206502_266_928 | 180 |
| 31 | 3300037068 | Ga0373925_0072856 | Ga0373925_0072856_1728_2390 | 180 |
| 32 | 3300028573 | Ga0265334_10019555 | Ga0265334_100195553 | 181 |
| 33 | 3300031247 | Ga0265340_10038743 | Ga0265340_100387433 | 181 |
| 34 | 3300049742 | Ga0501080_0417665 | Ga0501080_0417665_33_599 | 181 |
| 35 | 3300054114 | Ga0501084_0656549 | Ga0501084_0656549_17_583 | 181 |
| 36 | 3300037471 | Ga0395905_1402245 | Ga0395905_1402245_11_577 | 183 |
| 37 | 3300044842 | Ga0466957_0087234 | Ga0466957_0087234_1309_1938 | 183 |
| 38 | 3300046507 | Ga0495606_0123365 | Ga0495606_0123365_563_1114 | 183 |
| 39 | 3300049581 | Ga0501047_0065286 | Ga0501047_0065286_2869_3495 | 183 |
| 40 | 3300050490 | nmdc:mga03n38_501027_c1 | nmdc:mga03n38_501027_c1_17_646 | 183 |
| 41 | 3300053119 | Ga0500595_045822 | Ga0500595_045822_13_603 | 183 |
| 42 | iso_pu_bacteria | 8016557553 | 8016557688 | 183 |
| 43 | 3300021361 | Ga0213872_10001875 | Ga0213872_1000187510 | 187 |
| 44 | 3300039447 | Ga0436361_0713206 | Ga0436361_0713206_4410_5003 | 187 |
| 45 | 3300048920 | Ga0496117_0024048 | Ga0496117_0024048_882_1523 | 187 |
| 46 | 3300048921 | Ga0496118_0012069 | Ga0496118_0012069_2756_3397 | 187 |
| 47 | 3300005328 | Ga0070676_10079147 | Ga0070676_100791472 | 188 |
| 48 | 3300005334 | Ga0068869_100226785 | Ga0068869_1002267852 | 188 |
| 49 | 3300005338 | Ga0068868_100052577 | Ga0068868_1000525772 | 188 |
| 50 | 3300005340 | Ga0070689_100110657 | Ga0070689_1001106573 | 188 |
| 51 | 3300005364 | Ga0070673_100022431 | Ga0070673_1000224311 | 188 |
| 52 | 3300005459 | Ga0068867_100006768 | Ga0068867_1000067684 | 188 |
| 53 | 3300005617 | Ga0068859_100315980 | Ga0068859_1003159803 | 188 |
| 54 | 3300005840 | Ga0068870_10289216 | Ga0068870_102892162 | 188 |
| 55 | 3300006931 | Ga0097620_100315967 | Ga0097620_1003159671 | 188 |
| 56 | 3300009098 | Ga0105245_10816277 | Ga0105245_108162771 | 188 |
| 57 | 3300009148 | Ga0105243_10004582 | Ga0105243_100045827 | 188 |
| 58 | 3300009148 | Ga0105243_10038746 | Ga0105243_100387465 | 188 |
| 59 | 3300009176 | Ga0105242_10032335 | Ga0105242_100323355 | 188 |
| 60 | 3300010375 | Ga0105239_10857585 | Ga0105239_108575852 | 188 |
| 61 | 3300025899 | Ga0207642_10099987 | Ga0207642_100999872 | 188 |
| 62 | 3300025908 | Ga0207643_10134643 | Ga0207643_101346432 | 188 |
| 63 | 3300025927 | Ga0207687_10566003 | Ga0207687_105660031 | 188 |
| 64 | 3300025942 | Ga0207689_10076936 | Ga0207689_100769362 | 188 |
| 65 | 3300025960 | Ga0207651_10022119 | Ga0207651_100221195 | 188 |
| 66 | 3300026023 | Ga0207677_10315556 | Ga0207677_103155561 | 188 |
| 67 | 3300053153 | Ga0500616_0001113 | Ga0500616_0001113_24701_25363 | 188 |
| 68 | 3300005578 | Ga0068854_101139563 | Ga0068854_1011395631 | 190 |
| 69 | 3300053729 | Ga0500625_001277 | Ga0500625_001277_431_1024 | 190 |
| 70 | iso_pu_bacteria | 2510917020 | 2511124978 | 190 |
| 71 | iso_pu_bacteria | 2643221545 | 2643747599 | 190 |
| 72 | iso_pu_bacteria | 2643221552 | 2643781784 | 190 |
| 73 | iso_pu_bacteria | 2643221583 | 2643922349 | 190 |
| 74 | iso_pu_bacteria | 2643221584 | 2643931972 | 190 |
| 75 | iso_pu_bacteria | 2643221614 | 2644087620 | 190 |
| 76 | iso_pu_bacteria | 2643221661 | 2644344336 | 190 |
| 77 | iso_pu_bacteria | 2643221666 | 2644366979 | 190 |
| 78 | iso_pu_bacteria | 2643221691 | 2644507019 | 190 |
| 79 | iso_pu_bacteria | 2885429604 | 2885432360 | 190 |
| 80 | iso_pu_bacteria | 2935769743 | 2935773053 | 190 |
| 81 | iso_pu_bacteria | 2935777560 | 2935782996 | 190 |
| 82 | iso_pu_bacteria | 2935785616 | 2935787958 | 190 |
| 83 | iso_pu_bacteria | 2935793552 | 2935796466 | 190 |
| 84 | iso_pu_bacteria | 8016522445 | 8016526128 | 190 |
| 85 | iso_pu_bacteria | 8016530956 | 8016539740 | 190 |
| 86 | iso_pu_bacteria | 8016539877 | 8016544044 | 190 |
| 87 | iso_pu_bacteria | 8016566248 | 8016569448 | 190 |
| 88 | iso_pu_bacteria | 8016575299 | 8016582062 | 190 |
| 89 | iso_pu_bacteria | 8016595262 | 8016595721 | 190 |
| 90 | iso_pu_bacteria | 8016603502 | 8016606577 | 190 |
| 91 | iso_pu_bacteria | 8016613128 | 8016618478 | 190 |
| 92 | iso_pu_bacteria | 8016622563 | 8016623170 | 190 |
| 93 | iso_pu_bacteria | 8019530166 | 8019531016 | 190 |
| 94 | iso_pu_bacteria | 8019538911 | 8019540566 | 190 |
| 95 | iso_pu_bacteria | 8019547302 | 8019550186 | 190 |
| 96 | iso_pu_bacteria | 8057101203 | 8057105371 | 190 |
| 97 | 3300005289 | Ga0065704_10095571 | Ga0065704_100955713 | 191 |
| 98 | 3300005353 | Ga0070669_100013132 | Ga0070669_1000131325 | 191 |
| 99 | 3300009147 | Ga0114129_10158182 | Ga0114129_101581823 | 191 |
| 100 | 3300009978 | Ga0105148_100032 | Ga0105148_10003217 | 191 |
| 101 | 3300009982 | Ga0105147_101839 | Ga0105147_1018392 | 191 |
| 102 | 3300014326 | Ga0157380_10106285 | Ga0157380_101062851 | 191 |
| 103 | 3300025923 | Ga0207681_10010984 | Ga0207681_100109844 | 191 |
| 104 | 3300049663 | Ga0501223_000016 | Ga0501223_000016_9767_10360 | 191 |
| 105 | 3300049705 | Ga0501225_0000013 | Ga0501225_0000013_9793_10386 | 191 |
| 106 | 3300005344 | Ga0070661_100101670 | Ga0070661_1001016702 | 192 |
| 107 | 3300005434 | Ga0070709_10875616 | Ga0070709_108756161 | 192 |
| 108 | 3300005435 | Ga0070714_100088018 | Ga0070714_1000880183 | 192 |
| 109 | 3300005436 | Ga0070713_100026964 | Ga0070713_1000269644 | 192 |
| 110 | 3300005445 | Ga0070708_100075119 | Ga0070708_1000751194 | 192 |
| 111 | 3300005458 | Ga0070681_11096181 | Ga0070681_110961811 | 192 |
| 112 | 3300005563 | Ga0068855_100000106 | Ga0068855_10000010615 | 192 |
| 113 | 3300005616 | Ga0068852_100087292 | Ga0068852_1000872922 | 192 |
| 114 | 3300006028 | Ga0070717_11097182 | Ga0070717_110971821 | 192 |
| 115 | 3300006175 | Ga0070712_100233774 | Ga0070712_1002337742 | 192 |
| 116 | 3300007788 | Ga0099795_10008993 | Ga0099795_100089933 | 192 |
| 117 | 3300009093 | Ga0105240_10000653 | Ga0105240_1000065324 | 192 |
| 118 | 3300009174 | Ga0105241_10372821 | Ga0105241_103728212 | 192 |
| 119 | 3300009551 | Ga0105238_10024421 | Ga0105238_100244215 | 192 |
| 120 | 3300010375 | Ga0105239_10001093 | Ga0105239_1000109311 | 192 |
| 121 | 3300010375 | Ga0105239_10010429 | Ga0105239_100104295 | 192 |
| 122 | 3300013105 | Ga0157369_10001360 | Ga0157369_1000136029 | 192 |
| 123 | 3300013105 | Ga0157369_10022866 | Ga0157369_100228665 | 192 |
| 124 | 3300013297 | Ga0157378_10058417 | Ga0157378_100584174 | 192 |
| 125 | 3300013307 | Ga0157372_10441289 | Ga0157372_104412892 | 192 |
| 126 | 3300025905 | Ga0207685_10095357 | Ga0207685_100953572 | 192 |
| 127 | 3300025906 | Ga0207699_10181880 | Ga0207699_101818803 | 192 |
| 128 | 3300025911 | Ga0207654_10059863 | Ga0207654_100598633 | 192 |
| 129 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012379 | 192 |
| 130 | 3300025914 | Ga0207671_10075442 | Ga0207671_100754423 | 192 |
| 131 | 3300025920 | Ga0207649_10039885 | Ga0207649_100398852 | 192 |
| 132 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006286 | 192 |
| 133 | 3300025928 | Ga0207700_10073302 | Ga0207700_100733024 | 192 |
| 134 | 3300025929 | Ga0207664_10019693 | Ga0207664_100196933 | 192 |
| 135 | 3300025949 | Ga0207667_10000232 | Ga0207667_1000023270 | 192 |
| 136 | 3300026041 | Ga0207639_10032885 | Ga0207639_100328854 | 192 |
| 137 | 3300026142 | Ga0207698_10570779 | Ga0207698_105707792 | 192 |
| 138 | 3300027512 | Ga0209179_1001197 | Ga0209179_10011973 | 192 |
| 139 | 3300031730 | Ga0307516_10008284 | Ga0307516_100082849 | 192 |
| 140 | 3300035113 | Ga0373936_0036750 | Ga0373936_0036750_360_959 | 192 |
| 141 | 3300035724 | Ga0373933_0584888 | Ga0373933_0584888_112_711 | 192 |
| 142 | 3300046477 | Ga0495664_0052829 | Ga0495664_0052829_1381_1986 | 192 |
| 143 | 3300046529 | Ga0495652_0041492 | Ga0495652_0041492_1438_2043 | 192 |
| 144 | 3300046543 | Ga0495645_0057285 | Ga0495645_0057285_328_933 | 192 |
| 145 | 3300048903 | Ga0496100_0352809 | Ga0496100_0352809_495_1094 | 192 |
| 146 | 3300048905 | Ga0496102_0055568 | Ga0496102_0055568_346_1002 | 192 |
| 147 | 3300048918 | Ga0496115_0035271 | Ga0496115_0035271_2169_2768 | 192 |
| 148 | 3300048918 | Ga0496115_0164218 | Ga0496115_0164218_961_1617 | 192 |
| 149 | 3300048922 | Ga0496119_0033642 | Ga0496119_0033642_1679_2278 | 192 |
| 150 | 3300049460 | Ga0495682_0005183 | Ga0495682_0005183_1197_1802 | 192 |
| 151 | 3300049568 | Ga0501031_0129082 | Ga0501031_0129082_43_642 | 192 |
| 152 | 3300049569 | Ga0501032_0214904 | Ga0501032_0214904_42_641 | 192 |
| 153 | 3300049571 | Ga0501034_0044338 | Ga0501034_0044338_3278_3877 | 192 |
| 154 | 3300049571 | Ga0501034_0111394 | Ga0501034_0111394_1517_2116 | 192 |
| 155 | 3300049571 | Ga0501034_0182488 | Ga0501034_0182488_290_889 | 192 |
| 156 | 3300049572 | Ga0501036_0313510 | Ga0501036_0313510_126_725 | 192 |
| 157 | 3300049573 | Ga0501037_0038198 | Ga0501037_0038198_1445_2044 | 192 |
| 158 | 3300049574 | Ga0501038_0006869 | Ga0501038_0006869_2080_2679 | 192 |
| 159 | 3300049574 | Ga0501038_0045822 | Ga0501038_0045822_2218_2817 | 192 |
| 160 | 3300049575 | Ga0501039_0096681 | Ga0501039_0096681_371_970 | 192 |
| 161 | 3300049579 | Ga0501043_0022014 | Ga0501043_0022014_1276_1875 | 192 |
| 162 | 3300049581 | Ga0501047_0039366 | Ga0501047_0039366_1484_2083 | 192 |
| 163 | 3300049586 | Ga0501070_0288105 | Ga0501070_0288105_458_1057 | 192 |
| 164 | 3300049588 | Ga0501072_0255156 | Ga0501072_0255156_115_714 | 192 |
| 165 | 3300049822 | Ga0501035_0177734 | Ga0501035_0177734_351_950 | 192 |
| 166 | 3300049823 | Ga0501044_0011991 | Ga0501044_0011991_1446_2045 | 192 |
| 167 | 3300053133 | Ga0500655_002616 | Ga0500655_002616_1675_2280 | 192 |
| 168 | iso_pu_bacteria | 2844315083 | 2844315327 | 192 |
| 169 | iso_pu_bacteria | 2903727486 | 2903732188 | 192 |
| 170 | iso_pu_bacteria | 2906602504 | 2906604265 | 192 |
| 171 | iso_pu_bacteria | 8016583857 | 8016586388 | 192 |
| 172 | iso_pu_bacteria | 8056967851 | 8056971279 | 192 |
| 173 | 3300005985 | Ga0081539_10004087 | Ga0081539_1000408713 | 193 |
| 174 | 3300009093 | Ga0105240_10279200 | Ga0105240_102792002 | 193 |
| 175 | 3300013307 | Ga0157372_10090362 | Ga0157372_100903623 | 193 |
| 176 | 3300031901 | Ga0307406_10873694 | Ga0307406_108736941 | 193 |
| 177 | 3300046507 | Ga0495606_0213940 | Ga0495606_0213940_92_679 | 193 |
| 178 | 3300003214 | JGI25165J46597_1000010 | JGI25165J46597_100001087 | 194 |
| 179 | 3300003790 | Ga0055528_1006962 | Ga0055528_10069623 | 194 |
| 180 | 3300003791 | Ga0055530_10000313 | Ga0055530_100003132 | 194 |
| 181 | 3300003791 | Ga0055530_10002661 | Ga0055530_100026617 | 194 |
| 182 | 3300003791 | Ga0055530_10011004 | Ga0055530_100110044 | 194 |
| 183 | 3300003794 | Ga0055531_10002220 | Ga0055531_100022209 | 194 |
| 184 | 3300003794 | Ga0055531_10002388 | Ga0055531_100023883 | 194 |
| 185 | 3300004625 | Ga0055543_1033061 | Ga0055543_10330611 | 194 |
| 186 | 3300005262 | Ga0065165_1004438 | Ga0065165_10044388 | 194 |
| 187 | 3300005262 | Ga0065165_1005530 | Ga0065165_10055308 | 194 |
| 188 | 3300005288 | Ga0065714_10070296 | Ga0065714_100702964 | 194 |
| 189 | 3300005327 | Ga0070658_10312691 | Ga0070658_103126912 | 194 |
| 190 | 3300005327 | Ga0070658_10704365 | Ga0070658_107043652 | 194 |
| 191 | 3300005329 | Ga0070683_100084538 | Ga0070683_1000845382 | 194 |
| 192 | 3300005330 | Ga0070690_100177317 | Ga0070690_1001773172 | 194 |
| 193 | 3300005331 | Ga0070670_100373687 | Ga0070670_1003736872 | 194 |
| 194 | 3300005336 | Ga0070680_100001568 | Ga0070680_10000156814 | 194 |
| 195 | 3300005339 | Ga0070660_100019186 | Ga0070660_1000191862 | 194 |
| 196 | 3300005339 | Ga0070660_100100854 | Ga0070660_1001008542 | 194 |
| 197 | 3300005339 | Ga0070660_100240389 | Ga0070660_1002403892 | 194 |
| 198 | 3300005340 | Ga0070689_100072602 | Ga0070689_1000726024 | 194 |
| 199 | 3300005347 | Ga0070668_100011541 | Ga0070668_1000115412 | 194 |
| 200 | 3300005353 | Ga0070669_100214729 | Ga0070669_1002147292 | 194 |
| 201 | 3300005353 | Ga0070669_100308543 | Ga0070669_1003085432 | 194 |
| 202 | 3300005353 | Ga0070669_100584435 | Ga0070669_1005844352 | 194 |
| 203 | 3300005355 | Ga0070671_100045879 | Ga0070671_1000458792 | 194 |
| 204 | 3300005355 | Ga0070671_100079556 | Ga0070671_1000795562 | 194 |
| 205 | 3300005355 | Ga0070671_100355050 | Ga0070671_1003550502 | 194 |
| 206 | 3300005365 | Ga0070688_100134573 | Ga0070688_1001345732 | 194 |
| 207 | 3300005366 | Ga0070659_100000552 | Ga0070659_10000055222 | 194 |
| 208 | 3300005366 | Ga0070659_100006406 | Ga0070659_1000064062 | 194 |
| 209 | 3300005437 | Ga0070710_10367711 | Ga0070710_103677112 | 194 |
| 210 | 3300005445 | Ga0070708_100112540 | Ga0070708_1001125404 | 194 |
| 211 | 3300005456 | Ga0070678_101132543 | Ga0070678_1011325431 | 194 |
| 212 | 3300005458 | Ga0070681_10006651 | Ga0070681_1000665112 | 194 |
| 213 | 3300005458 | Ga0070681_10082542 | Ga0070681_100825424 | 194 |
| 214 | 3300005467 | Ga0070706_100282305 | Ga0070706_1002823052 | 194 |
| 215 | 3300005468 | Ga0070707_100091862 | Ga0070707_1000918623 | 194 |
| 216 | 3300005471 | Ga0070698_100025801 | Ga0070698_1000258017 | 194 |
| 217 | 3300005471 | Ga0070698_100912634 | Ga0070698_1009126341 | 194 |
| 218 | 3300005530 | Ga0070679_100007418 | Ga0070679_10000741811 | 194 |
| 219 | 3300005530 | Ga0070679_100009290 | Ga0070679_1000092903 | 194 |
| 220 | 3300005535 | Ga0070684_100024078 | Ga0070684_1000240781 | 194 |
| 221 | 3300005539 | Ga0068853_100011535 | Ga0068853_1000115358 | 194 |
| 222 | 3300005539 | Ga0068853_100466573 | Ga0068853_1004665732 | 194 |
| 223 | 3300005546 | Ga0070696_100227093 | Ga0070696_1002270932 | 194 |
| 224 | 3300005548 | Ga0070665_100000721 | Ga0070665_10000072116 | 194 |
| 225 | 3300005548 | Ga0070665_100109205 | Ga0070665_1001092053 | 194 |
| 226 | 3300005548 | Ga0070665_100186845 | Ga0070665_1001868452 | 194 |
| 227 | 3300005563 | Ga0068855_100024646 | Ga0068855_1000246467 | 194 |
| 228 | 3300005563 | Ga0068855_100044020 | Ga0068855_1000440202 | 194 |
| 229 | 3300005563 | Ga0068855_100126544 | Ga0068855_1001265443 | 194 |
| 230 | 3300005563 | Ga0068855_100257990 | Ga0068855_1002579903 | 194 |
| 231 | 3300005563 | Ga0068855_100310443 | Ga0068855_1003104432 | 194 |
| 232 | 3300005563 | Ga0068855_100783661 | Ga0068855_1007836612 | 194 |
| 233 | 3300005563 | Ga0068855_100864294 | Ga0068855_1008642941 | 194 |
| 234 | 3300005564 | Ga0070664_100120880 | Ga0070664_1001208803 | 194 |
| 235 | 3300005577 | Ga0068857_100078940 | Ga0068857_1000789404 | 194 |
| 236 | 3300005577 | Ga0068857_100121908 | Ga0068857_1001219082 | 194 |
| 237 | 3300005578 | Ga0068854_100607081 | Ga0068854_1006070812 | 194 |
| 238 | 3300005614 | Ga0068856_100072284 | Ga0068856_1000722842 | 194 |
| 239 | 3300005614 | Ga0068856_100146970 | Ga0068856_1001469702 | 194 |
| 240 | 3300005617 | Ga0068859_100518643 | Ga0068859_1005186432 | 194 |
| 241 | 3300005618 | Ga0068864_100062794 | Ga0068864_1000627944 | 194 |
| 242 | 3300005618 | Ga0068864_100106924 | Ga0068864_1001069243 | 194 |
| 243 | 3300005618 | Ga0068864_100550283 | Ga0068864_1005502832 | 194 |
| 244 | 3300005841 | Ga0068863_100103825 | Ga0068863_1001038253 | 194 |
| 245 | 3300005841 | Ga0068863_100234406 | Ga0068863_1002344062 | 194 |
| 246 | 3300005842 | Ga0068858_100000370 | Ga0068858_1000003703 | 194 |
| 247 | 3300005842 | Ga0068858_100328887 | Ga0068858_1003288872 | 194 |
| 248 | 3300005937 | Ga0081455_10004620 | Ga0081455_1000462016 | 194 |
| 249 | 3300006048 | Ga0075363_100008814 | Ga0075363_1000088143 | 194 |
| 250 | 3300006048 | Ga0075363_100308207 | Ga0075363_1003082072 | 194 |
| 251 | 3300006051 | Ga0075364_10199401 | Ga0075364_101994012 | 194 |
| 252 | 3300006058 | Ga0075432_10103145 | Ga0075432_101031452 | 194 |
| 253 | 3300006177 | Ga0075362_10004771 | Ga0075362_100047712 | 194 |
| 254 | 3300006177 | Ga0075362_10081232 | Ga0075362_100812322 | 194 |
| 255 | 3300006177 | Ga0075362_10088078 | Ga0075362_100880782 | 194 |
| 256 | 3300006178 | Ga0075367_10051804 | Ga0075367_100518043 | 194 |
| 257 | 3300006186 | Ga0075369_10001444 | Ga0075369_100014445 | 194 |
| 258 | 3300006186 | Ga0075369_10109805 | Ga0075369_101098052 | 194 |
| 259 | 3300006186 | Ga0075369_10163993 | Ga0075369_101639931 | 194 |
| 260 | 3300006195 | Ga0075366_10018266 | Ga0075366_100182662 | 194 |
| 261 | 3300006358 | Ga0068871_100687960 | Ga0068871_1006879602 | 194 |
| 262 | 3300006881 | Ga0068865_100012939 | Ga0068865_1000129394 | 194 |
| 263 | 3300006931 | Ga0097620_100518625 | Ga0097620_1005186252 | 194 |
| 264 | 3300009093 | Ga0105240_10001036 | Ga0105240_1000103626 | 194 |
| 265 | 3300009093 | Ga0105240_10026858 | Ga0105240_1002685812 | 194 |
| 266 | 3300009093 | Ga0105240_10197974 | Ga0105240_101979743 | 194 |
| 267 | 3300009093 | Ga0105240_10279462 | Ga0105240_102794622 | 194 |
| 268 | 3300009093 | Ga0105240_10873512 | Ga0105240_108735121 | 194 |
| 269 | 3300009098 | Ga0105245_10074248 | Ga0105245_100742485 | 194 |
| 270 | 3300009098 | Ga0105245_10235411 | Ga0105245_102354112 | 194 |
| 271 | 3300009148 | Ga0105243_10133977 | Ga0105243_101339773 | 194 |
| 272 | 3300009176 | Ga0105242_10652101 | Ga0105242_106521012 | 194 |
| 273 | 3300009176 | Ga0105242_10653111 | Ga0105242_106531112 | 194 |
| 274 | 3300009177 | Ga0105248_10000650 | Ga0105248_1000065052 | 194 |
| 275 | 3300009177 | Ga0105248_10108725 | Ga0105248_101087254 | 194 |
| 276 | 3300009177 | Ga0105248_11026339 | Ga0105248_110263392 | 194 |
| 277 | 3300009545 | Ga0105237_10022290 | Ga0105237_100222908 | 194 |
| 278 | 3300009545 | Ga0105237_10567538 | Ga0105237_105675382 | 194 |
| 279 | 3300009551 | Ga0105238_10070858 | Ga0105238_100708584 | 194 |
| 280 | 3300009553 | Ga0105249_10503820 | Ga0105249_105038201 | 194 |
| 281 | 3300009988 | Ga0105035_103614 | Ga0105035_1036141 | 194 |
| 282 | 3300010375 | Ga0105239_10000319 | Ga0105239_1000031926 | 194 |
| 283 | 3300010375 | Ga0105239_11349662 | Ga0105239_113496622 | 194 |
| 284 | 3300013296 | Ga0157374_10464244 | Ga0157374_104642442 | 194 |
| 285 | 3300013297 | Ga0157378_10920047 | Ga0157378_109200472 | 194 |
| 286 | 3300013297 | Ga0157378_11276722 | Ga0157378_112767222 | 194 |
| 287 | 3300013306 | Ga0163162_10684485 | Ga0163162_106844852 | 194 |
| 288 | 3300014325 | Ga0163163_10050842 | Ga0163163_100508423 | 194 |
| 289 | 3300014969 | Ga0157376_10438578 | Ga0157376_104385782 | 194 |
| 290 | 3300014969 | Ga0157376_11278281 | Ga0157376_112782811 | 194 |
| 291 | 3300015690 | Ga0183363_1003 | Ga0183363_100383 | 194 |
| 292 | 3300020082 | Ga0206353_11944051 | Ga0206353_119440511 | 194 |
| 293 | 3300021358 | Ga0213873_10038716 | Ga0213873_100387162 | 194 |
| 294 | 3300025254 | Ga0209148_1013603 | Ga0209148_10136032 | 194 |
| 295 | 3300025261 | Ga0209233_1000044 | Ga0209233_1000044396 | 194 |
| 296 | 3300025263 | Ga0209565_1001350 | Ga0209565_10013508 | 194 |
| 297 | 3300025273 | Ga0209673_1000732 | Ga0209673_10007328 | 194 |
| 298 | 3300025273 | Ga0209673_1037096 | Ga0209673_10370962 | 194 |
| 299 | 3300025291 | Ga0209675_1008215 | Ga0209675_10082152 | 194 |
| 300 | 3300025292 | Ga0209676_1000257 | Ga0209676_10002578 | 194 |
| 301 | 3300025292 | Ga0209676_1000316 | Ga0209676_100031695 | 194 |
| 302 | 3300025295 | Ga0209564_1004512 | Ga0209564_10045123 | 194 |
| 303 | 3300025295 | Ga0209564_1033760 | Ga0209564_10337602 | 194 |
| 304 | 3300025297 | Ga0209758_1002581 | Ga0209758_10025814 | 194 |
| 305 | 3300025297 | Ga0209758_1002904 | Ga0209758_10029042 | 194 |
| 306 | 3300025297 | Ga0209758_1004448 | Ga0209758_10044487 | 194 |
| 307 | 3300025298 | Ga0209050_1000053 | Ga0209050_100005392 | 194 |
| 308 | 3300025298 | Ga0209050_1003986 | Ga0209050_10039867 | 194 |
| 309 | 3300025298 | Ga0209050_1012713 | Ga0209050_10127132 | 194 |
| 310 | 3300025299 | Ga0209256_1003727 | Ga0209256_10037274 | 194 |
| 311 | 3300025299 | Ga0209256_1004379 | Ga0209256_10043793 | 194 |
| 312 | 3300025299 | Ga0209256_1017316 | Ga0209256_10173163 | 194 |
| 313 | 3300025302 | Ga0207426_1068214 | Ga0207426_10682142 | 194 |
| 314 | 3300025303 | Ga0209051_1024329 | Ga0209051_10243292 | 194 |
| 315 | 3300025304 | Ga0209257_1000419 | Ga0209257_100041956 | 194 |
| 316 | 3300025304 | Ga0209257_1000624 | Ga0209257_10006248 | 194 |
| 317 | 3300025304 | Ga0209257_1004976 | Ga0209257_10049768 | 194 |
| 318 | 3300025304 | Ga0209257_1012949 | Ga0209257_10129492 | 194 |
| 319 | 3300025321 | Ga0207656_10167158 | Ga0207656_101671582 | 194 |
| 320 | 3300025909 | Ga0207705_10001218 | Ga0207705_1000121812 | 194 |
| 321 | 3300025909 | Ga0207705_10035160 | Ga0207705_100351603 | 194 |
| 322 | 3300025909 | Ga0207705_10181237 | Ga0207705_101812372 | 194 |
| 323 | 3300025912 | Ga0207707_10004282 | Ga0207707_100042828 | 194 |
| 324 | 3300025912 | Ga0207707_10027285 | Ga0207707_100272853 | 194 |
| 325 | 3300025912 | Ga0207707_10840626 | Ga0207707_108406261 | 194 |
| 326 | 3300025913 | Ga0207695_10000867 | Ga0207695_1000086731 | 194 |
| 327 | 3300025913 | Ga0207695_10134575 | Ga0207695_101345752 | 194 |
| 328 | 3300025913 | Ga0207695_10189443 | Ga0207695_101894432 | 194 |
| 329 | 3300025913 | Ga0207695_10299135 | Ga0207695_102991352 | 194 |
| 330 | 3300025913 | Ga0207695_10333651 | Ga0207695_103336512 | 194 |
| 331 | 3300025914 | Ga0207671_10000924 | Ga0207671_1000092432 | 194 |
| 332 | 3300025916 | Ga0207663_10451518 | Ga0207663_104515182 | 194 |
| 333 | 3300025917 | Ga0207660_10001115 | Ga0207660_1000111521 | 194 |
| 334 | 3300025917 | Ga0207660_10021743 | Ga0207660_100217433 | 194 |
| 335 | 3300025919 | Ga0207657_10000235 | Ga0207657_1000023540 | 194 |
| 336 | 3300025919 | Ga0207657_10136206 | Ga0207657_101362062 | 194 |
| 337 | 3300025919 | Ga0207657_10156761 | Ga0207657_101567612 | 194 |
| 338 | 3300025920 | Ga0207649_10042655 | Ga0207649_100426552 | 194 |
| 339 | 3300025921 | Ga0207652_10011897 | Ga0207652_100118975 | 194 |
| 340 | 3300025921 | Ga0207652_10097115 | Ga0207652_100971151 | 194 |
| 341 | 3300025922 | Ga0207646_10220796 | Ga0207646_102207961 | 194 |
| 342 | 3300025923 | Ga0207681_10298999 | Ga0207681_102989991 | 194 |
| 343 | 3300025923 | Ga0207681_10389112 | Ga0207681_103891122 | 194 |
| 344 | 3300025923 | Ga0207681_10693573 | Ga0207681_106935732 | 194 |
| 345 | 3300025924 | Ga0207694_10040482 | Ga0207694_100404824 | 194 |
| 346 | 3300025924 | Ga0207694_10252701 | Ga0207694_102527012 | 194 |
| 347 | 3300025926 | Ga0207659_10038717 | Ga0207659_100387172 | 194 |
| 348 | 3300025927 | Ga0207687_10023768 | Ga0207687_100237686 | 194 |
| 349 | 3300025931 | Ga0207644_10050854 | Ga0207644_100508542 | 194 |
| 350 | 3300025931 | Ga0207644_10057973 | Ga0207644_100579734 | 194 |
| 351 | 3300025932 | Ga0207690_10000031 | Ga0207690_10000031103 | 194 |
| 352 | 3300025932 | Ga0207690_10014019 | Ga0207690_100140195 | 194 |
| 353 | 3300025936 | Ga0207670_10425825 | Ga0207670_104258252 | 194 |
| 354 | 3300025938 | Ga0207704_10026283 | Ga0207704_100262834 | 194 |
| 355 | 3300025941 | Ga0207711_10019608 | Ga0207711_100196088 | 194 |
| 356 | 3300025941 | Ga0207711_10186618 | Ga0207711_101866182 | 194 |
| 357 | 3300025941 | Ga0207711_10324013 | Ga0207711_103240132 | 194 |
| 358 | 3300025944 | Ga0207661_10068810 | Ga0207661_100688102 | 194 |
| 359 | 3300025945 | Ga0207679_10037465 | Ga0207679_100374654 | 194 |
| 360 | 3300025945 | Ga0207679_10702340 | Ga0207679_107023402 | 194 |
| 361 | 3300025949 | Ga0207667_10020506 | Ga0207667_100205067 | 194 |
| 362 | 3300025949 | Ga0207667_10094923 | Ga0207667_100949234 | 194 |
| 363 | 3300025949 | Ga0207667_10174431 | Ga0207667_101744312 | 194 |
| 364 | 3300025972 | Ga0207668_10005922 | Ga0207668_100059229 | 194 |
| 365 | 3300026023 | Ga0207677_10044056 | Ga0207677_100440563 | 194 |
| 366 | 3300026023 | Ga0207677_10360875 | Ga0207677_103608752 | 194 |
| 367 | 3300026035 | Ga0207703_10018753 | Ga0207703_100187537 | 194 |
| 368 | 3300026035 | Ga0207703_10939435 | Ga0207703_109394351 | 194 |
| 369 | 3300026041 | Ga0207639_10003312 | Ga0207639_100033128 | 194 |
| 370 | 3300026075 | Ga0207708_10364087 | Ga0207708_103640872 | 194 |
| 371 | 3300026078 | Ga0207702_10025007 | Ga0207702_100250075 | 194 |
| 372 | 3300026078 | Ga0207702_10372379 | Ga0207702_103723792 | 194 |
| 373 | 3300026088 | Ga0207641_10083786 | Ga0207641_100837862 | 194 |
| 374 | 3300026088 | Ga0207641_10118764 | Ga0207641_101187642 | 194 |
| 375 | 3300026095 | Ga0207676_10002933 | Ga0207676_1000293310 | 194 |
| 376 | 3300026095 | Ga0207676_10047480 | Ga0207676_100474803 | 194 |
| 377 | 3300026095 | Ga0207676_10359021 | Ga0207676_103590212 | 194 |
| 378 | 3300026095 | Ga0207676_10502047 | Ga0207676_105020472 | 194 |
| 379 | 3300026116 | Ga0207674_10039095 | Ga0207674_100390956 | 194 |
| 380 | 3300026116 | Ga0207674_10197160 | Ga0207674_101971602 | 194 |
| 381 | 3300026116 | Ga0207674_10225711 | Ga0207674_102257112 | 194 |
| 382 | 3300026121 | Ga0207683_10043941 | Ga0207683_100439415 | 194 |
| 383 | 3300026121 | Ga0207683_10663012 | Ga0207683_106630122 | 194 |
| 384 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031436 | 194 |
| 385 | 3300028379 | Ga0268266_10169666 | Ga0268266_101696662 | 194 |
| 386 | 3300028379 | Ga0268266_10237597 | Ga0268266_102375972 | 194 |
| 387 | 3300028379 | Ga0268266_10562428 | Ga0268266_105624282 | 194 |
| 388 | 3300028577 | Ga0265318_10051209 | Ga0265318_100512092 | 194 |
| 389 | 3300028786 | Ga0307517_10014862 | Ga0307517_100148621 | 194 |
| 390 | 3300028786 | Ga0307517_10078685 | Ga0307517_100786852 | 194 |
| 391 | 3300028794 | Ga0307515_10278160 | Ga0307515_102781602 | 194 |
| 392 | 3300030521 | Ga0307511_10124969 | Ga0307511_101249691 | 194 |
| 393 | 3300031238 | Ga0265332_10009706 | Ga0265332_100097065 | 194 |
| 394 | 3300031239 | Ga0265328_10015573 | Ga0265328_100155734 | 194 |
| 395 | 3300031241 | Ga0265325_10009030 | Ga0265325_100090302 | 194 |
| 396 | 3300031241 | Ga0265325_10053670 | Ga0265325_100536702 | 194 |
| 397 | 3300031242 | Ga0265329_10085737 | Ga0265329_100857372 | 194 |
| 398 | 3300031249 | Ga0265339_10009621 | Ga0265339_100096214 | 194 |
| 399 | 3300031249 | Ga0265339_10207300 | Ga0265339_102073002 | 194 |
| 400 | 3300031250 | Ga0265331_10052420 | Ga0265331_100524202 | 194 |
| 401 | 3300031344 | Ga0265316_10019515 | Ga0265316_100195153 | 194 |
| 402 | 3300031344 | Ga0265316_10062585 | Ga0265316_100625852 | 194 |
| 403 | 3300031344 | Ga0265316_10064176 | Ga0265316_100641764 | 194 |
| 404 | 3300031344 | Ga0265316_10104167 | Ga0265316_101041674 | 194 |
| 405 | 3300031456 | Ga0307513_10067935 | Ga0307513_100679354 | 194 |
| 406 | 3300031507 | Ga0307509_10164056 | Ga0307509_101640562 | 194 |
| 407 | 3300031595 | Ga0265313_10018163 | Ga0265313_100181634 | 194 |
| 408 | 3300031616 | Ga0307508_10000363 | Ga0307508_100003634 | 194 |
| 409 | 3300031711 | Ga0265314_10002040 | Ga0265314_1000204021 | 194 |
| 410 | 3300031711 | Ga0265314_10193112 | Ga0265314_101931122 | 194 |
| 411 | 3300031712 | Ga0265342_10011415 | Ga0265342_100114152 | 194 |
| 412 | 3300031712 | Ga0265342_10311868 | Ga0265342_103118681 | 194 |
| 413 | 3300032005 | Ga0307411_11144187 | Ga0307411_111441871 | 194 |
| 414 | 3300033180 | Ga0307510_10007759 | Ga0307510_100077599 | 194 |
| 415 | 3300033180 | Ga0307510_10062006 | Ga0307510_100620062 | 194 |
| 416 | 3300035113 | Ga0373936_0013344 | Ga0373936_0013344_1032_1655 | 194 |
| 417 | 3300035115 | Ga0373941_0150430 | Ga0373941_0150430_156_818 | 194 |
| 418 | 3300035116 | Ga0373945_0121419 | Ga0373945_0121419_205_825 | 194 |
| 419 | 3300035170 | Ga0373943_0307338 | Ga0373943_0307338_180_803 | 194 |
| 420 | 3300035171 | Ga0373946_0022218 | Ga0373946_0022218_1250_1873 | 194 |
| 421 | 3300035695 | Ga0373927_0000111 | Ga0373927_0000111_25952_26575 | 194 |
| 422 | 3300035725 | Ga0373947_0457242 | Ga0373947_0457242_193_855 | 194 |
| 423 | 3300036401 | Ga0373937_0068079 | Ga0373937_0068079_2157_2768 | 194 |
| 424 | 3300036401 | Ga0373937_0503916 | Ga0373937_0503916_76_696 | 194 |
| 425 | 3300036401 | Ga0373937_0597210 | Ga0373937_0597210_106_768 | 194 |
| 426 | 3300037068 | Ga0373925_0000209 | Ga0373925_0000209_37525_38148 | 194 |
| 427 | 3300037312 | Ga0395899_0027888 | Ga0395899_0027888_1657_2319 | 194 |
| 428 | 3300037312 | Ga0395899_0101588 | Ga0395899_0101588_298_960 | 194 |
| 429 | 3300037312 | Ga0395899_0331687 | Ga0395899_0331687_343_966 | 194 |
| 430 | 3300037418 | Ga0395900_0018770 | Ga0395900_0018770_4452_5114 | 194 |
| 431 | 3300037418 | Ga0395900_0123260 | Ga0395900_0123260_488_1150 | 194 |
| 432 | 3300037466 | Ga0395898_0020960 | Ga0395898_0020960_4183_4845 | 194 |
| 433 | 3300037471 | Ga0395905_0674269 | Ga0395905_0674269_99_710 | 194 |
| 434 | 3300038443 | Ga0395901_0003268 | Ga0395901_0003268_565_1227 | 194 |
| 435 | 3300038443 | Ga0395901_0025165 | Ga0395901_0025165_4813_5475 | 194 |
| 436 | 3300039062 | Ga0400483_051524 | Ga0400483_051524_5431_6075 | 194 |
| 437 | 3300039062 | Ga0400483_191709 | Ga0400483_191709_2620_3270 | 194 |
| 438 | 3300039062 | Ga0400483_292171 | Ga0400483_292171_26226_26870 | 194 |
| 439 | 3300039437 | Ga0436365_1045950 | Ga0436365_1045950_671_1333 | 194 |
| 440 | 3300039438 | Ga0436360_1158525 | Ga0436360_1158525_2216_2878 | 194 |
| 441 | 3300039447 | Ga0436361_0264740 | Ga0436361_0264740_775_1437 | 194 |
| 442 | 3300039453 | Ga0436362_0322257 | Ga0436362_0322257_228_866 | 194 |
| 443 | 3300039453 | Ga0436362_0969158 | Ga0436362_0969158_323_985 | 194 |
| 444 | 3300041452 | Ga0451793_0054054 | Ga0451793_0054054_73_687 | 194 |
| 445 | 3300041494 | Ga0451837_0323595 | Ga0451837_0323595_25_648 | 194 |
| 446 | 3300044683 | Ga0466965_0027461 | Ga0466965_0027461_1675_2274 | 194 |
| 447 | 3300046453 | Ga0495627_001129 | Ga0495627_001129_9595_10218 | 194 |
| 448 | 3300046460 | Ga0495638_0000283 | Ga0495638_0000283_61168_61761 | 194 |
| 449 | 3300046460 | Ga0495638_0000402 | Ga0495638_0000402_47607_48212 | 194 |
| 450 | 3300046460 | Ga0495638_0063422 | Ga0495638_0063422_616_1239 | 194 |
| 451 | 3300046471 | Ga0495650_0020126 | Ga0495650_0020126_2202_2825 | 194 |
| 452 | 3300046471 | Ga0495650_0052121 | Ga0495650_0052121_221_814 | 194 |
| 453 | 3300046501 | Ga0495607_0065814 | Ga0495607_0065814_248_871 | 194 |
| 454 | 3300046506 | Ga0495583_0015556 | Ga0495583_0015556_2211_2834 | 194 |
| 455 | 3300046512 | Ga0495610_0001080 | Ga0495610_0001080_19610_20233 | 194 |
| 456 | 3300046512 | Ga0495610_0009812 | Ga0495610_0009812_4722_5315 | 194 |
| 457 | 3300046513 | Ga0495616_0001277 | Ga0495616_0001277_10695_11318 | 194 |
| 458 | 3300046513 | Ga0495616_0014302 | Ga0495616_0014302_3688_4311 | 194 |
| 459 | 3300046516 | Ga0495628_0170453 | Ga0495628_0170453_727_1338 | 194 |
| 460 | 3300046519 | Ga0495632_0040673 | Ga0495632_0040673_431_1054 | 194 |
| 461 | 3300046520 | Ga0495637_0016533 | Ga0495637_0016533_2096_2689 | 194 |
| 462 | 3300046522 | Ga0495643_0075995 | Ga0495643_0075995_428_1051 | 194 |
| 463 | 3300046524 | Ga0495648_0000107 | Ga0495648_0000107_5672_6265 | 194 |
| 464 | 3300046524 | Ga0495648_0128901 | Ga0495648_0128901_413_1027 | 194 |
| 465 | 3300046525 | Ga0495663_0010031 | Ga0495663_0010031_1687_2292 | 194 |
| 466 | 3300046528 | Ga0495642_0047425 | Ga0495642_0047425_773_1384 | 194 |
| 467 | 3300046528 | Ga0495642_0065568 | Ga0495642_0065568_58_681 | 194 |
| 468 | 3300046530 | Ga0495654_0000085 | Ga0495654_0000085_66301_66924 | 194 |
| 469 | 3300046530 | Ga0495654_0011867 | Ga0495654_0011867_3729_4322 | 194 |
| 470 | 3300046538 | Ga0495609_0019546 | Ga0495609_0019546_1132_1755 | 194 |
| 471 | 3300046539 | Ga0495621_0016449 | Ga0495621_0016449_1551_2141 | 194 |
| 472 | 3300046542 | Ga0495597_0019658 | Ga0495597_0019658_508_1101 | 194 |
| 473 | 3300046543 | Ga0495645_0091145 | Ga0495645_0091145_912_1523 | 194 |
| 474 | 3300046557 | Ga0495622_0003645 | Ga0495622_0003645_350_961 | 194 |
| 475 | 3300046616 | Ga0495668_0003283 | Ga0495668_0003283_5485_6084 | 194 |
| 476 | 3300046616 | Ga0495668_0004662 | Ga0495668_0004662_7514_8137 | 194 |
| 477 | 3300046616 | Ga0495668_0056179 | Ga0495668_0056179_1164_1787 | 194 |
| 478 | 3300046616 | Ga0495668_0121010 | Ga0495668_0121010_271_861 | 194 |
| 479 | 3300046616 | Ga0495668_0128845 | Ga0495668_0128845_119_742 | 194 |
| 480 | 3300046648 | Ga0495611_0026073 | Ga0495611_0026073_424_1047 | 194 |
| 481 | 3300046660 | Ga0495625_0000094 | Ga0495625_0000094_100138_100734 | 194 |
| 482 | 3300046660 | Ga0495625_0004558 | Ga0495625_0004558_2792_3397 | 194 |
| 483 | 3300046660 | Ga0495625_0005125 | Ga0495625_0005125_4610_5233 | 194 |
| 484 | 3300046660 | Ga0495625_0043451 | Ga0495625_0043451_972_1571 | 194 |
| 485 | 3300046684 | Ga0495669_0000007 | Ga0495669_0000007_158645_159280 | 194 |
| 486 | 3300046684 | Ga0495669_0000548 | Ga0495669_0000548_3013_3612 | 194 |
| 487 | 3300046684 | Ga0495669_0039434 | Ga0495669_0039434_1065_1688 | 194 |
| 488 | 3300046691 | Ga0495670_0043271 | Ga0495670_0043271_1372_1965 | 194 |
| 489 | 3300046692 | Ga0495671_0104953 | Ga0495671_0104953_265_888 | 194 |
| 490 | 3300046692 | Ga0495671_0121032 | Ga0495671_0121032_145_738 | 194 |
| 491 | 3300046692 | Ga0495671_0129725 | Ga0495671_0129725_274_867 | 194 |
| 492 | 3300046694 | Ga0495649_0119151 | Ga0495649_0119151_160_771 | 194 |
| 493 | 3300046810 | Ga0495660_0221685 | Ga0495660_0221685_76_699 | 194 |
| 494 | 3300047320 | Ga0495672_0001097 | Ga0495672_0001097_7274_7897 | 194 |
| 495 | 3300047320 | Ga0495672_0010571 | Ga0495672_0010571_2411_3022 | 194 |
| 496 | 3300047445 | Ga0495677_0051314 | Ga0495677_0051314_369_992 | 194 |
| 497 | 3300047447 | Ga0495685_084547 | Ga0495685_084547_237_860 | 194 |
| 498 | 3300047469 | Ga0495673_0000341 | Ga0495673_0000341_56978_57601 | 194 |
| 499 | 3300047469 | Ga0495673_0004118 | Ga0495673_0004118_7424_8017 | 194 |
| 500 | 3300047469 | Ga0495673_0005953 | Ga0495673_0005953_6509_7132 | 194 |
| 501 | 3300047470 | Ga0495681_0070282 | Ga0495681_0070282_341_934 | 194 |
| 502 | 3300047472 | Ga0495686_0001488 | Ga0495686_0001488_4426_5019 | 194 |
| 503 | 3300047472 | Ga0495686_0016399 | Ga0495686_0016399_2201_2824 | 194 |
| 504 | 3300047472 | Ga0495686_0019971 | Ga0495686_0019971_2324_2947 | 194 |
| 505 | 3300047472 | Ga0495686_0020535 | Ga0495686_0020535_2806_3429 | 194 |
| 506 | 3300047472 | Ga0495686_0107263 | Ga0495686_0107263_744_1367 | 194 |
| 507 | 3300047472 | Ga0495686_0133047 | Ga0495686_0133047_319_942 | 194 |
| 508 | 3300048091 | Ga0495626_0106649 | Ga0495626_0106649_77_688 | 194 |
| 509 | 3300048904 | Ga0496101_0040526 | Ga0496101_0040526_77_700 | 194 |
| 510 | 3300048905 | Ga0496102_0009500 | Ga0496102_0009500_7552_8175 | 194 |
| 511 | 3300048905 | Ga0496102_0549056 | Ga0496102_0549056_224_847 | 194 |
| 512 | 3300048906 | Ga0496103_0073496 | Ga0496103_0073496_717_1340 | 194 |
| 513 | 3300048908 | Ga0496105_0252394 | Ga0496105_0252394_598_1221 | 194 |
| 514 | 3300048909 | Ga0496106_0015315 | Ga0496106_0015315_2285_2908 | 194 |
| 515 | 3300048909 | Ga0496106_0490437 | Ga0496106_0490437_82_705 | 194 |
| 516 | 3300048910 | Ga0496107_0000085 | Ga0496107_0000085_7443_8066 | 194 |
| 517 | 3300048912 | Ga0496109_0072137 | Ga0496109_0072137_699_1322 | 194 |
| 518 | 3300048913 | Ga0496110_0287157 | Ga0496110_0287157_520_1143 | 194 |
| 519 | 3300048915 | Ga0496112_0035271 | Ga0496112_0035271_2871_3494 | 194 |
| 520 | 3300048915 | Ga0496112_0178251 | Ga0496112_0178251_1377_2000 | 194 |
| 521 | 3300048916 | Ga0496113_0091473 | Ga0496113_0091473_10_633 | 194 |
| 522 | 3300048916 | Ga0496113_0498165 | Ga0496113_0498165_294_893 | 194 |
| 523 | 3300048918 | Ga0496115_0000460 | Ga0496115_0000460_5205_5828 | 194 |
| 524 | 3300048918 | Ga0496115_0001891 | Ga0496115_0001891_8118_8741 | 194 |
| 525 | 3300048918 | Ga0496115_0004365 | Ga0496115_0004365_6733_7356 | 194 |
| 526 | 3300048918 | Ga0496115_0118132 | Ga0496115_0118132_862_1446 | 194 |
| 527 | 3300048918 | Ga0496115_0556584 | Ga0496115_0556584_120_731 | 194 |
| 528 | 3300048924 | Ga0496121_0001169 | Ga0496121_0001169_37927_38550 | 194 |
| 529 | 3300048924 | Ga0496121_0002347 | Ga0496121_0002347_23671_24312 | 194 |
| 530 | 3300048924 | Ga0496121_0002899 | Ga0496121_0002899_19801_20442 | 194 |
| 531 | 3300048924 | Ga0496121_0330283 | Ga0496121_0330283_358_981 | 194 |
| 532 | 3300048927 | Ga0496124_0009364 | Ga0496124_0009364_6111_6710 | 194 |
| 533 | 3300048929 | Ga0496126_0021909 | Ga0496126_0021909_4995_5636 | 194 |
| 534 | 3300048929 | Ga0496126_0023104 | Ga0496126_0023104_2044_2706 | 194 |
| 535 | 3300049569 | Ga0501032_0002943 | Ga0501032_0002943_10004_10693 | 194 |
| 536 | 3300049570 | Ga0501033_0049119 | Ga0501033_0049119_280_876 | 194 |
| 537 | 3300049571 | Ga0501034_0003075 | Ga0501034_0003075_4769_5431 | 194 |
| 538 | 3300049571 | Ga0501034_0015064 | Ga0501034_0015064_2069_2803 | 194 |
| 539 | 3300049571 | Ga0501034_0035945 | Ga0501034_0035945_979_1668 | 194 |
| 540 | 3300049571 | Ga0501034_0050687 | Ga0501034_0050687_2216_2905 | 194 |
| 541 | 3300049571 | Ga0501034_0163202 | Ga0501034_0163202_1301_1921 | 194 |
| 542 | 3300049571 | Ga0501034_0305931 | Ga0501034_0305931_446_1108 | 194 |
| 543 | 3300049572 | Ga0501036_0454722 | Ga0501036_0454722_208_804 | 194 |
| 544 | 3300049573 | Ga0501037_0077995 | Ga0501037_0077995_88_777 | 194 |
| 545 | 3300049574 | Ga0501038_0297642 | Ga0501038_0297642_249_845 | 194 |
| 546 | 3300049574 | Ga0501038_0414885 | Ga0501038_0414885_348_1010 | 194 |
| 547 | 3300049579 | Ga0501043_0021727 | Ga0501043_0021727_2281_2970 | 194 |
| 548 | 3300049579 | Ga0501043_0113950 | Ga0501043_0113950_428_1051 | 194 |
| 549 | 3300049579 | Ga0501043_0216567 | Ga0501043_0216567_171_860 | 194 |
| 550 | 3300049580 | Ga0501046_0225343 | Ga0501046_0225343_397_1059 | 194 |
| 551 | 3300049580 | Ga0501046_0586401 | Ga0501046_0586401_168_779 | 194 |
| 552 | 3300049581 | Ga0501047_0002245 | Ga0501047_0002245_6543_7166 | 194 |
| 553 | 3300049581 | Ga0501047_0008627 | Ga0501047_0008627_5748_6359 | 194 |
| 554 | 3300049581 | Ga0501047_0103394 | Ga0501047_0103394_1169_1765 | 194 |
| 555 | 3300049581 | Ga0501047_0294001 | Ga0501047_0294001_395_1033 | 194 |
| 556 | 3300049582 | Ga0501048_0697761 | Ga0501048_0697761_40_651 | 194 |
| 557 | 3300049583 | Ga0501067_0000151 | Ga0501067_0000151_2471_3160 | 194 |
| 558 | 3300049584 | Ga0501068_0004552 | Ga0501068_0004552_725_1414 | 194 |
| 559 | 3300049589 | Ga0501073_0000002 | Ga0501073_0000002_179645_180334 | 194 |
| 560 | 3300049593 | Ga0501077_0000002 | Ga0501077_0000002_76504_77193 | 194 |
| 561 | 3300049741 | Ga0501079_0122464 | Ga0501079_0122464_1193_1882 | 194 |
| 562 | 3300049742 | Ga0501080_0007490 | Ga0501080_0007490_5179_5790 | 194 |
| 563 | 3300049742 | Ga0501080_0008841 | Ga0501080_0008841_3148_3837 | 194 |
| 564 | 3300049742 | Ga0501080_0150946 | Ga0501080_0150946_988_1599 | 194 |
| 565 | 3300049822 | Ga0501035_0098701 | Ga0501035_0098701_1091_1687 | 194 |
| 566 | 3300049823 | Ga0501044_0002054 | Ga0501044_0002054_10999_11688 | 194 |
| 567 | 3300049823 | Ga0501044_0142097 | Ga0501044_0142097_1007_1627 | 194 |
| 568 | 3300049823 | Ga0501044_0572839 | Ga0501044_0572839_261_923 | 194 |
| 569 | 3300049824 | Ga0501045_0317586 | Ga0501045_0317586_311_1000 | 194 |
| 570 | 3300050489 | nmdc:mga03683_677_c1 | nmdc:mga03683_677_c1_224_886 | 194 |
| 571 | 3300050489 | nmdc:mga03683_81581_c1 | nmdc:mga03683_81581_c1_245_907 | 194 |
| 572 | 3300050489 | nmdc:mga03683_94934_c2 | nmdc:mga03683_94934_c2_210_806 | 194 |
| 573 | 3300050491 | nmdc:mga00v17_205339_c2 | nmdc:mga00v17_205339_c2_216_878 | 194 |
| 574 | 3300050492 | nmdc:mga0yw44_146900_c1 | nmdc:mga0yw44_146900_c1_123_785 | 194 |
| 575 | 3300050492 | nmdc:mga0yw44_50534_c1 | nmdc:mga0yw44_50534_c1_1115_1777 | 194 |
| 576 | 3300050492 | nmdc:mga0yw44_6639_c1 | nmdc:mga0yw44_6639_c1_1703_2365 | 194 |
| 577 | 3300050493 | nmdc:mga0k408_60678_c1 | nmdc:mga0k408_60678_c1_991_1590 | 194 |
| 578 | 3300050494 | nmdc:mga06z11_12916_c1 | nmdc:mga06z11_12916_c1_625_1287 | 194 |
| 579 | 3300050494 | nmdc:mga06z11_302940_c1 | nmdc:mga06z11_302940_c1_277_939 | 194 |
| 580 | 3300050496 | nmdc:mga07m45_29809_c1 | nmdc:mga07m45_29809_c1_2045_2707 | 194 |
| 581 | 3300050496 | nmdc:mga07m45_49578_c1 | nmdc:mga07m45_49578_c1_606_1268 | 194 |
| 582 | 3300050516 | nmdc:mga0sz30_157021_c1 | nmdc:mga0sz30_157021_c1_125_787 | 194 |
| 583 | 3300050516 | nmdc:mga0sz30_365228_c1 | nmdc:mga0sz30_365228_c1_31_630 | 194 |
| 584 | 3300050516 | nmdc:mga0sz30_51994_c1 | nmdc:mga0sz30_51994_c1_13_675 | 194 |
| 585 | 3300053080 | Ga0500635_0077720 | Ga0500635_0077720_202_813 | 194 |
| 586 | 3300053086 | Ga0500578_0001569 | Ga0500578_0001569_20600_21193 | 194 |
| 587 | 3300053088 | Ga0500644_0000124 | Ga0500644_0000124_5063_5656 | 194 |
| 588 | 3300053088 | Ga0500644_0011700 | Ga0500644_0011700_378_971 | 194 |
| 589 | 3300053096 | Ga0500641_0001391 | Ga0500641_0001391_5875_6537 | 194 |
| 590 | 3300053096 | Ga0500641_0002845 | Ga0500641_0002845_4859_5452 | 194 |
| 591 | 3300053096 | Ga0500641_0207998 | Ga0500641_0207998_177_770 | 194 |
| 592 | 3300053119 | Ga0500595_013338 | Ga0500595_013338_801_1385 | 194 |
| 593 | 3300053122 | Ga0500608_109785 | Ga0500608_109785_269_892 | 194 |
| 594 | 3300053125 | Ga0500618_000159 | Ga0500618_000159_9434_10057 | 194 |
| 595 | 3300053130 | Ga0500642_0234454 | Ga0500642_0234454_56_679 | 194 |
| 596 | 3300053134 | Ga0500658_0000535 | Ga0500658_0000535_4859_5464 | 194 |
| 597 | 3300053134 | Ga0500658_0002725 | Ga0500658_0002725_4939_5562 | 194 |
| 598 | 3300053134 | Ga0500658_0055148 | Ga0500658_0055148_317_988 | 194 |
| 599 | 3300053136 | Ga0500559_0004938 | Ga0500559_0004938_4457_5041 | 194 |
| 600 | 3300053138 | Ga0500564_000063 | Ga0500564_000063_23982_24575 | 194 |
| 601 | 3300053139 | Ga0500568_0008465 | Ga0500568_0008465_3581_4252 | 194 |
| 602 | 3300053142 | Ga0500577_0016443 | Ga0500577_0016443_447_1070 | 194 |
| 603 | 3300053146 | Ga0500588_0017563 | Ga0500588_0017563_565_1158 | 194 |
| 604 | 3300053153 | Ga0500616_0005558 | Ga0500616_0005558_1756_2349 | 194 |
| 605 | 3300053153 | Ga0500616_0028588 | Ga0500616_0028588_2023_2646 | 194 |
| 606 | 3300053153 | Ga0500616_0040457 | Ga0500616_0040457_973_1593 | 194 |
| 607 | 3300053156 | Ga0500622_0000643 | Ga0500622_0000643_16658_17251 | 194 |
| 608 | 3300053156 | Ga0500622_0051446 | Ga0500622_0051446_1477_2073 | 194 |
| 609 | 3300053156 | Ga0500622_0137762 | Ga0500622_0137762_156_755 | 194 |
| 610 | 3300053158 | Ga0500627_0024296 | Ga0500627_0024296_750_1373 | 194 |
| 611 | 3300053730 | Ga0500645_020054 | Ga0500645_020054_1199_1822 | 194 |
| 612 | 3300053733 | Ga0500552_000050 | Ga0500552_000050_4716_5378 | 194 |
| 613 | 3300053737 | Ga0500601_004278 | Ga0500601_004278_722_1306 | 194 |
| 614 | 3300060353 | Ga0501082_0266158 | Ga0501082_0266158_80_742 | 194 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vhl-assembly2.cif.gz_B | crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate | 0.9104 | 2 | 191 |
| 2if2-assembly2.cif.gz_B | crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. | 0.9099 | 1 | 191 |
| 1n3b-assembly1.cif.gz_C | crystal structure of dephosphocoenzyme a kinase from escherichia coli | 0.9093 | 2 | 191 |
| 1n3b-assembly1.cif.gz_A | crystal structure of dephosphocoenzyme a kinase from escherichia coli | 0.9044 | 2 | 191 |
| 1uf9-assembly3.cif.gz_C | crystal structure of tt1252 from thermus thermophilus | 0.9039 | 2 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8WVC6_1_203_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9277 | 1 | 194 | 3.40.50.300 |
| af_Q8WVC6_1_203_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9232 | 1 | 194 | 3.40.50.300 |
| af_P34558_5_214_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9221 | 2 | 194 | 3.40.50.300 |
| af_P9WPA3_1_200_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9216 | 1 | 190 | 3.40.50.300 |
| af_O74414_1_201_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9198 | 1 | 191 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G6KQW1-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9926 | 1 | 194 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A6I5WYB6-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9898 | 2 | 191 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A7X1KCM8-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9893 | 2 | 191 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A1G6KQW1-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9875 | 1 | 194 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A1R1Z0H5-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9861 | 1 | 191 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar