F469393

General Info

Members Datasets Scaffolds Average Seq Length
614 355 581 206

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0015064|Ga0501034_0015064_2069_2803
Length 244
Sequence MTPPPPYDGDTSPAELGRKENVAIMIIVGLTGSIGMGKSTAAKMLRQMGVPVYDADAAVHRLQAPGGLALPPIEAAFPGVVKNGVLDRQALGGRVFGDKAALRRLEAIVHPLVQQQQRLFVRRAALRSAPMVVLDIPLLFEGLGERRVDGVLVVSAPAFLQRQRVMARPGMTAEKFAGILRQQVPDSLKRRKATVVIPTGLGLAPTRTALAKAVRSLKKKQGRSWPANPWRDRFTARLARAKRK

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
3 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
4 2643221583 Caulobacter sp. Root655 Isolate Unclassified
5 2643221584 Caulobacter sp. Root656 Isolate Unclassified
6 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
7 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
8 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
9 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
10 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
11 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
12 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
13 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
14 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
15 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
16 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
17 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
97 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
98 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
220 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
299 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
314 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
315 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
316 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
317 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
318 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
319 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
320 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
321 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
322 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
323 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
324 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
327 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
330 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
333 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
334 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
335 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
336 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
337 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
341 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
342 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
343 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
344 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
345 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
346 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
347 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
348 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
349 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
350 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
351 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
352 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
353 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
354 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
355 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 0.16
Isolates 5.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.29
Nodule 3.09
Rhizoplane 4.07
Rhizosphere 70.52
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000010 3300003214 Bacteria 442113
2 Ga0055528_1006962 3300003790 Bacteria 5061
3 Ga0055530_10000313 3300003791 Bacteria 44170
4 Ga0055530_10002661 3300003791 Bacteria 11168
5 Ga0055530_10011004 3300003791 Bacteria 3285
6 Ga0055531_10002220 3300003794 Bacteria 13181
7 Ga0055531_10002388 3300003794 Bacteria 12617
8 Ga0055543_1033061 3300004625 Bacteria 896
9 Ga0065165_1004438 3300005262 Bacteria 8701
10 Ga0065165_1005530 3300005262 Bacteria 7058
11 Ga0065714_10070296 3300005288 Bacteria 3907
12 Ga0065704_10095571 3300005289 Bacteria 2482
13 Ga0070658_10312691 3300005327 Bacteria 1340
14 Ga0070658_10704365 3300005327 Bacteria 876
15 Ga0070676_10079147 3300005328 Bacteria 1990
16 Ga0070683_100084538 3300005329 Bacteria 2973
17 Ga0070690_100177317 3300005330 Bacteria 1471
18 Ga0070670_100373687 3300005331 Bacteria 1255
19 Ga0068869_100226785 3300005334 Bacteria 1483
20 Ga0070680_100001568 3300005336 Bacteria 16671
21 Ga0068868_100052577 3300005338 Bacteria 3207
22 Ga0070660_100019186 3300005339 Bacteria 5006
23 Ga0070660_100100854 3300005339 Bacteria 2287
24 Ga0070660_100240389 3300005339 Bacteria 1475
25 Ga0070689_100072602 3300005340 Bacteria 2690
26 Ga0070689_100110657 3300005340 Bacteria 2184
27 Ga0070661_100101670 3300005344 Bacteria 2139
28 Ga0070668_100011541 3300005347 Bacteria 6578
29 Ga0070669_100013132 3300005353 Bacteria 5886
30 Ga0070669_100214729 3300005353 Bacteria 1519
31 Ga0070669_100308543 3300005353 Bacteria 1275
32 Ga0070669_100584435 3300005353 Bacteria 934
33 Ga0070671_100045879 3300005355 Bacteria 3633
34 Ga0070671_100079556 3300005355 Bacteria 2740
35 Ga0070671_100355050 3300005355 Bacteria 1251
36 Ga0070673_100022431 3300005364 Bacteria 4595
37 Ga0070688_100134573 3300005365 Bacteria 1672
38 Ga0070659_100000552 3300005366 Bacteria 27366
39 Ga0070659_100006406 3300005366 Bacteria 8500
40 Ga0070709_10875616 3300005434 Bacteria 709
41 Ga0070714_100088018 3300005435 Bacteria 2717
42 Ga0070713_100026964 3300005436 Bacteria 4518
43 Ga0070713_100050973 3300005436 Bacteria 3422
44 Ga0070710_10367711 3300005437 Bacteria 956
45 Ga0070708_100075119 3300005445 Bacteria 3050
46 Ga0070708_100112540 3300005445 Bacteria 2503
47 Ga0070678_101132543 3300005456 Bacteria 723
48 Ga0070681_10006651 3300005458 Bacteria 11252
49 Ga0070681_10082542 3300005458 Bacteria 3169
50 Ga0070681_11096181 3300005458 Bacteria 717
51 Ga0068867_100006768 3300005459 Bacteria 8100
52 Ga0070706_100282305 3300005467 Bacteria 1550
53 Ga0070707_100091862 3300005468 Bacteria 2939
54 Ga0070698_100025801 3300005471 Bacteria 6124
55 Ga0070698_100912634 3300005471 Bacteria 824
56 Ga0070679_100007418 3300005530 Bacteria 10249
57 Ga0070679_100009290 3300005530 Bacteria 9295
58 Ga0070684_100024078 3300005535 Bacteria 5103
59 Ga0068853_100011535 3300005539 Bacteria 7185
60 Ga0068853_100466573 3300005539 Bacteria 1189
61 Ga0070696_100227093 3300005546 Bacteria 1403
62 Ga0070665_100000721 3300005548 Bacteria 44003
63 Ga0070665_100109205 3300005548 Bacteria 2768
64 Ga0070665_100186845 3300005548 Bacteria 2073
65 Ga0068855_100000106 3300005563 Bacteria 103864
66 Ga0068855_100024646 3300005563 Bacteria 7197
67 Ga0068855_100044020 3300005563 Bacteria 5285
68 Ga0068855_100126544 3300005563 Bacteria 2921
69 Ga0068855_100257990 3300005563 Bacteria 1943
70 Ga0068855_100310443 3300005563 Bacteria 1745
71 Ga0068855_100783661 3300005563 Bacteria 1014
72 Ga0068855_100864294 3300005563 Bacteria 957
73 Ga0070664_100120880 3300005564 Bacteria 2293
74 Ga0068857_100078940 3300005577 Bacteria 2938
75 Ga0068857_100121908 3300005577 Bacteria 2348
76 Ga0068854_100607081 3300005578 Bacteria 935
77 Ga0068854_101139563 3300005578 Unclassified 696
78 Ga0068856_100072284 3300005614 Bacteria 3415
79 Ga0068856_100146970 3300005614 Bacteria 2365
80 Ga0068852_100087292 3300005616 Bacteria 2783
81 Ga0068859_100315980 3300005617 Bacteria 1656
82 Ga0068859_100518643 3300005617 Bacteria 1287
83 Ga0068864_100000145 3300005618 Bacteria 68040
84 Ga0068864_100062794 3300005618 Bacteria 3219
85 Ga0068864_100106924 3300005618 Bacteria 2488
86 Ga0068864_100550283 3300005618 Bacteria 1115
87 Ga0068870_10289216 3300005840 Bacteria 1030
88 Ga0068863_100103825 3300005841 Bacteria 2704
89 Ga0068863_100234406 3300005841 Bacteria 1771
90 Ga0068863_100435322 3300005841 Bacteria 1286
91 Ga0068858_100000268 3300005842 Bacteria 55747
92 Ga0068858_100000370 3300005842 Bacteria 47225
93 Ga0068858_100328887 3300005842 Bacteria 1462
94 Ga0068860_100293462 3300005843 Bacteria 1591
95 Ga0081455_10004620 3300005937 Bacteria 15371
96 Ga0081455_10025838 3300005937 Bacteria 5413
97 Ga0081539_10004087 3300005985 Bacteria 16680
98 Ga0070717_11097182 3300006028 Bacteria 725
99 Ga0075363_100008814 3300006048 Bacteria 4717
100 Ga0075363_100308207 3300006048 Bacteria 920
101 Ga0075364_10199401 3300006051 Bacteria 1356
102 Ga0075432_10103145 3300006058 Bacteria 1056
103 Ga0070712_100233774 3300006175 Bacteria 1461
104 Ga0075362_10004771 3300006177 Bacteria 4896
105 Ga0075362_10081232 3300006177 Bacteria 1494
106 Ga0075362_10088078 3300006177 Bacteria 1438
107 Ga0075367_10051804 3300006178 Bacteria 2427
108 Ga0075369_10001444 3300006186 Bacteria 8107
109 Ga0075369_10109805 3300006186 Bacteria 1243
110 Ga0075369_10163993 3300006186 Bacteria 1019
111 Ga0075366_10018266 3300006195 Bacteria 4047
112 Ga0068871_100687960 3300006358 Bacteria 936
113 Ga0068865_100012939 3300006881 Bacteria 5262
114 Ga0097620_100315967 3300006931 Bacteria 1656
115 Ga0097620_100518625 3300006931 Bacteria 1287
116 Ga0099795_10008993 3300007788 Bacteria 2879
117 Ga0105240_10000653 3300009093 Bacteria 63948
118 Ga0105240_10001036 3300009093 Bacteria 49427
119 Ga0105240_10026858 3300009093 Bacteria 7549
120 Ga0105240_10197974 3300009093 Bacteria 2357
121 Ga0105240_10279200 3300009093 Bacteria 1920
122 Ga0105240_10279462 3300009093 Bacteria 1919
123 Ga0105240_10873512 3300009093 Bacteria 969
124 Ga0105245_10074248 3300009098 Bacteria 3094
125 Ga0105245_10235411 3300009098 Bacteria 1773
126 Ga0105245_10816277 3300009098 Bacteria 971
127 Ga0114129_10158182 3300009147 Bacteria 3097
128 Ga0105243_10004582 3300009148 Bacteria 10901
129 Ga0105243_10038746 3300009148 Bacteria 3712
130 Ga0105243_10133977 3300009148 Bacteria 2106
131 Ga0105241_10372821 3300009174 Bacteria 1245
132 Ga0105242_10032335 3300009176 Bacteria 4183
133 Ga0105242_10652101 3300009176 Bacteria 1024
134 Ga0105242_10653111 3300009176 Bacteria 1023
135 Ga0105248_10000650 3300009177 Bacteria 39474
136 Ga0105248_10108725 3300009177 Bacteria 3127
137 Ga0105248_11026339 3300009177 Bacteria 932
138 Ga0105237_10022290 3300009545 Bacteria 6498
139 Ga0105237_10567538 3300009545 Bacteria 1141
140 Ga0105238_10024421 3300009551 Bacteria 6161
141 Ga0105238_10070858 3300009551 Bacteria 3484
142 Ga0105249_10503820 3300009553 Bacteria 1256
143 Ga0105148_100032 3300009978 Bacteria 20199
144 Ga0105147_101839 3300009982 Bacteria 1736
145 Ga0105035_103614 3300009988 Bacteria 1198
146 Ga0105239_10000319 3300010375 Bacteria 70995
147 Ga0105239_10001093 3300010375 Bacteria 37498
148 Ga0105239_10010429 3300010375 Bacteria 10390
149 Ga0105239_10857585 3300010375 Bacteria 1042
150 Ga0105239_11349662 3300010375 Bacteria 823
151 Ga0157369_10001360 3300013105 Bacteria 30196
152 Ga0157369_10022866 3300013105 Bacteria 6972
153 Ga0157374_10464244 3300013296 Bacteria 1268
154 Ga0157378_10058417 3300013297 Bacteria 3440
155 Ga0157378_10920047 3300013297 Bacteria 906
156 Ga0157378_11276722 3300013297 Bacteria 775
157 Ga0163162_10010851 3300013306 Bacteria 8866
158 Ga0163162_10684485 3300013306 Bacteria 1148
159 Ga0157372_10090362 3300013307 Bacteria 3481
160 Ga0157372_10441289 3300013307 Bacteria 1517
161 Ga0163163_10050842 3300014325 Bacteria 4083
162 Ga0157380_10106285 3300014326 Bacteria 2348
163 Ga0157376_10438578 3300014969 Bacteria 1271
164 Ga0157376_11278281 3300014969 Bacteria 763
165 Ga0183363_1003 3300015690 Bacteria 421263
166 Ga0206353_11944051 3300020082 Bacteria 1134
167 Ga0213873_10038716 3300021358 Bacteria 1219
168 Ga0213872_10001875 3300021361 Bacteria 12982
169 Ga0209148_1013603 3300025254 Bacteria 1459
170 Ga0209233_1000044 3300025261 Bacteria 489783
171 Ga0209565_1001350 3300025263 Bacteria 11140
172 Ga0209673_1000732 3300025273 Bacteria 45546
173 Ga0209673_1037096 3300025273 Bacteria 1436
174 Ga0209675_1008215 3300025291 Bacteria 3872
175 Ga0209676_1000257 3300025292 Bacteria 112662
176 Ga0209676_1000316 3300025292 Bacteria 94380
177 Ga0209564_1004512 3300025295 Bacteria 8472
178 Ga0209564_1033760 3300025295 Bacteria 1515
179 Ga0209758_1002581 3300025297 Bacteria 18179
180 Ga0209758_1002904 3300025297 Bacteria 16541
181 Ga0209758_1004448 3300025297 Bacteria 11655
182 Ga0209050_1000053 3300025298 Bacteria 349521
183 Ga0209050_1003986 3300025298 Bacteria 10412
184 Ga0209050_1012713 3300025298 Bacteria 3827
185 Ga0209256_1003727 3300025299 Bacteria 10317
186 Ga0209256_1004379 3300025299 Bacteria 8921
187 Ga0209256_1017316 3300025299 Bacteria 2401
188 Ga0207426_1068214 3300025302 Bacteria 1000
189 Ga0209051_1024329 3300025303 Bacteria 2492
190 Ga0209257_1000419 3300025304 Bacteria 81956
191 Ga0209257_1000624 3300025304 Bacteria 56974
192 Ga0209257_1004976 3300025304 Bacteria 9723
193 Ga0209257_1012949 3300025304 Bacteria 3773
194 Ga0207697_10003663 3300025315 Bacteria 7527
195 Ga0207656_10167158 3300025321 Bacteria 1050
196 Ga0207642_10099987 3300025899 Bacteria 1454
197 Ga0207685_10095357 3300025905 Bacteria 1262
198 Ga0207699_10181880 3300025906 Bacteria 1414
199 Ga0207645_10011653 3300025907 Bacteria 5995
200 Ga0207643_10134643 3300025908 Bacteria 1472
201 Ga0207705_10001218 3300025909 Bacteria 20813
202 Ga0207705_10035160 3300025909 Bacteria 3584
203 Ga0207705_10181237 3300025909 Bacteria 1590
204 Ga0207654_10059863 3300025911 Bacteria 2223
205 Ga0207707_10004282 3300025912 Bacteria 12629
206 Ga0207707_10027285 3300025912 Bacteria 4994
207 Ga0207707_10840626 3300025912 Bacteria 762
208 Ga0207695_10000012 3300025913 Bacteria 840961
209 Ga0207695_10000867 3300025913 Bacteria 55339
210 Ga0207695_10134575 3300025913 Bacteria 2426
211 Ga0207695_10189443 3300025913 Bacteria 1975
212 Ga0207695_10299135 3300025913 Bacteria 1500
213 Ga0207695_10333651 3300025913 Bacteria 1405
214 Ga0207671_10000924 3300025914 Bacteria 36861
215 Ga0207671_10075442 3300025914 Bacteria 2522
216 Ga0207663_10451518 3300025916 Bacteria 991
217 Ga0207660_10001115 3300025917 Bacteria 17946
218 Ga0207660_10021743 3300025917 Bacteria 4316
219 Ga0207657_10000235 3300025919 Bacteria 58394
220 Ga0207657_10136206 3300025919 Bacteria 2009
221 Ga0207657_10156761 3300025919 Bacteria 1851
222 Ga0207649_10039885 3300025920 Bacteria 2850
223 Ga0207649_10042655 3300025920 Bacteria 2769
224 Ga0207652_10011897 3300025921 Bacteria 7020
225 Ga0207652_10097115 3300025921 Bacteria 2596
226 Ga0207646_10220796 3300025922 Bacteria 1712
227 Ga0207681_10010984 3300025923 Bacteria 5562
228 Ga0207681_10298999 3300025923 Bacteria 1273
229 Ga0207681_10389112 3300025923 Bacteria 1124
230 Ga0207681_10693573 3300025923 Bacteria 846
231 Ga0207694_10000006 3300025924 Bacteria 631109
232 Ga0207694_10040482 3300025924 Bacteria 3588
233 Ga0207694_10252701 3300025924 Bacteria 1443
234 Ga0207659_10038717 3300025926 Bacteria 3319
235 Ga0207687_10023768 3300025927 Bacteria 4088
236 Ga0207687_10566003 3300025927 Bacteria 955
237 Ga0207700_10049644 3300025928 Bacteria 3122
238 Ga0207700_10073302 3300025928 Bacteria 2644
239 Ga0207664_10019693 3300025929 Bacteria 4993
240 Ga0207644_10050854 3300025931 Bacteria 2972
241 Ga0207644_10057973 3300025931 Bacteria 2797
242 Ga0207690_10000031 3300025932 Bacteria 154724
243 Ga0207690_10014019 3300025932 Bacteria 4831
244 Ga0207686_10093195 3300025934 Bacteria 1993
245 Ga0207670_10086377 3300025936 Bacteria 2207
246 Ga0207670_10425825 3300025936 Bacteria 1066
247 Ga0207704_10026283 3300025938 Bacteria 3192
248 Ga0207711_10003775 3300025941 Bacteria 13046
249 Ga0207711_10019608 3300025941 Bacteria 5630
250 Ga0207711_10186618 3300025941 Bacteria 1888
251 Ga0207711_10324013 3300025941 Bacteria 1424
252 Ga0207689_10076936 3300025942 Bacteria 2743
253 Ga0207661_10068810 3300025944 Bacteria 2884
254 Ga0207679_10037465 3300025945 Bacteria 3447
255 Ga0207679_10702340 3300025945 Bacteria 918
256 Ga0207667_10000232 3300025949 Bacteria 77277
257 Ga0207667_10020506 3300025949 Bacteria 7348
258 Ga0207667_10094923 3300025949 Bacteria 3079
259 Ga0207667_10174431 3300025949 Bacteria 2209
260 Ga0207651_10022119 3300025960 Bacteria 3880
261 Ga0207668_10005922 3300025972 Bacteria 7204
262 Ga0207677_10044056 3300026023 Bacteria 2970
263 Ga0207677_10315556 3300026023 Bacteria 1297
264 Ga0207677_10360875 3300026023 Bacteria 1220
265 Ga0207703_10000139 3300026035 Bacteria 86495
266 Ga0207703_10018753 3300026035 Bacteria 5404
267 Ga0207703_10939435 3300026035 Bacteria 829
268 Ga0207639_10003312 3300026041 Bacteria 10846
269 Ga0207639_10032885 3300026041 Bacteria 3822
270 Ga0207708_10364087 3300026075 Bacteria 1189
271 Ga0207702_10025007 3300026078 Bacteria 4953
272 Ga0207702_10372379 3300026078 Bacteria 1371
273 Ga0207641_10083786 3300026088 Bacteria 2774
274 Ga0207641_10118764 3300026088 Bacteria 2356
275 Ga0207648_10015507 3300026089 Bacteria 7006
276 Ga0207676_10000072 3300026095 Bacteria 101978
277 Ga0207676_10002933 3300026095 Bacteria 12151
278 Ga0207676_10047480 3300026095 Bacteria 3328
279 Ga0207676_10359021 3300026095 Bacteria 1350
280 Ga0207676_10502047 3300026095 Bacteria 1152
281 Ga0207674_10039095 3300026116 Bacteria 4920
282 Ga0207674_10197160 3300026116 Bacteria 1963
283 Ga0207674_10225711 3300026116 Bacteria 1821
284 Ga0207683_10043941 3300026121 Bacteria 3905
285 Ga0207683_10663012 3300026121 Bacteria 967
286 Ga0207698_10570779 3300026142 Bacteria 1112
287 Ga0209179_1001197 3300027512 Bacteria 3081
288 Ga0268266_10000003 3300028379 Bacteria 1701703
289 Ga0268266_10169666 3300028379 Bacteria 1980
290 Ga0268266_10237597 3300028379 Bacteria 1680
291 Ga0268266_10562428 3300028379 Bacteria 1093
292 Ga0265334_10019555 3300028573 Bacteria 2784
293 Ga0265318_10051209 3300028577 Bacteria 1551
294 Ga0307517_10014862 3300028786 Bacteria 10407
295 Ga0307517_10078685 3300028786 Bacteria 2848
296 Ga0307515_10278160 3300028794 Bacteria 1385
297 Ga0307511_10124969 3300030521 Bacteria 1573
298 Ga0265332_10009706 3300031238 Bacteria 4294
299 Ga0265328_10015573 3300031239 Bacteria 2975
300 Ga0265325_10009030 3300031241 Bacteria 5848
301 Ga0265325_10053670 3300031241 Bacteria 2066
302 Ga0265329_10085737 3300031242 Bacteria 998
303 Ga0265340_10038743 3300031247 Bacteria 2356
304 Ga0265339_10009621 3300031249 Bacteria 6054
305 Ga0265339_10207300 3300031249 Bacteria 964
306 Ga0265331_10052420 3300031250 Bacteria 1949
307 Ga0265316_10019515 3300031344 Bacteria 5796
308 Ga0265316_10062585 3300031344 Bacteria 2887
309 Ga0265316_10064176 3300031344 Bacteria 2845
310 Ga0265316_10104167 3300031344 Bacteria 2154
311 Ga0307513_10067935 3300031456 Bacteria 3736
312 Ga0307509_10164056 3300031507 Bacteria 2114
313 Ga0265313_10018163 3300031595 Bacteria 3961
314 Ga0307508_10000363 3300031616 Bacteria 55049
315 Ga0265314_10002040 3300031711 Bacteria 21393
316 Ga0265314_10193112 3300031711 Bacteria 1210
317 Ga0265342_10011415 3300031712 Bacteria 6083
318 Ga0265342_10311868 3300031712 Bacteria 826
319 Ga0307516_10008284 3300031730 Bacteria 11788
320 Ga0307406_10873694 3300031901 Bacteria 764
321 Ga0307411_11144187 3300032005 Bacteria 703
322 Ga0307510_10007759 3300033180 Bacteria 12800
323 Ga0307510_10062006 3300033180 Bacteria 3825
324 Ga0373932_0010219 3300035112 Bacteria 2269
325 Ga0373936_0013344 3300035113 Bacteria 3135
326 Ga0373936_0036750 3300035113 Bacteria 1954
327 Ga0373941_0150430 3300035115 Bacteria 854
328 Ga0373945_0121419 3300035116 Bacteria 1039
329 Ga0373943_0192908 3300035170 Bacteria 1124
330 Ga0373943_0307338 3300035170 Bacteria 901
331 Ga0373946_0022218 3300035171 Bacteria 2467
332 Ga0373935_0206502 3300035692 Bacteria 1360
333 Ga0373927_0000111 3300035695 Bacteria 62031
334 Ga0373927_0118702 3300035695 Bacteria 1726
335 Ga0373933_0120575 3300035724 Bacteria 1642
336 Ga0373933_0584888 3300035724 Bacteria 733
337 Ga0373947_0457242 3300035725 Bacteria 865
338 Ga0373937_0068079 3300036401 Bacteria 3282
339 Ga0373937_0355868 3300036401 Bacteria 1387
340 Ga0373937_0503916 3300036401 Bacteria 1150
341 Ga0373937_0597210 3300036401 Bacteria 1048
342 Ga0373925_0000209 3300037068 Bacteria 64086
343 Ga0373925_0072856 3300037068 Bacteria 2599
344 Ga0395899_0027888 3300037312 Bacteria 4253
345 Ga0395899_0101588 3300037312 Bacteria 2075
346 Ga0395899_0331687 3300037312 Bacteria 1022
347 Ga0395900_0018770 3300037418 Bacteria 7052
348 Ga0395900_0123260 3300037418 Bacteria 2658
349 Ga0395898_0020960 3300037466 Bacteria 6632
350 Ga0395905_0674269 3300037471 Bacteria 936
351 Ga0395905_1402245 3300037471 Bacteria 603
352 Ga0395901_0003268 3300038443 Bacteria 16314
353 Ga0395901_0025165 3300038443 Bacteria 6110
354 Ga0400483_051524 3300039062 Bacteria 48782
355 Ga0400483_191709 3300039062 Bacteria 8235
356 Ga0400483_292171 3300039062 Bacteria 65188
357 Ga0436365_1045950 3300039437 Bacteria 1703
358 Ga0436360_1158525 3300039438 Bacteria 6652
359 Ga0436361_0264740 3300039447 Bacteria 3590
360 Ga0436361_0713206 3300039447 Bacteria 50586
361 Ga0436362_0322257 3300039453 Bacteria 1397
362 Ga0436362_0969158 3300039453 Bacteria 1235
363 Ga0451793_0054054 3300041452 Bacteria 819
364 Ga0451837_0323595 3300041494 Bacteria 708
365 Ga0466965_0027461 3300044683 Bacteria 2764
366 Ga0466957_0087234 3300044842 Bacteria 1951
367 Ga0495627_001129 3300046453 Bacteria 17294
368 Ga0495638_0000283 3300046460 Bacteria 67742
369 Ga0495638_0000402 3300046460 Bacteria 52910
370 Ga0495638_0063422 3300046460 Bacteria 2278
371 Ga0495650_0020126 3300046471 Bacteria 3262
372 Ga0495650_0052121 3300046471 Bacteria 1681
373 Ga0495664_0052829 3300046477 Bacteria 2416
374 Ga0495607_0065814 3300046501 Bacteria 2042
375 Ga0495583_0015556 3300046506 Bacteria 4133
376 Ga0495606_0123365 3300046507 Bacteria 1548
377 Ga0495606_0213940 3300046507 Bacteria 1090
378 Ga0495610_0001080 3300046512 Bacteria 24952
379 Ga0495610_0009812 3300046512 Bacteria 6008
380 Ga0495616_0001277 3300046513 Bacteria 17673
381 Ga0495616_0014302 3300046513 Bacteria 4446
382 Ga0495628_0170453 3300046516 Bacteria 1651
383 Ga0495632_0040673 3300046519 Bacteria 2340
384 Ga0495637_0016533 3300046520 Bacteria 3448
385 Ga0495643_0075995 3300046522 Bacteria 1757
386 Ga0495648_0000107 3300046524 Bacteria 104376
387 Ga0495648_0128901 3300046524 Bacteria 1348
388 Ga0495663_0010031 3300046525 Bacteria 2629
389 Ga0495642_0047425 3300046528 Bacteria 1760
390 Ga0495642_0065568 3300046528 Bacteria 1512
391 Ga0495652_0041492 3300046529 Bacteria 3972
392 Ga0495654_0000085 3300046530 Bacteria 107010
393 Ga0495654_0011867 3300046530 Bacteria 4700
394 Ga0495609_0019546 3300046538 Bacteria 3133
395 Ga0495621_0016449 3300046539 Bacteria 2375
396 Ga0495597_0019658 3300046542 Bacteria 3157
397 Ga0495645_0057285 3300046543 Bacteria 2829
398 Ga0495645_0091145 3300046543 Bacteria 2177
399 Ga0495622_0003645 3300046557 Bacteria 7228
400 Ga0495668_0003283 3300046616 Bacteria 12284
401 Ga0495668_0004662 3300046616 Bacteria 9624
402 Ga0495668_0056179 3300046616 Bacteria 2173
403 Ga0495668_0121010 3300046616 Bacteria 1432
404 Ga0495668_0128845 3300046616 Bacteria 1385
405 Ga0495611_0026073 3300046648 Bacteria 2550
406 Ga0495625_0000094 3300046660 Bacteria 144517
407 Ga0495625_0004558 3300046660 Bacteria 13033
408 Ga0495625_0005125 3300046660 Bacteria 12110
409 Ga0495625_0043451 3300046660 Bacteria 3258
410 Ga0495669_0000007 3300046684 Bacteria 180797
411 Ga0495669_0000548 3300046684 Bacteria 16774
412 Ga0495669_0039434 3300046684 Bacteria 2092
413 Ga0495670_0043271 3300046691 Bacteria 2247
414 Ga0495671_0104953 3300046692 Bacteria 1380
415 Ga0495671_0121032 3300046692 Bacteria 1277
416 Ga0495671_0129725 3300046692 Bacteria 1229
417 Ga0495649_0119151 3300046694 Unclassified 1396
418 Ga0495660_0221685 3300046810 Bacteria 891
419 Ga0495672_0001097 3300047320 Bacteria 27486
420 Ga0495672_0010571 3300047320 Bacteria 6565
421 Ga0495677_0051314 3300047445 Bacteria 1519
422 Ga0495685_084547 3300047447 Bacteria 1055
423 Ga0495673_0000341 3300047469 Bacteria 59080
424 Ga0495673_0004118 3300047469 Bacteria 9214
425 Ga0495673_0005953 3300047469 Bacteria 7264
426 Ga0495681_0070282 3300047470 Bacteria 1588
427 Ga0495686_0001488 3300047472 Bacteria 25389
428 Ga0495686_0016399 3300047472 Bacteria 5024
429 Ga0495686_0019971 3300047472 Bacteria 4471
430 Ga0495686_0020535 3300047472 Bacteria 4402
431 Ga0495686_0107263 3300047472 Bacteria 1678
432 Ga0495686_0133047 3300047472 Bacteria 1473
433 Ga0495626_0106649 3300048091 Bacteria 1217
434 Ga0496100_0352809 3300048903 Bacteria 1111
435 Ga0496101_0040526 3300048904 Bacteria 3317
436 Ga0496102_0009500 3300048905 Bacteria 8362
437 Ga0496102_0055568 3300048905 Bacteria 3610
438 Ga0496102_0549056 3300048905 Bacteria 1078
439 Ga0496102_0603393 3300048905 Bacteria 1021
440 Ga0496103_0073496 3300048906 Bacteria 2142
441 Ga0496105_0252394 3300048908 Bacteria 1429
442 Ga0496106_0015315 3300048909 Bacteria 5674
443 Ga0496106_0490437 3300048909 Bacteria 987
444 Ga0496107_0000085 3300048910 Bacteria 44306
445 Ga0496109_0072137 3300048912 Bacteria 3171
446 Ga0496110_0287157 3300048913 Bacteria 1498
447 Ga0496112_0035271 3300048915 Bacteria 4871
448 Ga0496112_0178251 3300048915 Bacteria 2089
449 Ga0496113_0091473 3300048916 Bacteria 2345
450 Ga0496113_0498165 3300048916 Bacteria 978
451 Ga0496115_0000460 3300048918 Bacteria 32584
452 Ga0496115_0001891 3300048918 Bacteria 14988
453 Ga0496115_0004365 3300048918 Bacteria 10236
454 Ga0496115_0035271 3300048918 Bacteria 3957
455 Ga0496115_0118132 3300048918 Bacteria 2181
456 Ga0496115_0164218 3300048918 Bacteria 1836
457 Ga0496115_0556584 3300048918 Bacteria 916
458 Ga0496117_0024048 3300048920 Bacteria 4832
459 Ga0496117_0147720 3300048920 Bacteria 1396
460 Ga0496118_0012069 3300048921 Bacteria 8340
461 Ga0496119_0033642 3300048922 Bacteria 3394
462 Ga0496121_0001169 3300048924 Bacteria 46049
463 Ga0496121_0002347 3300048924 Bacteria 29197
464 Ga0496121_0002899 3300048924 Bacteria 25178
465 Ga0496121_0330283 3300048924 Bacteria 1023
466 Ga0496124_0009364 3300048927 Bacteria 10093
467 Ga0496126_0021909 3300048929 Bacteria 6232
468 Ga0496126_0023104 3300048929 Bacteria 6029
469 Ga0495682_0005183 3300049460 Bacteria 5448
470 Ga0501031_0129082 3300049568 Bacteria 1651
471 Ga0501032_0002943 3300049569 Bacteria 13244
472 Ga0501032_0214904 3300049569 Bacteria 1252
473 Ga0501033_0049119 3300049570 Bacteria 3132
474 Ga0501034_0003075 3300049571 Bacteria 19246
475 Ga0501034_0015064 3300049571 Bacteria 7949
476 Ga0501034_0035945 3300049571 Bacteria 5022
477 Ga0501034_0044338 3300049571 Bacteria 4499
478 Ga0501034_0050687 3300049571 Bacteria 4186
479 Ga0501034_0111394 3300049571 Bacteria 2727
480 Ga0501034_0163202 3300049571 Bacteria 2198
481 Ga0501034_0182488 3300049571 Bacteria 2063
482 Ga0501034_0305931 3300049571 Bacteria 1525
483 Ga0501036_0313510 3300049572 Bacteria 1311
484 Ga0501036_0454722 3300049572 Bacteria 1067
485 Ga0501037_0038198 3300049573 Bacteria 3538
486 Ga0501037_0077995 3300049573 Bacteria 2404
487 Ga0501038_0006869 3300049574 Bacteria 10512
488 Ga0501038_0045822 3300049574 Bacteria 3794
489 Ga0501038_0297642 3300049574 Bacteria 1267
490 Ga0501038_0414885 3300049574 Bacteria 1040
491 Ga0501039_0096681 3300049575 Bacteria 2302
492 Ga0501039_0861865 3300049575 Bacteria 706
493 Ga0501043_0021727 3300049579 Bacteria 5031
494 Ga0501043_0022014 3300049579 Bacteria 5000
495 Ga0501043_0113950 3300049579 Bacteria 2123
496 Ga0501043_0216567 3300049579 Bacteria 1483
497 Ga0501046_0225343 3300049580 Bacteria 1387
498 Ga0501046_0586401 3300049580 Bacteria 792
499 Ga0501047_0002245 3300049581 Bacteria 18488
500 Ga0501047_0008627 3300049581 Bacteria 9626
501 Ga0501047_0039366 3300049581 Bacteria 4573
502 Ga0501047_0065286 3300049581 Bacteria 3509
503 Ga0501047_0103394 3300049581 Bacteria 2729
504 Ga0501047_0294001 3300049581 Bacteria 1468
505 Ga0501048_0697761 3300049582 Bacteria 729
506 Ga0501067_0000151 3300049583 Bacteria 38386
507 Ga0501068_0004552 3300049584 Bacteria 7543
508 Ga0501070_0288105 3300049586 Bacteria 1339
509 Ga0501072_0255156 3300049588 Bacteria 1396
510 Ga0501073_0000002 3300049589 Bacteria 323865
511 Ga0501077_0000002 3300049593 Bacteria 159855
512 Ga0501223_000016 3300049663 Bacteria 68443
513 Ga0501225_0000013 3300049705 Bacteria 71839
514 Ga0501079_0122464 3300049741 Bacteria 2023
515 Ga0501080_0007490 3300049742 Bacteria 9856
516 Ga0501080_0008841 3300049742 Bacteria 9157
517 Ga0501080_0150946 3300049742 Bacteria 2147
518 Ga0501080_0417665 3300049742 Bacteria 1205
519 Ga0501035_0098701 3300049822 Bacteria 2564
520 Ga0501035_0177734 3300049822 Bacteria 1835
521 Ga0501044_0002054 3300049823 Bacteria 23229
522 Ga0501044_0011991 3300049823 Bacteria 9391
523 Ga0501044_0142097 3300049823 Bacteria 2388
524 Ga0501044_0572839 3300049823 Bacteria 1024
525 Ga0501045_0317586 3300049824 Bacteria 1159
526 nmdc:mga03683_677_c1 3300050489 Bacteria 9814
527 nmdc:mga03683_81581_c1 3300050489 Bacteria 1397
528 nmdc:mga03683_94934_c2 3300050489 Bacteria 1104
529 nmdc:mga03n38_501027_c1 3300050490 Bacteria 681
530 nmdc:mga00v17_205339_c2 3300050491 Bacteria 953
531 nmdc:mga0yw44_146900_c1 3300050492 Bacteria 1536
532 nmdc:mga0yw44_50534_c1 3300050492 Bacteria 2514
533 nmdc:mga0yw44_6639_c1 3300050492 Bacteria 5609
534 nmdc:mga0k408_60678_c1 3300050493 Bacteria 2198
535 nmdc:mga06z11_12916_c1 3300050494 Bacteria 3647
536 nmdc:mga06z11_302940_c1 3300050494 Bacteria 950
537 nmdc:mga07m45_29809_c1 3300050496 Bacteria 3020
538 nmdc:mga07m45_49578_c1 3300050496 Bacteria 2363
539 nmdc:mga0sz30_157021_c1 3300050516 Bacteria 1007
540 nmdc:mga0sz30_365228_c1 3300050516 Bacteria 646
541 nmdc:mga0sz30_51994_c1 3300050516 Bacteria 733
542 Ga0500635_0077720 3300053080 Bacteria 1187
543 Ga0500578_0001569 3300053086 Bacteria 22315
544 Ga0500644_0000124 3300053088 Bacteria 47262
545 Ga0500644_0011700 3300053088 Bacteria 2406
546 Ga0500647_0059977 3300053091 Bacteria 1830
547 Ga0500641_0001391 3300053096 Bacteria 8622
548 Ga0500641_0002845 3300053096 Bacteria 6134
549 Ga0500641_0207998 3300053096 Bacteria 833
550 Ga0500557_000037 3300053105 Bacteria 71114
551 Ga0500595_013338 3300053119 Bacteria 3151
552 Ga0500595_045822 3300053119 Bacteria 1379
553 Ga0500597_187287 3300053120 Bacteria 875
554 Ga0500608_109785 3300053122 Bacteria 1266
555 Ga0500618_000159 3300053125 Bacteria 56114
556 Ga0500642_0000062 3300053130 Bacteria 58970
557 Ga0500642_0234454 3300053130 Bacteria 847
558 Ga0500655_002616 3300053133 Bacteria 3265
559 Ga0500658_0000535 3300053134 Bacteria 16034
560 Ga0500658_0002725 3300053134 Bacteria 6792
561 Ga0500658_0055148 3300053134 Bacteria 1635
562 Ga0500559_0004938 3300053136 Bacteria 6202
563 Ga0500564_000063 3300053138 Bacteria 28411
564 Ga0500568_0008465 3300053139 Bacteria 4951
565 Ga0500568_0087537 3300053139 Bacteria 1177
566 Ga0500577_0016443 3300053142 Bacteria 2332
567 Ga0500588_0017563 3300053146 Bacteria 1870
568 Ga0500616_0001113 3300053153 Bacteria 27764
569 Ga0500616_0005558 3300053153 Bacteria 8531
570 Ga0500616_0028588 3300053153 Bacteria 3071
571 Ga0500616_0040457 3300053153 Bacteria 2507
572 Ga0500622_0000643 3300053156 Bacteria 31235
573 Ga0500622_0051446 3300053156 Bacteria 2120
574 Ga0500622_0137762 3300053156 Bacteria 1167
575 Ga0500627_0024296 3300053158 Bacteria 2478
576 Ga0500625_001277 3300053729 Bacteria 8427
577 Ga0500645_020054 3300053730 Bacteria 2074
578 Ga0500552_000050 3300053733 Bacteria 9891
579 Ga0500601_004278 3300053737 Bacteria 1552
580 Ga0501084_0656549 3300054114 Bacteria 885
581 Ga0501082_0266158 3300060353 Bacteria 1492

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053120 Ga0500597_187287 Ga0500597_187287_290_850 162
2 3300049575 Ga0501039_0861865 Ga0501039_0861865_77_685 167
3 3300005618 Ga0068864_100000145 Ga0068864_10000014553 169
4 3300005842 Ga0068858_100000268 Ga0068858_1000002687 169
5 3300013306 Ga0163162_10010851 Ga0163162_100108517 169
6 3300025315 Ga0207697_10003663 Ga0207697_100036634 169
7 3300025941 Ga0207711_10003775 Ga0207711_100037759 169
8 3300026035 Ga0207703_10000139 Ga0207703_1000013935 169
9 3300026095 Ga0207676_10000072 Ga0207676_1000007281 169
10 3300048905 Ga0496102_0603393 Ga0496102_0603393_176_781 169
11 3300048920 Ga0496117_0147720 Ga0496117_0147720_818_1384 169
12 3300053091 Ga0500647_0059977 Ga0500647_0059977_610_1203 173
13 3300053105 Ga0500557_000037 Ga0500557_000037_58009_58602 173
14 3300053130 Ga0500642_0000062 Ga0500642_0000062_37480_38073 173
15 3300053139 Ga0500568_0087537 Ga0500568_0087537_625_1161 175
16 3300025907 Ga0207645_10011653 Ga0207645_100116533 179
17 3300025934 Ga0207686_10093195 Ga0207686_100931953 179
18 3300025936 Ga0207670_10086377 Ga0207670_100863772 179
19 3300026089 Ga0207648_10015507 Ga0207648_100155075 179
20 3300035112 Ga0373932_0010219 Ga0373932_0010219_726_1388 179
21 3300035170 Ga0373943_0192908 Ga0373943_0192908_18_680 179
22 3300035695 Ga0373927_0118702 Ga0373927_0118702_435_1097 179
23 3300035724 Ga0373933_0120575 Ga0373933_0120575_879_1541 179
24 3300036401 Ga0373937_0355868 Ga0373937_0355868_14_676 179
25 3300005436 Ga0070713_100050973 Ga0070713_1000509733 180
26 3300005841 Ga0068863_100435322 Ga0068863_1004353222 180
27 3300005843 Ga0068860_100293462 Ga0068860_1002934622 180
28 3300005937 Ga0081455_10025838 Ga0081455_100258384 180
29 3300025928 Ga0207700_10049644 Ga0207700_100496443 180
30 3300035692 Ga0373935_0206502 Ga0373935_0206502_266_928 180
31 3300037068 Ga0373925_0072856 Ga0373925_0072856_1728_2390 180
32 3300028573 Ga0265334_10019555 Ga0265334_100195553 181
33 3300031247 Ga0265340_10038743 Ga0265340_100387433 181
34 3300049742 Ga0501080_0417665 Ga0501080_0417665_33_599 181
35 3300054114 Ga0501084_0656549 Ga0501084_0656549_17_583 181
36 3300037471 Ga0395905_1402245 Ga0395905_1402245_11_577 183
37 3300044842 Ga0466957_0087234 Ga0466957_0087234_1309_1938 183
38 3300046507 Ga0495606_0123365 Ga0495606_0123365_563_1114 183
39 3300049581 Ga0501047_0065286 Ga0501047_0065286_2869_3495 183
40 3300050490 nmdc:mga03n38_501027_c1 nmdc:mga03n38_501027_c1_17_646 183
41 3300053119 Ga0500595_045822 Ga0500595_045822_13_603 183
42 iso_pu_bacteria 8016557553 8016557688 183
43 3300021361 Ga0213872_10001875 Ga0213872_1000187510 187
44 3300039447 Ga0436361_0713206 Ga0436361_0713206_4410_5003 187
45 3300048920 Ga0496117_0024048 Ga0496117_0024048_882_1523 187
46 3300048921 Ga0496118_0012069 Ga0496118_0012069_2756_3397 187
47 3300005328 Ga0070676_10079147 Ga0070676_100791472 188
48 3300005334 Ga0068869_100226785 Ga0068869_1002267852 188
49 3300005338 Ga0068868_100052577 Ga0068868_1000525772 188
50 3300005340 Ga0070689_100110657 Ga0070689_1001106573 188
51 3300005364 Ga0070673_100022431 Ga0070673_1000224311 188
52 3300005459 Ga0068867_100006768 Ga0068867_1000067684 188
53 3300005617 Ga0068859_100315980 Ga0068859_1003159803 188
54 3300005840 Ga0068870_10289216 Ga0068870_102892162 188
55 3300006931 Ga0097620_100315967 Ga0097620_1003159671 188
56 3300009098 Ga0105245_10816277 Ga0105245_108162771 188
57 3300009148 Ga0105243_10004582 Ga0105243_100045827 188
58 3300009148 Ga0105243_10038746 Ga0105243_100387465 188
59 3300009176 Ga0105242_10032335 Ga0105242_100323355 188
60 3300010375 Ga0105239_10857585 Ga0105239_108575852 188
61 3300025899 Ga0207642_10099987 Ga0207642_100999872 188
62 3300025908 Ga0207643_10134643 Ga0207643_101346432 188
63 3300025927 Ga0207687_10566003 Ga0207687_105660031 188
64 3300025942 Ga0207689_10076936 Ga0207689_100769362 188
65 3300025960 Ga0207651_10022119 Ga0207651_100221195 188
66 3300026023 Ga0207677_10315556 Ga0207677_103155561 188
67 3300053153 Ga0500616_0001113 Ga0500616_0001113_24701_25363 188
68 3300005578 Ga0068854_101139563 Ga0068854_1011395631 190
69 3300053729 Ga0500625_001277 Ga0500625_001277_431_1024 190
70 iso_pu_bacteria 2510917020 2511124978 190
71 iso_pu_bacteria 2643221545 2643747599 190
72 iso_pu_bacteria 2643221552 2643781784 190
73 iso_pu_bacteria 2643221583 2643922349 190
74 iso_pu_bacteria 2643221584 2643931972 190
75 iso_pu_bacteria 2643221614 2644087620 190
76 iso_pu_bacteria 2643221661 2644344336 190
77 iso_pu_bacteria 2643221666 2644366979 190
78 iso_pu_bacteria 2643221691 2644507019 190
79 iso_pu_bacteria 2885429604 2885432360 190
80 iso_pu_bacteria 2935769743 2935773053 190
81 iso_pu_bacteria 2935777560 2935782996 190
82 iso_pu_bacteria 2935785616 2935787958 190
83 iso_pu_bacteria 2935793552 2935796466 190
84 iso_pu_bacteria 8016522445 8016526128 190
85 iso_pu_bacteria 8016530956 8016539740 190
86 iso_pu_bacteria 8016539877 8016544044 190
87 iso_pu_bacteria 8016566248 8016569448 190
88 iso_pu_bacteria 8016575299 8016582062 190
89 iso_pu_bacteria 8016595262 8016595721 190
90 iso_pu_bacteria 8016603502 8016606577 190
91 iso_pu_bacteria 8016613128 8016618478 190
92 iso_pu_bacteria 8016622563 8016623170 190
93 iso_pu_bacteria 8019530166 8019531016 190
94 iso_pu_bacteria 8019538911 8019540566 190
95 iso_pu_bacteria 8019547302 8019550186 190
96 iso_pu_bacteria 8057101203 8057105371 190
97 3300005289 Ga0065704_10095571 Ga0065704_100955713 191
98 3300005353 Ga0070669_100013132 Ga0070669_1000131325 191
99 3300009147 Ga0114129_10158182 Ga0114129_101581823 191
100 3300009978 Ga0105148_100032 Ga0105148_10003217 191
101 3300009982 Ga0105147_101839 Ga0105147_1018392 191
102 3300014326 Ga0157380_10106285 Ga0157380_101062851 191
103 3300025923 Ga0207681_10010984 Ga0207681_100109844 191
104 3300049663 Ga0501223_000016 Ga0501223_000016_9767_10360 191
105 3300049705 Ga0501225_0000013 Ga0501225_0000013_9793_10386 191
106 3300005344 Ga0070661_100101670 Ga0070661_1001016702 192
107 3300005434 Ga0070709_10875616 Ga0070709_108756161 192
108 3300005435 Ga0070714_100088018 Ga0070714_1000880183 192
109 3300005436 Ga0070713_100026964 Ga0070713_1000269644 192
110 3300005445 Ga0070708_100075119 Ga0070708_1000751194 192
111 3300005458 Ga0070681_11096181 Ga0070681_110961811 192
112 3300005563 Ga0068855_100000106 Ga0068855_10000010615 192
113 3300005616 Ga0068852_100087292 Ga0068852_1000872922 192
114 3300006028 Ga0070717_11097182 Ga0070717_110971821 192
115 3300006175 Ga0070712_100233774 Ga0070712_1002337742 192
116 3300007788 Ga0099795_10008993 Ga0099795_100089933 192
117 3300009093 Ga0105240_10000653 Ga0105240_1000065324 192
118 3300009174 Ga0105241_10372821 Ga0105241_103728212 192
119 3300009551 Ga0105238_10024421 Ga0105238_100244215 192
120 3300010375 Ga0105239_10001093 Ga0105239_1000109311 192
121 3300010375 Ga0105239_10010429 Ga0105239_100104295 192
122 3300013105 Ga0157369_10001360 Ga0157369_1000136029 192
123 3300013105 Ga0157369_10022866 Ga0157369_100228665 192
124 3300013297 Ga0157378_10058417 Ga0157378_100584174 192
125 3300013307 Ga0157372_10441289 Ga0157372_104412892 192
126 3300025905 Ga0207685_10095357 Ga0207685_100953572 192
127 3300025906 Ga0207699_10181880 Ga0207699_101818803 192
128 3300025911 Ga0207654_10059863 Ga0207654_100598633 192
129 3300025913 Ga0207695_10000012 Ga0207695_10000012379 192
130 3300025914 Ga0207671_10075442 Ga0207671_100754423 192
131 3300025920 Ga0207649_10039885 Ga0207649_100398852 192
132 3300025924 Ga0207694_10000006 Ga0207694_10000006286 192
133 3300025928 Ga0207700_10073302 Ga0207700_100733024 192
134 3300025929 Ga0207664_10019693 Ga0207664_100196933 192
135 3300025949 Ga0207667_10000232 Ga0207667_1000023270 192
136 3300026041 Ga0207639_10032885 Ga0207639_100328854 192
137 3300026142 Ga0207698_10570779 Ga0207698_105707792 192
138 3300027512 Ga0209179_1001197 Ga0209179_10011973 192
139 3300031730 Ga0307516_10008284 Ga0307516_100082849 192
140 3300035113 Ga0373936_0036750 Ga0373936_0036750_360_959 192
141 3300035724 Ga0373933_0584888 Ga0373933_0584888_112_711 192
142 3300046477 Ga0495664_0052829 Ga0495664_0052829_1381_1986 192
143 3300046529 Ga0495652_0041492 Ga0495652_0041492_1438_2043 192
144 3300046543 Ga0495645_0057285 Ga0495645_0057285_328_933 192
145 3300048903 Ga0496100_0352809 Ga0496100_0352809_495_1094 192
146 3300048905 Ga0496102_0055568 Ga0496102_0055568_346_1002 192
147 3300048918 Ga0496115_0035271 Ga0496115_0035271_2169_2768 192
148 3300048918 Ga0496115_0164218 Ga0496115_0164218_961_1617 192
149 3300048922 Ga0496119_0033642 Ga0496119_0033642_1679_2278 192
150 3300049460 Ga0495682_0005183 Ga0495682_0005183_1197_1802 192
151 3300049568 Ga0501031_0129082 Ga0501031_0129082_43_642 192
152 3300049569 Ga0501032_0214904 Ga0501032_0214904_42_641 192
153 3300049571 Ga0501034_0044338 Ga0501034_0044338_3278_3877 192
154 3300049571 Ga0501034_0111394 Ga0501034_0111394_1517_2116 192
155 3300049571 Ga0501034_0182488 Ga0501034_0182488_290_889 192
156 3300049572 Ga0501036_0313510 Ga0501036_0313510_126_725 192
157 3300049573 Ga0501037_0038198 Ga0501037_0038198_1445_2044 192
158 3300049574 Ga0501038_0006869 Ga0501038_0006869_2080_2679 192
159 3300049574 Ga0501038_0045822 Ga0501038_0045822_2218_2817 192
160 3300049575 Ga0501039_0096681 Ga0501039_0096681_371_970 192
161 3300049579 Ga0501043_0022014 Ga0501043_0022014_1276_1875 192
162 3300049581 Ga0501047_0039366 Ga0501047_0039366_1484_2083 192
163 3300049586 Ga0501070_0288105 Ga0501070_0288105_458_1057 192
164 3300049588 Ga0501072_0255156 Ga0501072_0255156_115_714 192
165 3300049822 Ga0501035_0177734 Ga0501035_0177734_351_950 192
166 3300049823 Ga0501044_0011991 Ga0501044_0011991_1446_2045 192
167 3300053133 Ga0500655_002616 Ga0500655_002616_1675_2280 192
168 iso_pu_bacteria 2844315083 2844315327 192
169 iso_pu_bacteria 2903727486 2903732188 192
170 iso_pu_bacteria 2906602504 2906604265 192
171 iso_pu_bacteria 8016583857 8016586388 192
172 iso_pu_bacteria 8056967851 8056971279 192
173 3300005985 Ga0081539_10004087 Ga0081539_1000408713 193
174 3300009093 Ga0105240_10279200 Ga0105240_102792002 193
175 3300013307 Ga0157372_10090362 Ga0157372_100903623 193
176 3300031901 Ga0307406_10873694 Ga0307406_108736941 193
177 3300046507 Ga0495606_0213940 Ga0495606_0213940_92_679 193
178 3300003214 JGI25165J46597_1000010 JGI25165J46597_100001087 194
179 3300003790 Ga0055528_1006962 Ga0055528_10069623 194
180 3300003791 Ga0055530_10000313 Ga0055530_100003132 194
181 3300003791 Ga0055530_10002661 Ga0055530_100026617 194
182 3300003791 Ga0055530_10011004 Ga0055530_100110044 194
183 3300003794 Ga0055531_10002220 Ga0055531_100022209 194
184 3300003794 Ga0055531_10002388 Ga0055531_100023883 194
185 3300004625 Ga0055543_1033061 Ga0055543_10330611 194
186 3300005262 Ga0065165_1004438 Ga0065165_10044388 194
187 3300005262 Ga0065165_1005530 Ga0065165_10055308 194
188 3300005288 Ga0065714_10070296 Ga0065714_100702964 194
189 3300005327 Ga0070658_10312691 Ga0070658_103126912 194
190 3300005327 Ga0070658_10704365 Ga0070658_107043652 194
191 3300005329 Ga0070683_100084538 Ga0070683_1000845382 194
192 3300005330 Ga0070690_100177317 Ga0070690_1001773172 194
193 3300005331 Ga0070670_100373687 Ga0070670_1003736872 194
194 3300005336 Ga0070680_100001568 Ga0070680_10000156814 194
195 3300005339 Ga0070660_100019186 Ga0070660_1000191862 194
196 3300005339 Ga0070660_100100854 Ga0070660_1001008542 194
197 3300005339 Ga0070660_100240389 Ga0070660_1002403892 194
198 3300005340 Ga0070689_100072602 Ga0070689_1000726024 194
199 3300005347 Ga0070668_100011541 Ga0070668_1000115412 194
200 3300005353 Ga0070669_100214729 Ga0070669_1002147292 194
201 3300005353 Ga0070669_100308543 Ga0070669_1003085432 194
202 3300005353 Ga0070669_100584435 Ga0070669_1005844352 194
203 3300005355 Ga0070671_100045879 Ga0070671_1000458792 194
204 3300005355 Ga0070671_100079556 Ga0070671_1000795562 194
205 3300005355 Ga0070671_100355050 Ga0070671_1003550502 194
206 3300005365 Ga0070688_100134573 Ga0070688_1001345732 194
207 3300005366 Ga0070659_100000552 Ga0070659_10000055222 194
208 3300005366 Ga0070659_100006406 Ga0070659_1000064062 194
209 3300005437 Ga0070710_10367711 Ga0070710_103677112 194
210 3300005445 Ga0070708_100112540 Ga0070708_1001125404 194
211 3300005456 Ga0070678_101132543 Ga0070678_1011325431 194
212 3300005458 Ga0070681_10006651 Ga0070681_1000665112 194
213 3300005458 Ga0070681_10082542 Ga0070681_100825424 194
214 3300005467 Ga0070706_100282305 Ga0070706_1002823052 194
215 3300005468 Ga0070707_100091862 Ga0070707_1000918623 194
216 3300005471 Ga0070698_100025801 Ga0070698_1000258017 194
217 3300005471 Ga0070698_100912634 Ga0070698_1009126341 194
218 3300005530 Ga0070679_100007418 Ga0070679_10000741811 194
219 3300005530 Ga0070679_100009290 Ga0070679_1000092903 194
220 3300005535 Ga0070684_100024078 Ga0070684_1000240781 194
221 3300005539 Ga0068853_100011535 Ga0068853_1000115358 194
222 3300005539 Ga0068853_100466573 Ga0068853_1004665732 194
223 3300005546 Ga0070696_100227093 Ga0070696_1002270932 194
224 3300005548 Ga0070665_100000721 Ga0070665_10000072116 194
225 3300005548 Ga0070665_100109205 Ga0070665_1001092053 194
226 3300005548 Ga0070665_100186845 Ga0070665_1001868452 194
227 3300005563 Ga0068855_100024646 Ga0068855_1000246467 194
228 3300005563 Ga0068855_100044020 Ga0068855_1000440202 194
229 3300005563 Ga0068855_100126544 Ga0068855_1001265443 194
230 3300005563 Ga0068855_100257990 Ga0068855_1002579903 194
231 3300005563 Ga0068855_100310443 Ga0068855_1003104432 194
232 3300005563 Ga0068855_100783661 Ga0068855_1007836612 194
233 3300005563 Ga0068855_100864294 Ga0068855_1008642941 194
234 3300005564 Ga0070664_100120880 Ga0070664_1001208803 194
235 3300005577 Ga0068857_100078940 Ga0068857_1000789404 194
236 3300005577 Ga0068857_100121908 Ga0068857_1001219082 194
237 3300005578 Ga0068854_100607081 Ga0068854_1006070812 194
238 3300005614 Ga0068856_100072284 Ga0068856_1000722842 194
239 3300005614 Ga0068856_100146970 Ga0068856_1001469702 194
240 3300005617 Ga0068859_100518643 Ga0068859_1005186432 194
241 3300005618 Ga0068864_100062794 Ga0068864_1000627944 194
242 3300005618 Ga0068864_100106924 Ga0068864_1001069243 194
243 3300005618 Ga0068864_100550283 Ga0068864_1005502832 194
244 3300005841 Ga0068863_100103825 Ga0068863_1001038253 194
245 3300005841 Ga0068863_100234406 Ga0068863_1002344062 194
246 3300005842 Ga0068858_100000370 Ga0068858_1000003703 194
247 3300005842 Ga0068858_100328887 Ga0068858_1003288872 194
248 3300005937 Ga0081455_10004620 Ga0081455_1000462016 194
249 3300006048 Ga0075363_100008814 Ga0075363_1000088143 194
250 3300006048 Ga0075363_100308207 Ga0075363_1003082072 194
251 3300006051 Ga0075364_10199401 Ga0075364_101994012 194
252 3300006058 Ga0075432_10103145 Ga0075432_101031452 194
253 3300006177 Ga0075362_10004771 Ga0075362_100047712 194
254 3300006177 Ga0075362_10081232 Ga0075362_100812322 194
255 3300006177 Ga0075362_10088078 Ga0075362_100880782 194
256 3300006178 Ga0075367_10051804 Ga0075367_100518043 194
257 3300006186 Ga0075369_10001444 Ga0075369_100014445 194
258 3300006186 Ga0075369_10109805 Ga0075369_101098052 194
259 3300006186 Ga0075369_10163993 Ga0075369_101639931 194
260 3300006195 Ga0075366_10018266 Ga0075366_100182662 194
261 3300006358 Ga0068871_100687960 Ga0068871_1006879602 194
262 3300006881 Ga0068865_100012939 Ga0068865_1000129394 194
263 3300006931 Ga0097620_100518625 Ga0097620_1005186252 194
264 3300009093 Ga0105240_10001036 Ga0105240_1000103626 194
265 3300009093 Ga0105240_10026858 Ga0105240_1002685812 194
266 3300009093 Ga0105240_10197974 Ga0105240_101979743 194
267 3300009093 Ga0105240_10279462 Ga0105240_102794622 194
268 3300009093 Ga0105240_10873512 Ga0105240_108735121 194
269 3300009098 Ga0105245_10074248 Ga0105245_100742485 194
270 3300009098 Ga0105245_10235411 Ga0105245_102354112 194
271 3300009148 Ga0105243_10133977 Ga0105243_101339773 194
272 3300009176 Ga0105242_10652101 Ga0105242_106521012 194
273 3300009176 Ga0105242_10653111 Ga0105242_106531112 194
274 3300009177 Ga0105248_10000650 Ga0105248_1000065052 194
275 3300009177 Ga0105248_10108725 Ga0105248_101087254 194
276 3300009177 Ga0105248_11026339 Ga0105248_110263392 194
277 3300009545 Ga0105237_10022290 Ga0105237_100222908 194
278 3300009545 Ga0105237_10567538 Ga0105237_105675382 194
279 3300009551 Ga0105238_10070858 Ga0105238_100708584 194
280 3300009553 Ga0105249_10503820 Ga0105249_105038201 194
281 3300009988 Ga0105035_103614 Ga0105035_1036141 194
282 3300010375 Ga0105239_10000319 Ga0105239_1000031926 194
283 3300010375 Ga0105239_11349662 Ga0105239_113496622 194
284 3300013296 Ga0157374_10464244 Ga0157374_104642442 194
285 3300013297 Ga0157378_10920047 Ga0157378_109200472 194
286 3300013297 Ga0157378_11276722 Ga0157378_112767222 194
287 3300013306 Ga0163162_10684485 Ga0163162_106844852 194
288 3300014325 Ga0163163_10050842 Ga0163163_100508423 194
289 3300014969 Ga0157376_10438578 Ga0157376_104385782 194
290 3300014969 Ga0157376_11278281 Ga0157376_112782811 194
291 3300015690 Ga0183363_1003 Ga0183363_100383 194
292 3300020082 Ga0206353_11944051 Ga0206353_119440511 194
293 3300021358 Ga0213873_10038716 Ga0213873_100387162 194
294 3300025254 Ga0209148_1013603 Ga0209148_10136032 194
295 3300025261 Ga0209233_1000044 Ga0209233_1000044396 194
296 3300025263 Ga0209565_1001350 Ga0209565_10013508 194
297 3300025273 Ga0209673_1000732 Ga0209673_10007328 194
298 3300025273 Ga0209673_1037096 Ga0209673_10370962 194
299 3300025291 Ga0209675_1008215 Ga0209675_10082152 194
300 3300025292 Ga0209676_1000257 Ga0209676_10002578 194
301 3300025292 Ga0209676_1000316 Ga0209676_100031695 194
302 3300025295 Ga0209564_1004512 Ga0209564_10045123 194
303 3300025295 Ga0209564_1033760 Ga0209564_10337602 194
304 3300025297 Ga0209758_1002581 Ga0209758_10025814 194
305 3300025297 Ga0209758_1002904 Ga0209758_10029042 194
306 3300025297 Ga0209758_1004448 Ga0209758_10044487 194
307 3300025298 Ga0209050_1000053 Ga0209050_100005392 194
308 3300025298 Ga0209050_1003986 Ga0209050_10039867 194
309 3300025298 Ga0209050_1012713 Ga0209050_10127132 194
310 3300025299 Ga0209256_1003727 Ga0209256_10037274 194
311 3300025299 Ga0209256_1004379 Ga0209256_10043793 194
312 3300025299 Ga0209256_1017316 Ga0209256_10173163 194
313 3300025302 Ga0207426_1068214 Ga0207426_10682142 194
314 3300025303 Ga0209051_1024329 Ga0209051_10243292 194
315 3300025304 Ga0209257_1000419 Ga0209257_100041956 194
316 3300025304 Ga0209257_1000624 Ga0209257_10006248 194
317 3300025304 Ga0209257_1004976 Ga0209257_10049768 194
318 3300025304 Ga0209257_1012949 Ga0209257_10129492 194
319 3300025321 Ga0207656_10167158 Ga0207656_101671582 194
320 3300025909 Ga0207705_10001218 Ga0207705_1000121812 194
321 3300025909 Ga0207705_10035160 Ga0207705_100351603 194
322 3300025909 Ga0207705_10181237 Ga0207705_101812372 194
323 3300025912 Ga0207707_10004282 Ga0207707_100042828 194
324 3300025912 Ga0207707_10027285 Ga0207707_100272853 194
325 3300025912 Ga0207707_10840626 Ga0207707_108406261 194
326 3300025913 Ga0207695_10000867 Ga0207695_1000086731 194
327 3300025913 Ga0207695_10134575 Ga0207695_101345752 194
328 3300025913 Ga0207695_10189443 Ga0207695_101894432 194
329 3300025913 Ga0207695_10299135 Ga0207695_102991352 194
330 3300025913 Ga0207695_10333651 Ga0207695_103336512 194
331 3300025914 Ga0207671_10000924 Ga0207671_1000092432 194
332 3300025916 Ga0207663_10451518 Ga0207663_104515182 194
333 3300025917 Ga0207660_10001115 Ga0207660_1000111521 194
334 3300025917 Ga0207660_10021743 Ga0207660_100217433 194
335 3300025919 Ga0207657_10000235 Ga0207657_1000023540 194
336 3300025919 Ga0207657_10136206 Ga0207657_101362062 194
337 3300025919 Ga0207657_10156761 Ga0207657_101567612 194
338 3300025920 Ga0207649_10042655 Ga0207649_100426552 194
339 3300025921 Ga0207652_10011897 Ga0207652_100118975 194
340 3300025921 Ga0207652_10097115 Ga0207652_100971151 194
341 3300025922 Ga0207646_10220796 Ga0207646_102207961 194
342 3300025923 Ga0207681_10298999 Ga0207681_102989991 194
343 3300025923 Ga0207681_10389112 Ga0207681_103891122 194
344 3300025923 Ga0207681_10693573 Ga0207681_106935732 194
345 3300025924 Ga0207694_10040482 Ga0207694_100404824 194
346 3300025924 Ga0207694_10252701 Ga0207694_102527012 194
347 3300025926 Ga0207659_10038717 Ga0207659_100387172 194
348 3300025927 Ga0207687_10023768 Ga0207687_100237686 194
349 3300025931 Ga0207644_10050854 Ga0207644_100508542 194
350 3300025931 Ga0207644_10057973 Ga0207644_100579734 194
351 3300025932 Ga0207690_10000031 Ga0207690_10000031103 194
352 3300025932 Ga0207690_10014019 Ga0207690_100140195 194
353 3300025936 Ga0207670_10425825 Ga0207670_104258252 194
354 3300025938 Ga0207704_10026283 Ga0207704_100262834 194
355 3300025941 Ga0207711_10019608 Ga0207711_100196088 194
356 3300025941 Ga0207711_10186618 Ga0207711_101866182 194
357 3300025941 Ga0207711_10324013 Ga0207711_103240132 194
358 3300025944 Ga0207661_10068810 Ga0207661_100688102 194
359 3300025945 Ga0207679_10037465 Ga0207679_100374654 194
360 3300025945 Ga0207679_10702340 Ga0207679_107023402 194
361 3300025949 Ga0207667_10020506 Ga0207667_100205067 194
362 3300025949 Ga0207667_10094923 Ga0207667_100949234 194
363 3300025949 Ga0207667_10174431 Ga0207667_101744312 194
364 3300025972 Ga0207668_10005922 Ga0207668_100059229 194
365 3300026023 Ga0207677_10044056 Ga0207677_100440563 194
366 3300026023 Ga0207677_10360875 Ga0207677_103608752 194
367 3300026035 Ga0207703_10018753 Ga0207703_100187537 194
368 3300026035 Ga0207703_10939435 Ga0207703_109394351 194
369 3300026041 Ga0207639_10003312 Ga0207639_100033128 194
370 3300026075 Ga0207708_10364087 Ga0207708_103640872 194
371 3300026078 Ga0207702_10025007 Ga0207702_100250075 194
372 3300026078 Ga0207702_10372379 Ga0207702_103723792 194
373 3300026088 Ga0207641_10083786 Ga0207641_100837862 194
374 3300026088 Ga0207641_10118764 Ga0207641_101187642 194
375 3300026095 Ga0207676_10002933 Ga0207676_1000293310 194
376 3300026095 Ga0207676_10047480 Ga0207676_100474803 194
377 3300026095 Ga0207676_10359021 Ga0207676_103590212 194
378 3300026095 Ga0207676_10502047 Ga0207676_105020472 194
379 3300026116 Ga0207674_10039095 Ga0207674_100390956 194
380 3300026116 Ga0207674_10197160 Ga0207674_101971602 194
381 3300026116 Ga0207674_10225711 Ga0207674_102257112 194
382 3300026121 Ga0207683_10043941 Ga0207683_100439415 194
383 3300026121 Ga0207683_10663012 Ga0207683_106630122 194
384 3300028379 Ga0268266_10000003 Ga0268266_100000031436 194
385 3300028379 Ga0268266_10169666 Ga0268266_101696662 194
386 3300028379 Ga0268266_10237597 Ga0268266_102375972 194
387 3300028379 Ga0268266_10562428 Ga0268266_105624282 194
388 3300028577 Ga0265318_10051209 Ga0265318_100512092 194
389 3300028786 Ga0307517_10014862 Ga0307517_100148621 194
390 3300028786 Ga0307517_10078685 Ga0307517_100786852 194
391 3300028794 Ga0307515_10278160 Ga0307515_102781602 194
392 3300030521 Ga0307511_10124969 Ga0307511_101249691 194
393 3300031238 Ga0265332_10009706 Ga0265332_100097065 194
394 3300031239 Ga0265328_10015573 Ga0265328_100155734 194
395 3300031241 Ga0265325_10009030 Ga0265325_100090302 194
396 3300031241 Ga0265325_10053670 Ga0265325_100536702 194
397 3300031242 Ga0265329_10085737 Ga0265329_100857372 194
398 3300031249 Ga0265339_10009621 Ga0265339_100096214 194
399 3300031249 Ga0265339_10207300 Ga0265339_102073002 194
400 3300031250 Ga0265331_10052420 Ga0265331_100524202 194
401 3300031344 Ga0265316_10019515 Ga0265316_100195153 194
402 3300031344 Ga0265316_10062585 Ga0265316_100625852 194
403 3300031344 Ga0265316_10064176 Ga0265316_100641764 194
404 3300031344 Ga0265316_10104167 Ga0265316_101041674 194
405 3300031456 Ga0307513_10067935 Ga0307513_100679354 194
406 3300031507 Ga0307509_10164056 Ga0307509_101640562 194
407 3300031595 Ga0265313_10018163 Ga0265313_100181634 194
408 3300031616 Ga0307508_10000363 Ga0307508_100003634 194
409 3300031711 Ga0265314_10002040 Ga0265314_1000204021 194
410 3300031711 Ga0265314_10193112 Ga0265314_101931122 194
411 3300031712 Ga0265342_10011415 Ga0265342_100114152 194
412 3300031712 Ga0265342_10311868 Ga0265342_103118681 194
413 3300032005 Ga0307411_11144187 Ga0307411_111441871 194
414 3300033180 Ga0307510_10007759 Ga0307510_100077599 194
415 3300033180 Ga0307510_10062006 Ga0307510_100620062 194
416 3300035113 Ga0373936_0013344 Ga0373936_0013344_1032_1655 194
417 3300035115 Ga0373941_0150430 Ga0373941_0150430_156_818 194
418 3300035116 Ga0373945_0121419 Ga0373945_0121419_205_825 194
419 3300035170 Ga0373943_0307338 Ga0373943_0307338_180_803 194
420 3300035171 Ga0373946_0022218 Ga0373946_0022218_1250_1873 194
421 3300035695 Ga0373927_0000111 Ga0373927_0000111_25952_26575 194
422 3300035725 Ga0373947_0457242 Ga0373947_0457242_193_855 194
423 3300036401 Ga0373937_0068079 Ga0373937_0068079_2157_2768 194
424 3300036401 Ga0373937_0503916 Ga0373937_0503916_76_696 194
425 3300036401 Ga0373937_0597210 Ga0373937_0597210_106_768 194
426 3300037068 Ga0373925_0000209 Ga0373925_0000209_37525_38148 194
427 3300037312 Ga0395899_0027888 Ga0395899_0027888_1657_2319 194
428 3300037312 Ga0395899_0101588 Ga0395899_0101588_298_960 194
429 3300037312 Ga0395899_0331687 Ga0395899_0331687_343_966 194
430 3300037418 Ga0395900_0018770 Ga0395900_0018770_4452_5114 194
431 3300037418 Ga0395900_0123260 Ga0395900_0123260_488_1150 194
432 3300037466 Ga0395898_0020960 Ga0395898_0020960_4183_4845 194
433 3300037471 Ga0395905_0674269 Ga0395905_0674269_99_710 194
434 3300038443 Ga0395901_0003268 Ga0395901_0003268_565_1227 194
435 3300038443 Ga0395901_0025165 Ga0395901_0025165_4813_5475 194
436 3300039062 Ga0400483_051524 Ga0400483_051524_5431_6075 194
437 3300039062 Ga0400483_191709 Ga0400483_191709_2620_3270 194
438 3300039062 Ga0400483_292171 Ga0400483_292171_26226_26870 194
439 3300039437 Ga0436365_1045950 Ga0436365_1045950_671_1333 194
440 3300039438 Ga0436360_1158525 Ga0436360_1158525_2216_2878 194
441 3300039447 Ga0436361_0264740 Ga0436361_0264740_775_1437 194
442 3300039453 Ga0436362_0322257 Ga0436362_0322257_228_866 194
443 3300039453 Ga0436362_0969158 Ga0436362_0969158_323_985 194
444 3300041452 Ga0451793_0054054 Ga0451793_0054054_73_687 194
445 3300041494 Ga0451837_0323595 Ga0451837_0323595_25_648 194
446 3300044683 Ga0466965_0027461 Ga0466965_0027461_1675_2274 194
447 3300046453 Ga0495627_001129 Ga0495627_001129_9595_10218 194
448 3300046460 Ga0495638_0000283 Ga0495638_0000283_61168_61761 194
449 3300046460 Ga0495638_0000402 Ga0495638_0000402_47607_48212 194
450 3300046460 Ga0495638_0063422 Ga0495638_0063422_616_1239 194
451 3300046471 Ga0495650_0020126 Ga0495650_0020126_2202_2825 194
452 3300046471 Ga0495650_0052121 Ga0495650_0052121_221_814 194
453 3300046501 Ga0495607_0065814 Ga0495607_0065814_248_871 194
454 3300046506 Ga0495583_0015556 Ga0495583_0015556_2211_2834 194
455 3300046512 Ga0495610_0001080 Ga0495610_0001080_19610_20233 194
456 3300046512 Ga0495610_0009812 Ga0495610_0009812_4722_5315 194
457 3300046513 Ga0495616_0001277 Ga0495616_0001277_10695_11318 194
458 3300046513 Ga0495616_0014302 Ga0495616_0014302_3688_4311 194
459 3300046516 Ga0495628_0170453 Ga0495628_0170453_727_1338 194
460 3300046519 Ga0495632_0040673 Ga0495632_0040673_431_1054 194
461 3300046520 Ga0495637_0016533 Ga0495637_0016533_2096_2689 194
462 3300046522 Ga0495643_0075995 Ga0495643_0075995_428_1051 194
463 3300046524 Ga0495648_0000107 Ga0495648_0000107_5672_6265 194
464 3300046524 Ga0495648_0128901 Ga0495648_0128901_413_1027 194
465 3300046525 Ga0495663_0010031 Ga0495663_0010031_1687_2292 194
466 3300046528 Ga0495642_0047425 Ga0495642_0047425_773_1384 194
467 3300046528 Ga0495642_0065568 Ga0495642_0065568_58_681 194
468 3300046530 Ga0495654_0000085 Ga0495654_0000085_66301_66924 194
469 3300046530 Ga0495654_0011867 Ga0495654_0011867_3729_4322 194
470 3300046538 Ga0495609_0019546 Ga0495609_0019546_1132_1755 194
471 3300046539 Ga0495621_0016449 Ga0495621_0016449_1551_2141 194
472 3300046542 Ga0495597_0019658 Ga0495597_0019658_508_1101 194
473 3300046543 Ga0495645_0091145 Ga0495645_0091145_912_1523 194
474 3300046557 Ga0495622_0003645 Ga0495622_0003645_350_961 194
475 3300046616 Ga0495668_0003283 Ga0495668_0003283_5485_6084 194
476 3300046616 Ga0495668_0004662 Ga0495668_0004662_7514_8137 194
477 3300046616 Ga0495668_0056179 Ga0495668_0056179_1164_1787 194
478 3300046616 Ga0495668_0121010 Ga0495668_0121010_271_861 194
479 3300046616 Ga0495668_0128845 Ga0495668_0128845_119_742 194
480 3300046648 Ga0495611_0026073 Ga0495611_0026073_424_1047 194
481 3300046660 Ga0495625_0000094 Ga0495625_0000094_100138_100734 194
482 3300046660 Ga0495625_0004558 Ga0495625_0004558_2792_3397 194
483 3300046660 Ga0495625_0005125 Ga0495625_0005125_4610_5233 194
484 3300046660 Ga0495625_0043451 Ga0495625_0043451_972_1571 194
485 3300046684 Ga0495669_0000007 Ga0495669_0000007_158645_159280 194
486 3300046684 Ga0495669_0000548 Ga0495669_0000548_3013_3612 194
487 3300046684 Ga0495669_0039434 Ga0495669_0039434_1065_1688 194
488 3300046691 Ga0495670_0043271 Ga0495670_0043271_1372_1965 194
489 3300046692 Ga0495671_0104953 Ga0495671_0104953_265_888 194
490 3300046692 Ga0495671_0121032 Ga0495671_0121032_145_738 194
491 3300046692 Ga0495671_0129725 Ga0495671_0129725_274_867 194
492 3300046694 Ga0495649_0119151 Ga0495649_0119151_160_771 194
493 3300046810 Ga0495660_0221685 Ga0495660_0221685_76_699 194
494 3300047320 Ga0495672_0001097 Ga0495672_0001097_7274_7897 194
495 3300047320 Ga0495672_0010571 Ga0495672_0010571_2411_3022 194
496 3300047445 Ga0495677_0051314 Ga0495677_0051314_369_992 194
497 3300047447 Ga0495685_084547 Ga0495685_084547_237_860 194
498 3300047469 Ga0495673_0000341 Ga0495673_0000341_56978_57601 194
499 3300047469 Ga0495673_0004118 Ga0495673_0004118_7424_8017 194
500 3300047469 Ga0495673_0005953 Ga0495673_0005953_6509_7132 194
501 3300047470 Ga0495681_0070282 Ga0495681_0070282_341_934 194
502 3300047472 Ga0495686_0001488 Ga0495686_0001488_4426_5019 194
503 3300047472 Ga0495686_0016399 Ga0495686_0016399_2201_2824 194
504 3300047472 Ga0495686_0019971 Ga0495686_0019971_2324_2947 194
505 3300047472 Ga0495686_0020535 Ga0495686_0020535_2806_3429 194
506 3300047472 Ga0495686_0107263 Ga0495686_0107263_744_1367 194
507 3300047472 Ga0495686_0133047 Ga0495686_0133047_319_942 194
508 3300048091 Ga0495626_0106649 Ga0495626_0106649_77_688 194
509 3300048904 Ga0496101_0040526 Ga0496101_0040526_77_700 194
510 3300048905 Ga0496102_0009500 Ga0496102_0009500_7552_8175 194
511 3300048905 Ga0496102_0549056 Ga0496102_0549056_224_847 194
512 3300048906 Ga0496103_0073496 Ga0496103_0073496_717_1340 194
513 3300048908 Ga0496105_0252394 Ga0496105_0252394_598_1221 194
514 3300048909 Ga0496106_0015315 Ga0496106_0015315_2285_2908 194
515 3300048909 Ga0496106_0490437 Ga0496106_0490437_82_705 194
516 3300048910 Ga0496107_0000085 Ga0496107_0000085_7443_8066 194
517 3300048912 Ga0496109_0072137 Ga0496109_0072137_699_1322 194
518 3300048913 Ga0496110_0287157 Ga0496110_0287157_520_1143 194
519 3300048915 Ga0496112_0035271 Ga0496112_0035271_2871_3494 194
520 3300048915 Ga0496112_0178251 Ga0496112_0178251_1377_2000 194
521 3300048916 Ga0496113_0091473 Ga0496113_0091473_10_633 194
522 3300048916 Ga0496113_0498165 Ga0496113_0498165_294_893 194
523 3300048918 Ga0496115_0000460 Ga0496115_0000460_5205_5828 194
524 3300048918 Ga0496115_0001891 Ga0496115_0001891_8118_8741 194
525 3300048918 Ga0496115_0004365 Ga0496115_0004365_6733_7356 194
526 3300048918 Ga0496115_0118132 Ga0496115_0118132_862_1446 194
527 3300048918 Ga0496115_0556584 Ga0496115_0556584_120_731 194
528 3300048924 Ga0496121_0001169 Ga0496121_0001169_37927_38550 194
529 3300048924 Ga0496121_0002347 Ga0496121_0002347_23671_24312 194
530 3300048924 Ga0496121_0002899 Ga0496121_0002899_19801_20442 194
531 3300048924 Ga0496121_0330283 Ga0496121_0330283_358_981 194
532 3300048927 Ga0496124_0009364 Ga0496124_0009364_6111_6710 194
533 3300048929 Ga0496126_0021909 Ga0496126_0021909_4995_5636 194
534 3300048929 Ga0496126_0023104 Ga0496126_0023104_2044_2706 194
535 3300049569 Ga0501032_0002943 Ga0501032_0002943_10004_10693 194
536 3300049570 Ga0501033_0049119 Ga0501033_0049119_280_876 194
537 3300049571 Ga0501034_0003075 Ga0501034_0003075_4769_5431 194
538 3300049571 Ga0501034_0015064 Ga0501034_0015064_2069_2803 194
539 3300049571 Ga0501034_0035945 Ga0501034_0035945_979_1668 194
540 3300049571 Ga0501034_0050687 Ga0501034_0050687_2216_2905 194
541 3300049571 Ga0501034_0163202 Ga0501034_0163202_1301_1921 194
542 3300049571 Ga0501034_0305931 Ga0501034_0305931_446_1108 194
543 3300049572 Ga0501036_0454722 Ga0501036_0454722_208_804 194
544 3300049573 Ga0501037_0077995 Ga0501037_0077995_88_777 194
545 3300049574 Ga0501038_0297642 Ga0501038_0297642_249_845 194
546 3300049574 Ga0501038_0414885 Ga0501038_0414885_348_1010 194
547 3300049579 Ga0501043_0021727 Ga0501043_0021727_2281_2970 194
548 3300049579 Ga0501043_0113950 Ga0501043_0113950_428_1051 194
549 3300049579 Ga0501043_0216567 Ga0501043_0216567_171_860 194
550 3300049580 Ga0501046_0225343 Ga0501046_0225343_397_1059 194
551 3300049580 Ga0501046_0586401 Ga0501046_0586401_168_779 194
552 3300049581 Ga0501047_0002245 Ga0501047_0002245_6543_7166 194
553 3300049581 Ga0501047_0008627 Ga0501047_0008627_5748_6359 194
554 3300049581 Ga0501047_0103394 Ga0501047_0103394_1169_1765 194
555 3300049581 Ga0501047_0294001 Ga0501047_0294001_395_1033 194
556 3300049582 Ga0501048_0697761 Ga0501048_0697761_40_651 194
557 3300049583 Ga0501067_0000151 Ga0501067_0000151_2471_3160 194
558 3300049584 Ga0501068_0004552 Ga0501068_0004552_725_1414 194
559 3300049589 Ga0501073_0000002 Ga0501073_0000002_179645_180334 194
560 3300049593 Ga0501077_0000002 Ga0501077_0000002_76504_77193 194
561 3300049741 Ga0501079_0122464 Ga0501079_0122464_1193_1882 194
562 3300049742 Ga0501080_0007490 Ga0501080_0007490_5179_5790 194
563 3300049742 Ga0501080_0008841 Ga0501080_0008841_3148_3837 194
564 3300049742 Ga0501080_0150946 Ga0501080_0150946_988_1599 194
565 3300049822 Ga0501035_0098701 Ga0501035_0098701_1091_1687 194
566 3300049823 Ga0501044_0002054 Ga0501044_0002054_10999_11688 194
567 3300049823 Ga0501044_0142097 Ga0501044_0142097_1007_1627 194
568 3300049823 Ga0501044_0572839 Ga0501044_0572839_261_923 194
569 3300049824 Ga0501045_0317586 Ga0501045_0317586_311_1000 194
570 3300050489 nmdc:mga03683_677_c1 nmdc:mga03683_677_c1_224_886 194
571 3300050489 nmdc:mga03683_81581_c1 nmdc:mga03683_81581_c1_245_907 194
572 3300050489 nmdc:mga03683_94934_c2 nmdc:mga03683_94934_c2_210_806 194
573 3300050491 nmdc:mga00v17_205339_c2 nmdc:mga00v17_205339_c2_216_878 194
574 3300050492 nmdc:mga0yw44_146900_c1 nmdc:mga0yw44_146900_c1_123_785 194
575 3300050492 nmdc:mga0yw44_50534_c1 nmdc:mga0yw44_50534_c1_1115_1777 194
576 3300050492 nmdc:mga0yw44_6639_c1 nmdc:mga0yw44_6639_c1_1703_2365 194
577 3300050493 nmdc:mga0k408_60678_c1 nmdc:mga0k408_60678_c1_991_1590 194
578 3300050494 nmdc:mga06z11_12916_c1 nmdc:mga06z11_12916_c1_625_1287 194
579 3300050494 nmdc:mga06z11_302940_c1 nmdc:mga06z11_302940_c1_277_939 194
580 3300050496 nmdc:mga07m45_29809_c1 nmdc:mga07m45_29809_c1_2045_2707 194
581 3300050496 nmdc:mga07m45_49578_c1 nmdc:mga07m45_49578_c1_606_1268 194
582 3300050516 nmdc:mga0sz30_157021_c1 nmdc:mga0sz30_157021_c1_125_787 194
583 3300050516 nmdc:mga0sz30_365228_c1 nmdc:mga0sz30_365228_c1_31_630 194
584 3300050516 nmdc:mga0sz30_51994_c1 nmdc:mga0sz30_51994_c1_13_675 194
585 3300053080 Ga0500635_0077720 Ga0500635_0077720_202_813 194
586 3300053086 Ga0500578_0001569 Ga0500578_0001569_20600_21193 194
587 3300053088 Ga0500644_0000124 Ga0500644_0000124_5063_5656 194
588 3300053088 Ga0500644_0011700 Ga0500644_0011700_378_971 194
589 3300053096 Ga0500641_0001391 Ga0500641_0001391_5875_6537 194
590 3300053096 Ga0500641_0002845 Ga0500641_0002845_4859_5452 194
591 3300053096 Ga0500641_0207998 Ga0500641_0207998_177_770 194
592 3300053119 Ga0500595_013338 Ga0500595_013338_801_1385 194
593 3300053122 Ga0500608_109785 Ga0500608_109785_269_892 194
594 3300053125 Ga0500618_000159 Ga0500618_000159_9434_10057 194
595 3300053130 Ga0500642_0234454 Ga0500642_0234454_56_679 194
596 3300053134 Ga0500658_0000535 Ga0500658_0000535_4859_5464 194
597 3300053134 Ga0500658_0002725 Ga0500658_0002725_4939_5562 194
598 3300053134 Ga0500658_0055148 Ga0500658_0055148_317_988 194
599 3300053136 Ga0500559_0004938 Ga0500559_0004938_4457_5041 194
600 3300053138 Ga0500564_000063 Ga0500564_000063_23982_24575 194
601 3300053139 Ga0500568_0008465 Ga0500568_0008465_3581_4252 194
602 3300053142 Ga0500577_0016443 Ga0500577_0016443_447_1070 194
603 3300053146 Ga0500588_0017563 Ga0500588_0017563_565_1158 194
604 3300053153 Ga0500616_0005558 Ga0500616_0005558_1756_2349 194
605 3300053153 Ga0500616_0028588 Ga0500616_0028588_2023_2646 194
606 3300053153 Ga0500616_0040457 Ga0500616_0040457_973_1593 194
607 3300053156 Ga0500622_0000643 Ga0500622_0000643_16658_17251 194
608 3300053156 Ga0500622_0051446 Ga0500622_0051446_1477_2073 194
609 3300053156 Ga0500622_0137762 Ga0500622_0137762_156_755 194
610 3300053158 Ga0500627_0024296 Ga0500627_0024296_750_1373 194
611 3300053730 Ga0500645_020054 Ga0500645_020054_1199_1822 194
612 3300053733 Ga0500552_000050 Ga0500552_000050_4716_5378 194
613 3300053737 Ga0500601_004278 Ga0500601_004278_722_1306 194
614 3300060353 Ga0501082_0266158 Ga0501082_0266158_80_742 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

26

203

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhl-assembly2.cif.gz_B crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate 0.9104 2 191
2if2-assembly2.cif.gz_B crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.9099 1 191
1n3b-assembly1.cif.gz_C crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.9093 2 191
1n3b-assembly1.cif.gz_A crystal structure of dephosphocoenzyme a kinase from escherichia coli 0.9044 2 191
1uf9-assembly3.cif.gz_C crystal structure of tt1252 from thermus thermophilus 0.9039 2 193
ID Description Score Start End Superfamily
af_Q8WVC6_1_203_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9277 1 194 3.40.50.300
af_Q8WVC6_1_203_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9232 1 194 3.40.50.300
af_P34558_5_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9221 2 194 3.40.50.300
af_P9WPA3_1_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9216 1 190 3.40.50.300
af_O74414_1_201_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9198 1 191 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1G6KQW1-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9926 1 194 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A6I5WYB6-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9898 2 191 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A7X1KCM8-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9893 2 191 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A1G6KQW1-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9875 1 194 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A1R1Z0H5-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9861 1 191 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
96 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map