F469263

General Info

Members Datasets Scaffolds Average Seq Length
613 308 1226 147

Family's Representative Sequence

Representative Sequence 3300025941|Ga0207711_10907428|Ga0207711_109074282
Length 165
Sequence MAMSTGGGGNSVKAEPNVTPMIDVMLVMVVTPALLAGFNAVPPQGQNLKDHPEDAENDQVLGIDRDGNYYLNKQPISKTAIEGEIKRIFEKRESDKVMYLKADKDLLYSKVVDATDMAAKNGVRVIGLISDQKAGTVSTVVGDSAVPSSSGTGSVSSGCLSPSGT

Samples

Sample ID Description Type Environment
1 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
125 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.48
Metatranscriptomes 14.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.77
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207711_10907428 3300025941 Bacteria 819
2 LJQas_1012689 3300000549 Unclassified 994
3 JGI24752J21851_1003590 3300001976 Unclassified 2043
4 JGI24737J22298_10024842 3300001990 Unclassified 1896
5 JGI24738J21930_10008993 3300002075 Unclassified 2261
6 Ga0006759J45824_1040862 3300003163 Bacteria 1096
7 Ga0007410J51695_1021220 3300003574 Unclassified 1494
8 Ga0007409J51694_1034732 3300003575 Unclassified 980
9 Ga0007416J51690_1059353 3300003577 Bacteria 643
10 Ga0007416J51690_1135492 3300003577 Bacteria 667
11 Ga0007429J51699_1023882 3300003579 Bacteria 1049
12 Ga0007429J51699_1073541 3300003579 Bacteria 610
13 Ga0058859_10031235 3300004798 Bacteria 1059
14 Ga0058859_10072571 3300004798 Bacteria 1296
15 Ga0058859_11771399 3300004798 Bacteria 1965
16 Ga0058859_11806325 3300004798 Bacteria 2540
17 Ga0058863_10011583 3300004799 Bacteria 1398
18 Ga0058863_10019978 3300004799 Bacteria 2473
19 Ga0058863_10025698 3300004799 Bacteria 1005
20 Ga0058863_10160997 3300004799 Bacteria 2244
21 Ga0058863_11927537 3300004799 Bacteria 1298
22 Ga0058861_10031427 3300004800 Bacteria 2085
23 Ga0058861_10068166 3300004800 Bacteria 789
24 Ga0058861_10100634 3300004800 Bacteria 2520
25 Ga0058861_10174494 3300004800 Bacteria 1279
26 Ga0058860_12149395 3300004801 Bacteria 2050
27 Ga0058860_12169105 3300004801 Bacteria 1157
28 Ga0058860_12224385 3300004801 Bacteria 1289
29 Ga0058862_10015645 3300004803 Bacteria 1092
30 Ga0058862_10026066 3300004803 Bacteria 2460
31 Ga0058862_10053905 3300004803 Bacteria 1305
32 Ga0058862_10121865 3300004803 Bacteria 1198
33 Ga0058862_10180327 3300004803 Bacteria 1000
34 Ga0058862_12768226 3300004803 Bacteria 1263
35 Ga0058862_12775103 3300004803 Bacteria 1374
36 Ga0058862_12822515 3300004803 Bacteria 621
37 Ga0058862_12870049 3300004803 Bacteria 1881
38 Ga0065712_10105869 3300005290 Bacteria 1930
39 Ga0065712_10246953 3300005290 Bacteria 959
40 Ga0065715_10219187 3300005293 Bacteria 1279
41 Ga0070658_10002530 3300005327 Bacteria 15260
42 Ga0070658_10027578 3300005327 Bacteria 4555
43 Ga0070658_10089531 3300005327 Bacteria 2534
44 Ga0070658_10268770 3300005327 Bacteria 1450
45 Ga0070658_10372861 3300005327 Bacteria 1223
46 Ga0070658_10501341 3300005327 Bacteria 1049
47 Ga0070658_10569541 3300005327 Bacteria 981
48 Ga0070676_10093025 3300005328 Bacteria 1850
49 Ga0070676_10132340 3300005328 Bacteria 1579
50 Ga0070683_100000662 3300005329 Bacteria 24891
51 Ga0070683_100003547 3300005329 Bacteria 12693
52 Ga0070683_100017034 3300005329 Bacteria 6414
53 Ga0070683_100057123 3300005329 Bacteria 3625
54 Ga0070683_100069251 3300005329 Bacteria 3289
55 Ga0070683_100171623 3300005329 Bacteria 2059
56 Ga0070683_100183978 3300005329 Bacteria 1983
57 Ga0070683_100322487 3300005329 Bacteria 1470
58 Ga0070683_100495166 3300005329 Bacteria 1167
59 Ga0070690_100075352 3300005330 Bacteria 2199
60 Ga0070690_100108436 3300005330 Bacteria 1850
61 Ga0070690_101003806 3300005330 Bacteria 658
62 Ga0070670_100008774 3300005331 Bacteria 8628
63 Ga0070670_100084678 3300005331 Bacteria 2724
64 Ga0070670_100290046 3300005331 Bacteria 1430
65 Ga0070677_10094646 3300005333 Bacteria 1306
66 Ga0068869_100006227 3300005334 Bacteria 7556
67 Ga0070666_10084739 3300005335 Bacteria 2170
68 Ga0070680_100006760 3300005336 Bacteria 8739
69 Ga0070680_100046871 3300005336 Bacteria 3517
70 Ga0070680_100419539 3300005336 Bacteria 1141
71 Ga0070680_100596973 3300005336 Bacteria 948
72 Ga0070682_100002639 3300005337 Bacteria 9906
73 Ga0070682_100723328 3300005337 Bacteria 801
74 Ga0068868_100707797 3300005338 Bacteria 902
75 Ga0070660_100423221 3300005339 Bacteria 1103
76 Ga0070689_100844357 3300005340 Bacteria 808
77 Ga0070687_100435113 3300005343 Bacteria 869
78 Ga0070661_100027604 3300005344 Bacteria 4089
79 Ga0070661_100086675 3300005344 Bacteria 2315
80 Ga0070661_100216428 3300005344 Bacteria 1468
81 Ga0070661_100624971 3300005344 Bacteria 872
82 Ga0070661_100633806 3300005344 Bacteria 866
83 Ga0070692_10370413 3300005345 Bacteria 896
84 Ga0070668_100076225 3300005347 Bacteria 2619
85 Ga0070669_100014167 3300005353 Bacteria 5674
86 Ga0070669_100277876 3300005353 Bacteria 1341
87 Ga0070669_100711883 3300005353 Bacteria 848
88 Ga0070669_100863143 3300005353 Bacteria 772
89 Ga0070675_100001662 3300005354 Bacteria 16436
90 Ga0070675_100116171 3300005354 Bacteria 2269
91 Ga0070675_100701642 3300005354 Bacteria 922
92 Ga0070675_100824202 3300005354 Bacteria 849
93 Ga0070671_100131468 3300005355 Bacteria 2108
94 Ga0070671_100518071 3300005355 Bacteria 1027
95 Ga0070674_100231784 3300005356 Bacteria 1441
96 Ga0070673_100118119 3300005364 Bacteria 2208
97 Ga0070673_100189519 3300005364 Bacteria 1765
98 Ga0070673_100295875 3300005364 Bacteria 1424
99 Ga0070673_100445715 3300005364 Bacteria 1164
100 Ga0070673_100609365 3300005364 Bacteria 996
101 Ga0070688_100004495 3300005365 Bacteria 7269
102 Ga0070659_100013361 3300005366 Bacteria 6109
103 Ga0070659_100045299 3300005366 Bacteria 3445
104 Ga0070659_100180618 3300005366 Bacteria 1732
105 Ga0070659_100259581 3300005366 Bacteria 1441
106 Ga0070667_100316185 3300005367 Bacteria 1408
107 Ga0070667_100870998 3300005367 Bacteria 838
108 Ga0070709_10004433 3300005434 Bacteria 7573
109 Ga0070714_100123476 3300005435 Bacteria 2306
110 Ga0070714_101319056 3300005435 Bacteria 704
111 Ga0070713_100045324 3300005436 Bacteria 3603
112 Ga0070713_100075174 3300005436 Bacteria 2865
113 Ga0070710_10309376 3300005437 Bacteria 1034
114 Ga0070701_10301713 3300005438 Bacteria 985
115 Ga0070701_10681073 3300005438 Bacteria 690
116 Ga0070711_100222579 3300005439 Bacteria 1468
117 Ga0070711_100344906 3300005439 Bacteria 1196
118 Ga0070705_100880341 3300005440 Bacteria 719
119 Ga0070694_100994804 3300005444 Bacteria 696
120 Ga0070708_100017280 3300005445 Bacteria 6012
121 Ga0070663_100583791 3300005455 Bacteria 938
122 Ga0070662_100161194 3300005457 Bacteria 1754
123 Ga0070681_10026256 3300005458 Bacteria 5854
124 Ga0070681_10054797 3300005458 Bacteria 3973
125 Ga0070681_10135556 3300005458 Bacteria 2393
126 Ga0070681_10415097 3300005458 Bacteria 1258
127 Ga0068867_100023307 3300005459 Bacteria 4432
128 Ga0070685_10109256 3300005466 Bacteria 1701
129 Ga0070706_100488462 3300005467 Bacteria 1146
130 Ga0070698_100337410 3300005471 Bacteria 1439
131 Ga0070679_100000771 3300005530 Bacteria 27790
132 Ga0070679_100005023 3300005530 Bacteria 12209
133 Ga0070679_100082272 3300005530 Bacteria 3209
134 Ga0070679_100087543 3300005530 Bacteria 3102
135 Ga0070679_100253998 3300005530 Bacteria 1714
136 Ga0070684_100004296 3300005535 Bacteria 10813
137 Ga0070684_100015882 3300005535 Bacteria 6145
138 Ga0070684_100088411 3300005535 Bacteria 2753
139 Ga0070684_100112014 3300005535 Bacteria 2448
140 Ga0070684_100178147 3300005535 Bacteria 1932
141 Ga0070684_100939700 3300005535 Bacteria 811
142 Ga0070684_101010613 3300005535 Bacteria 780
143 Ga0068853_100276435 3300005539 Bacteria 1548
144 Ga0068853_101508768 3300005539 Bacteria 651
145 Ga0070672_100035408 3300005543 Bacteria 3795
146 Ga0070672_100083137 3300005543 Bacteria 2569
147 Ga0070672_100275162 3300005543 Bacteria 1422
148 Ga0070672_101282597 3300005543 Bacteria 654
149 Ga0070686_101478739 3300005544 Bacteria 572
150 Ga0070696_100239800 3300005546 Bacteria 1367
151 Ga0070693_101109436 3300005547 Bacteria 604
152 Ga0070704_100585658 3300005549 Bacteria 979
153 Ga0068855_100114484 3300005563 Bacteria 3092
154 Ga0068855_100960826 3300005563 Bacteria 899
155 Ga0070664_100016816 3300005564 Bacteria 6004
156 Ga0070664_100215244 3300005564 Bacteria 1717
157 Ga0070664_100623148 3300005564 Bacteria 1001
158 Ga0068857_100004677 3300005577 Bacteria 11598
159 Ga0068857_100022826 3300005577 Bacteria 5505
160 Ga0068857_100094341 3300005577 Bacteria 2679
161 Ga0068857_101199528 3300005577 Bacteria 735
162 Ga0068854_100779860 3300005578 Bacteria 831
163 Ga0068854_100999353 3300005578 Bacteria 741
164 Ga0068856_100037691 3300005614 Bacteria 4744
165 Ga0068856_100092780 3300005614 Bacteria 3005
166 Ga0068856_100162634 3300005614 Bacteria 2243
167 Ga0068856_100416410 3300005614 Bacteria 1364
168 Ga0070702_100006432 3300005615 Bacteria 5558
169 Ga0070702_100116480 3300005615 Bacteria 1666
170 Ga0070702_100285054 3300005615 Bacteria 1136
171 Ga0068852_100215707 3300005616 Bacteria 1823
172 Ga0068852_100347488 3300005616 Bacteria 1447
173 Ga0068852_101486673 3300005616 Bacteria 700
174 Ga0068859_100088363 3300005617 Bacteria 3148
175 Ga0068859_100112215 3300005617 Bacteria 2789
176 Ga0068859_101679150 3300005617 Bacteria 701
177 Ga0068864_100024854 3300005618 Bacteria 5039
178 Ga0068866_10098877 3300005718 Bacteria 1606
179 Ga0068861_100619558 3300005719 Bacteria 996
180 Ga0068851_10172401 3300005834 Bacteria 1194
181 Ga0068851_10214314 3300005834 Bacteria 1080
182 Ga0068870_10012644 3300005840 Bacteria 3948
183 Ga0068863_100029136 3300005841 Bacteria 5271
184 Ga0068863_100069225 3300005841 Bacteria 3337
185 Ga0068858_100147199 3300005842 Bacteria 2212
186 Ga0068858_100192377 3300005842 Bacteria 1928
187 Ga0068858_101409200 3300005842 Bacteria 687
188 Ga0068860_100021657 3300005843 Bacteria 6223
189 Ga0068862_100058772 3300005844 Bacteria 3299
190 Ga0068862_100423028 3300005844 Bacteria 1250
191 Ga0075432_10153999 3300006058 Bacteria 885
192 Ga0070716_100529257 3300006173 Bacteria 875
193 Ga0070712_100125839 3300006175 Bacteria 1936
194 Ga0097621_100010975 3300006237 Bacteria 6653
195 Ga0097621_100272783 3300006237 Bacteria 1487
196 Ga0068871_100284792 3300006358 Bacteria 1446
197 Ga0068871_100316158 3300006358 Bacteria 1374
198 Ga0068871_101344292 3300006358 Bacteria 673
199 Ga0075434_101383660 3300006871 Bacteria 714
200 Ga0075429_100303956 3300006880 Bacteria 1397
201 Ga0068865_100005638 3300006881 Bacteria 7598
202 Ga0097620_100088359 3300006931 Bacteria 3148
203 Ga0097620_100112208 3300006931 Bacteria 2789
204 Ga0097620_101679142 3300006931 Bacteria 701
205 Ga0075435_101270120 3300007076 Bacteria 645
206 Ga0105240_10267128 3300009093 Bacteria 1971
207 Ga0111539_10187731 3300009094 Bacteria 2413
208 Ga0111539_10233831 3300009094 Bacteria 2140
209 Ga0105245_10187854 3300009098 Bacteria 1978
210 Ga0105243_10051387 3300009148 Bacteria 3260
211 Ga0105243_10886061 3300009148 Bacteria 887
212 Ga0105243_11528073 3300009148 Bacteria 692
213 Ga0105241_10008171 3300009174 Bacteria 7705
214 Ga0105241_10141303 3300009174 Bacteria 1961
215 Ga0105241_11003878 3300009174 Bacteria 781
216 Ga0105242_10101363 3300009176 Bacteria 2440
217 Ga0105242_10287784 3300009176 Bacteria 1495
218 Ga0105242_10362970 3300009176 Bacteria 1341
219 Ga0105242_11328191 3300009176 Bacteria 744
220 Ga0105248_10077657 3300009177 Bacteria 3733
221 Ga0105248_10325266 3300009177 Bacteria 1732
222 Ga0105248_10570335 3300009177 Bacteria 1277
223 Ga0105248_11120906 3300009177 Bacteria 889
224 Ga0105237_10197173 3300009545 Bacteria 2013
225 Ga0105237_10445491 3300009545 Bacteria 1301
226 Ga0105237_10553013 3300009545 Bacteria 1157
227 Ga0105237_11044972 3300009545 Bacteria 824
228 Ga0105238_10069130 3300009551 Bacteria 3532
229 Ga0105238_10493845 3300009551 Bacteria 1224
230 Ga0105238_10798874 3300009551 Bacteria 959
231 Ga0105249_10130805 3300009553 Bacteria 2396
232 Ga0105239_10025248 3300010375 Bacteria 6544
233 Ga0105239_10427565 3300010375 Bacteria 1501
234 Ga0105239_11049295 3300010375 Bacteria 938
235 Ga0105246_10001421 3300011119 Bacteria 14186
236 Ga0105246_10596453 3300011119 Bacteria 954
237 Ga0157373_10135434 3300013100 Bacteria 1732
238 Ga0157373_10274111 3300013100 Bacteria 1195
239 Ga0157373_10450611 3300013100 Bacteria 926
240 Ga0157373_10868718 3300013100 Bacteria 668
241 Ga0157371_10018782 3300013102 Bacteria 5108
242 Ga0157371_10066051 3300013102 Bacteria 2562
243 Ga0157371_10205383 3300013102 Bacteria 1413
244 Ga0157371_10733877 3300013102 Bacteria 741
245 Ga0157371_11312407 3300013102 Bacteria 560
246 Ga0157370_10007324 3300013104 Bacteria 12042
247 Ga0157370_10310553 3300013104 Bacteria 1455
248 Ga0157370_10393560 3300013104 Bacteria 1276
249 Ga0157370_10695108 3300013104 Bacteria 928
250 Ga0157370_10852887 3300013104 Bacteria 828
251 Ga0157369_10059499 3300013105 Bacteria 4120
252 Ga0157369_10217042 3300013105 Bacteria 2003
253 Ga0157369_10396672 3300013105 Bacteria 1431
254 Ga0157369_10545452 3300013105 Bacteria 1199
255 Ga0157369_10805984 3300013105 Bacteria 965
256 Ga0157369_10956670 3300013105 Bacteria 877
257 Ga0157374_10251765 3300013296 Bacteria 1738
258 Ga0157374_10422228 3300013296 Bacteria 1332
259 Ga0157378_10171220 3300013297 Bacteria 2036
260 Ga0157378_11311516 3300013297 Bacteria 765
261 Ga0163162_10041886 3300013306 Bacteria 4582
262 Ga0163162_10397847 3300013306 Bacteria 1510
263 Ga0163162_10463736 3300013306 Bacteria 1398
264 Ga0157372_10194884 3300013307 Bacteria 2347
265 Ga0157372_10214535 3300013307 Bacteria 2230
266 Ga0157372_10405406 3300013307 Bacteria 1589
267 Ga0157372_10505550 3300013307 Bacteria 1409
268 Ga0157372_10749839 3300013307 Bacteria 1135
269 Ga0157372_10809219 3300013307 Bacteria 1088
270 Ga0157372_11055312 3300013307 Bacteria 940
271 Ga0157372_11082912 3300013307 Bacteria 927
272 Ga0157375_10016467 3300013308 Bacteria 6644
273 Ga0157375_10615385 3300013308 Bacteria 1244
274 Ga0157375_10744470 3300013308 Bacteria 1132
275 Ga0163163_10458713 3300014325 Bacteria 1335
276 Ga0163163_10514615 3300014325 Bacteria 1259
277 Ga0157380_10177783 3300014326 Bacteria 1867
278 Ga0157377_10006216 3300014745 Bacteria 5680
279 Ga0157377_10602755 3300014745 Bacteria 784
280 Ga0157379_10214043 3300014968 Bacteria 1745
281 Ga0157376_10986349 3300014969 Bacteria 864
282 Ga0182007_10094832 3300015262 Bacteria 984
283 Ga0182007_10145981 3300015262 Bacteria 802
284 Ga0163161_10106798 3300017792 Bacteria 2089
285 Ga0206356_10071443 3300020070 Bacteria 2469
286 Ga0206356_10458780 3300020070 Bacteria 967
287 Ga0206356_10858288 3300020070 Bacteria 551
288 Ga0206356_11088513 3300020070 Bacteria 837
289 Ga0206356_11707898 3300020070 Bacteria 926
290 Ga0206349_1385913 3300020075 Bacteria 1022
291 Ga0206355_1022390 3300020076 Bacteria 718
292 Ga0206351_10392633 3300020077 Bacteria 663
293 Ga0206352_10170617 3300020078 Bacteria 1605
294 Ga0206352_10186617 3300020078 Bacteria 969
295 Ga0206352_10463369 3300020078 Bacteria 652
296 Ga0206352_10780591 3300020078 Bacteria 1307
297 Ga0206352_10987980 3300020078 Bacteria 1109
298 Ga0206350_11319129 3300020080 Bacteria 929
299 Ga0206354_11533883 3300020081 Bacteria 904
300 Ga0224712_10141538 3300022467 Bacteria 1059
301 Ga0207697_10158761 3300025315 Bacteria 986
302 Ga0207656_10025013 3300025321 Bacteria 2421
303 Ga0207656_10112090 3300025321 Bacteria 1262
304 Ga0207682_10094051 3300025893 Bacteria 1303
305 Ga0207682_10106266 3300025893 Bacteria 1232
306 Ga0207682_10246966 3300025893 Bacteria 830
307 Ga0207642_10037832 3300025899 Bacteria 2082
308 Ga0207688_10087613 3300025901 Bacteria 1785
309 Ga0207647_10095405 3300025904 Bacteria 1771
310 Ga0207685_10055812 3300025905 Bacteria 1543
311 Ga0207699_10032403 3300025906 Bacteria 2944
312 Ga0207645_10003859 3300025907 Bacteria 11218
313 Ga0207645_10458004 3300025907 Bacteria 861
314 Ga0207643_10024386 3300025908 Bacteria 3338
315 Ga0207643_10466052 3300025908 Bacteria 805
316 Ga0207705_10054893 3300025909 Bacteria 2871
317 Ga0207705_10114841 3300025909 Bacteria 1992
318 Ga0207705_10186495 3300025909 Bacteria 1567
319 Ga0207705_10313805 3300025909 Bacteria 1204
320 Ga0207654_10057461 3300025911 Bacteria 2261
321 Ga0207654_10814900 3300025911 Bacteria 675
322 Ga0207707_10006540 3300025912 Bacteria 10171
323 Ga0207707_10009547 3300025912 Bacteria 8417
324 Ga0207707_10348257 3300025912 Bacteria 1277
325 Ga0207707_10522385 3300025912 Bacteria 1011
326 Ga0207695_10012644 3300025913 Bacteria 10111
327 Ga0207671_10250869 3300025914 Bacteria 1391
328 Ga0207693_10052380 3300025915 Bacteria 3201
329 Ga0207693_10732457 3300025915 Bacteria 765
330 Ga0207663_10036893 3300025916 Bacteria 2943
331 Ga0207663_10038395 3300025916 Bacteria 2894
332 Ga0207663_10296715 3300025916 Bacteria 1206
333 Ga0207663_10355872 3300025916 Bacteria 1109
334 Ga0207660_10008227 3300025917 Bacteria 6749
335 Ga0207660_10009120 3300025917 Bacteria 6424
336 Ga0207660_10920253 3300025917 Bacteria 713
337 Ga0207662_10001709 3300025918 Bacteria 10752
338 Ga0207657_10041175 3300025919 Bacteria 4086
339 Ga0207657_10126471 3300025919 Bacteria 2099
340 Ga0207649_10314641 3300025920 Bacteria 1148
341 Ga0207652_10003240 3300025921 Bacteria 13498
342 Ga0207652_10055753 3300025921 Bacteria 3400
343 Ga0207652_10070046 3300025921 Bacteria 3045
344 Ga0207652_10175589 3300025921 Bacteria 1924
345 Ga0207681_10004359 3300025923 Bacteria 8728
346 Ga0207681_11063034 3300025923 Bacteria 679
347 Ga0207694_10120264 3300025924 Bacteria 2096
348 Ga0207650_10002341 3300025925 Bacteria 13193
349 Ga0207650_10049790 3300025925 Bacteria 3095
350 Ga0207659_10005988 3300025926 Bacteria 7419
351 Ga0207659_10576600 3300025926 Bacteria 958
352 Ga0207659_10648374 3300025926 Bacteria 902
353 Ga0207687_10166331 3300025927 Bacteria 1697
354 Ga0207687_10292241 3300025927 Bacteria 1310
355 Ga0207700_10024941 3300025928 Bacteria 4145
356 Ga0207700_10376199 3300025928 Bacteria 1241
357 Ga0207664_10006700 3300025929 Bacteria 7948
358 Ga0207664_10049834 3300025929 Bacteria 3299
359 Ga0207644_10238659 3300025931 Bacteria 1446
360 Ga0207644_10246538 3300025931 Bacteria 1424
361 Ga0207644_10411415 3300025931 Bacteria 1107
362 Ga0207690_10008263 3300025932 Bacteria 6173
363 Ga0207690_10036856 3300025932 Bacteria 3170
364 Ga0207686_10021294 3300025934 Bacteria 3719
365 Ga0207686_10142532 3300025934 Bacteria 1658
366 Ga0207686_11442138 3300025934 Bacteria 567
367 Ga0207709_11155616 3300025935 Bacteria 637
368 Ga0207670_10131140 3300025936 Bacteria 1836
369 Ga0207670_10805599 3300025936 Bacteria 783
370 Ga0207669_10134761 3300025937 Bacteria 1704
371 Ga0207704_10007324 3300025938 Bacteria 5206
372 Ga0207691_10036983 3300025940 Bacteria 4522
373 Ga0207691_10054622 3300025940 Bacteria 3643
374 Ga0207691_10300556 3300025940 Bacteria 1379
375 Ga0207691_10748588 3300025940 Bacteria 823
376 Ga0207711_10140777 3300025941 Bacteria 2170
377 Ga0207689_10002618 3300025942 Bacteria 16653
378 Ga0207661_10003817 3300025944 Bacteria 10503
379 Ga0207661_10068651 3300025944 Bacteria 2887
380 Ga0207661_10111017 3300025944 Bacteria 2319
381 Ga0207661_10135219 3300025944 Bacteria 2116
382 Ga0207661_10210766 3300025944 Bacteria 1712
383 Ga0207661_10517084 3300025944 Bacteria 1091
384 Ga0207661_11180243 3300025944 Bacteria 704
385 Ga0207679_10001825 3300025945 Bacteria 13268
386 Ga0207679_10629173 3300025945 Bacteria 969
387 Ga0207667_10058152 3300025949 Bacteria 4057
388 Ga0207667_10117398 3300025949 Bacteria 2742
389 Ga0207667_10769188 3300025949 Bacteria 961
390 Ga0207651_10076222 3300025960 Bacteria 2396
391 Ga0207651_10135290 3300025960 Bacteria 1894
392 Ga0207651_10207994 3300025960 Bacteria 1573
393 Ga0207651_10989825 3300025960 Bacteria 751
394 Ga0207712_10430976 3300025961 Bacteria 1114
395 Ga0207712_10883219 3300025961 Bacteria 789
396 Ga0207668_10015561 3300025972 Bacteria 4728
397 Ga0207658_11598351 3300025986 Bacteria 596
398 Ga0207677_10549543 3300026023 Bacteria 1006
399 Ga0207703_10068730 3300026035 Bacteria 2919
400 Ga0207703_10447393 3300026035 Bacteria 1206
401 Ga0207639_11109279 3300026041 Bacteria 742
402 Ga0207678_10284573 3300026067 Bacteria 1419
403 Ga0207678_10299760 3300026067 Bacteria 1381
404 Ga0207678_10752195 3300026067 Bacteria 859
405 Ga0207708_10277693 3300026075 Bacteria 1357
406 Ga0207702_10012764 3300026078 Bacteria 6990
407 Ga0207702_10228532 3300026078 Bacteria 1738
408 Ga0207702_10265467 3300026078 Bacteria 1617
409 Ga0207702_10271109 3300026078 Bacteria 1601
410 Ga0207702_10823257 3300026078 Bacteria 918
411 Ga0207641_10043525 3300026088 Bacteria 3771
412 Ga0207641_10996400 3300026088 Bacteria 834
413 Ga0207648_10007649 3300026089 Bacteria 10578
414 Ga0207676_10016488 3300026095 Bacteria 5350
415 Ga0207676_10294957 3300026095 Bacteria 1478
416 Ga0207674_10002535 3300026116 Bacteria 23011
417 Ga0207674_10026110 3300026116 Bacteria 6213
418 Ga0207674_10026159 3300026116 Bacteria 6207
419 Ga0207674_10494805 3300026116 Bacteria 1181
420 Ga0207674_10888353 3300026116 Bacteria 859
421 Ga0207675_100132057 3300026118 Bacteria 2368
422 Ga0207698_10179186 3300026142 Bacteria 1875
423 Ga0207428_10201907 3300027907 Bacteria 1496
424 Ga0268265_10038929 3300028380 Bacteria 3501
425 Ga0268264_10091803 3300028381 Bacteria 2620
426 Ga0307408_100874958 3300031548 Bacteria 821
427 Ga0307413_10012801 3300031824 Bacteria 4189
428 Ga0307410_10249149 3300031852 Bacteria 1380
429 Ga0307406_10074765 3300031901 Bacteria 2232
430 Ga0307409_100046838 3300031995 Bacteria 3276
431 Ga0307416_100947453 3300032002 Bacteria 963
432 Ga0307416_101084829 3300032002 Bacteria 905
433 Ga0307414_10135109 3300032004 Bacteria 1922
434 Ga0307414_10652751 3300032004 Bacteria 949
435 Ga0307415_100105915 3300032126 Bacteria 2075
436 Ga0307415_100173988 3300032126 Bacteria 1682
437 Ga0307415_100445546 3300032126 Bacteria 1118
438 Ga0307415_100567230 3300032126 Bacteria 1004
439 Ga0373948_0094813 3300034817 Bacteria 697
440 Ga0373936_0477670 3300035113 Bacteria 578
441 Ga0373945_0117639 3300035116 Bacteria 1054
442 Ga0373954_0045633 3300035118 Bacteria 2048
443 Ga0373957_0126894 3300035120 Bacteria 1036
444 Ga0373943_0029448 3300035170 Bacteria 2594
445 Ga0373943_0281684 3300035170 Bacteria 940
446 Ga0373955_0016306 3300035172 Bacteria 3654
447 Ga0373955_0052973 3300035172 Bacteria 2214
448 Ga0373955_0328400 3300035172 Bacteria 925
449 Ga0373961_0046461 3300035241 Bacteria 1273
450 Ga0373924_0062334 3300035410 Bacteria 1562
451 Ga0373935_0245403 3300035692 Bacteria 1252
452 Ga0373927_0033533 3300035695 Bacteria 3343
453 Ga0373927_0197044 3300035695 Bacteria 1322
454 Ga0373933_0051813 3300035724 Bacteria 2454
455 Ga0373937_0015856 3300036401 Bacteria 6679
456 Ga0373937_0166609 3300036401 Bacteria 2066
457 Ga0373937_0969823 3300036401 Bacteria 799
458 Ga0373925_0031465 3300037068 Bacteria 3900
459 Ga0373925_0037683 3300037068 Bacteria 3571
460 Ga0395900_0323581 3300037418 Bacteria 1522
461 Ga0395905_0139084 3300037471 Bacteria 2285
462 Ga0395901_0434478 3300038443 Bacteria 1345
463 Ga0436363_1599808 3300039450 Bacteria 812
464 Ga0466961_0279357 3300044693 Bacteria 1022
465 Ga0451576_0054679 3300045051 Bacteria 4179
466 Ga0451576_2595716 3300045051 Bacteria 517
467 Ga0466967_0026287 3300045976 Bacteria 4819
468 Ga0495592_0086410 3300046454 Bacteria 2259
469 Ga0495629_0024153 3300046459 Bacteria 4329
470 Ga0495651_0073973 3300046462 Bacteria 2586
471 Ga0495651_0162192 3300046462 Bacteria 1600
472 Ga0495651_0413669 3300046462 Bacteria 878
473 Ga0495653_0045292 3300046463 Bacteria 3411
474 Ga0495580_0013439 3300046472 Bacteria 6245
475 Ga0495582_0165473 3300046473 Bacteria 1258
476 Ga0495582_0200302 3300046473 Bacteria 1140
477 Ga0495639_0288650 3300046475 Bacteria 816
478 Ga0495662_0029855 3300046476 Bacteria 2631
479 Ga0495662_0156645 3300046476 Bacteria 1122
480 Ga0495664_0009895 3300046477 Bacteria 5349
481 Ga0495664_0529448 3300046477 Bacteria 703
482 Ga0495594_0002515 3300046499 Bacteria 9556
483 Ga0495594_0009546 3300046499 Bacteria 5016
484 Ga0495596_0197002 3300046500 Bacteria 783
485 Ga0495608_0018028 3300046511 Bacteria 4877
486 Ga0495608_0753323 3300046511 Bacteria 577
487 Ga0495628_0260991 3300046516 Bacteria 1291
488 Ga0495628_0267701 3300046516 Bacteria 1272
489 Ga0495630_0017051 3300046517 Bacteria 5316
490 Ga0495642_0178357 3300046528 Bacteria 924
491 Ga0495652_0003351 3300046529 Bacteria 15872
492 Ga0495652_0045072 3300046529 Bacteria 3795
493 Ga0495665_0020004 3300046531 Bacteria 3599
494 Ga0495640_0224938 3300046533 Bacteria 1182
495 Ga0495586_0051997 3300046535 Bacteria 2217
496 Ga0495586_0055944 3300046535 Bacteria 2139
497 Ga0495587_0000747 3300046536 Bacteria 21674
498 Ga0495587_0023334 3300046536 Bacteria 3802
499 Ga0495587_0482106 3300046536 Bacteria 686
500 Ga0495587_0758948 3300046536 Bacteria 530
501 Ga0495598_0187645 3300046537 Bacteria 741
502 Ga0495645_0000475 3300046543 Bacteria 27786
503 Ga0495645_0000710 3300046543 Bacteria 22853
504 Ga0495667_0001590 3300046559 Bacteria 15065
505 Ga0495668_0464353 3300046616 Bacteria 697
506 Ga0495634_0335479 3300046642 Bacteria 908
507 Ga0495634_0405658 3300046642 Bacteria 809
508 Ga0495634_0449592 3300046642 Bacteria 760
509 Ga0495635_0032403 3300046663 Bacteria 3626
510 Ga0495635_0487325 3300046663 Bacteria 813
511 Ga0495588_0206409 3300046674 Bacteria 1038
512 Ga0495588_0744960 3300046674 Bacteria 512
513 Ga0495657_0062418 3300046675 Bacteria 2462
514 Ga0495657_0151763 3300046675 Bacteria 1438
515 Ga0495599_0003240 3300046678 Bacteria 9475
516 Ga0495599_0003716 3300046678 Bacteria 8938
517 Ga0495623_0032621 3300046679 Bacteria 3347
518 Ga0495623_0121170 3300046679 Bacteria 1574
519 Ga0495646_0042427 3300046680 Bacteria 2792
520 Ga0495669_0204211 3300046684 Bacteria 945
521 Ga0495669_0231076 3300046684 Bacteria 887
522 Ga0495613_0043113 3300046689 Bacteria 3338
523 Ga0495613_0158496 3300046689 Bacteria 1611
524 Ga0495600_0069926 3300046809 Bacteria 2294
525 Ga0495600_0260587 3300046809 Bacteria 1101
526 Ga0495581_0033867 3300047315 Bacteria 2956
527 Ga0495581_0163615 3300047315 Bacteria 1301
528 Ga0495581_0361763 3300047315 Bacteria 847
529 Ga0495674_0186240 3300047319 Bacteria 1727
530 Ga0495674_0210436 3300047319 Bacteria 1611
531 Ga0495674_0530969 3300047319 Bacteria 938
532 Ga0495675_0041679 3300047444 Bacteria 2925
533 Ga0495675_0202812 3300047444 Bacteria 1206
534 Ga0495675_0230660 3300047444 Bacteria 1117
535 Ga0495675_0312896 3300047444 Bacteria 930
536 Ga0495684_0006808 3300047471 Bacteria 8877
537 Ga0495684_0011453 3300047471 Bacteria 6850
538 Ga0495684_0036669 3300047471 Bacteria 3759
539 Ga0495593_0038393 3300047673 Bacteria 2587
540 Ga0495593_0401541 3300047673 Bacteria 685
541 Ga0495602_0035269 3300048088 Bacteria 4666
542 Ga0495602_0236891 3300048088 Bacteria 1367
543 Ga0496100_0139361 3300048903 Bacteria 1717
544 Ga0496101_0253254 3300048904 Bacteria 1372
545 Ga0496104_0165984 3300048907 Bacteria 2117
546 Ga0496105_0393646 3300048908 Bacteria 1101
547 Ga0496106_0843071 3300048909 Bacteria 726
548 Ga0496108_0085778 3300048911 Bacteria 2673
549 Ga0496109_0310571 3300048912 Bacteria 1487
550 Ga0496109_0397457 3300048912 Bacteria 1302
551 Ga0496110_0167276 3300048913 Bacteria 1994
552 Ga0496111_0510874 3300048914 Bacteria 884
553 Ga0496111_0723183 3300048914 Bacteria 723
554 Ga0496112_0014015 3300048915 Bacteria 7418
555 Ga0496112_0024153 3300048915 Bacteria 5817
556 Ga0496113_0311334 3300048916 Bacteria 1261
557 Ga0496113_0495052 3300048916 Bacteria 981
558 Ga0496114_0491060 3300048917 Bacteria 1086
559 Ga0496115_0485705 3300048918 Bacteria 994
560 Ga0501319_012248 3300049535 Bacteria 700
561 Ga0501320_068171 3300049536 Bacteria 511
562 Ga0501043_0054688 3300049579 Bacteria 3135
563 Ga0501047_0002195 3300049581 Bacteria 18687
564 Ga0501070_0061053 3300049586 Bacteria 3124
565 Ga0501080_0824137 3300049742 Bacteria 813
566 Ga0501044_1573271 3300049823 Bacteria 522
567 nmdc:mga09592_264993_c1 3300050508 Bacteria 1490
568 nmdc:mga08y16_168621_c1 3300050511 Bacteria 2274
569 nmdc:mga08y16_307808_c1 3300050511 Bacteria 1632
570 nmdc:mga0rr50_907305_c1 3300050513 Bacteria 751
571 Ga0495601_0037316 3300053077 Bacteria 3038
572 Ga0495612_0387974 3300053078 Bacteria 634
573 Ga0495595_0335050 3300053084 Bacteria 763
574 Ga0495619_0190541 3300053085 Bacteria 1419
575 Ga0587066_077996 3300059490 Bacteria 712
576 Ga0587066_101130 3300059490 Bacteria 655
577 Ga0587070_037976 3300059491 Bacteria 908
578 Ga0587070_059351 3300059491 Bacteria 787
579 Ga0587070_091628 3300059491 Bacteria 685
580 Ga0587073_0194169 3300059492 Bacteria 604
581 Ga0587077_013632 3300059493 Bacteria 1323
582 Ga0587077_055521 3300059493 Bacteria 842
583 Ga0587077_073292 3300059493 Bacteria 770
584 Ga0587077_103608 3300059493 Bacteria 687
585 Ga0587080_016079 3300059503 Bacteria 1177
586 Ga0587080_146217 3300059503 Bacteria 544
587 Ga0587082_019893 3300059504 Bacteria 1082
588 Ga0587083_0088097 3300059505 Bacteria 752
589 Ga0587083_0164164 3300059505 Bacteria 610
590 Ga0587086_010142 3300059507 Bacteria 1134
591 Ga0587088_066854 3300059508 Bacteria 741
592 Ga0587095_001316 3300059514 Bacteria 1505
593 Ga0587109_114101 3300059624 Bacteria 635
594 Ga0587115_015858 3300059626 Bacteria 1001
595 Ga0587069_013657 3300059642 Bacteria 1120
596 Ga0587072_010267 3300059643 Bacteria 1510
597 Ga0587072_145146 3300059643 Bacteria 569
598 Ga0587075_011241 3300059644 Bacteria 1198
599 Ga0587075_047138 3300059644 Bacteria 741
600 Ga0587076_055010 3300059645 Bacteria 787
601 Ga0587079_033951 3300059647 Bacteria 996
602 Ga0587079_064580 3300059647 Bacteria 802
603 Ga0587079_149367 3300059647 Bacteria 602
604 Ga0587100_026929 3300059648 Bacteria 592
605 Ga0587107_005191 3300059652 Bacteria 1366
606 Ga0587107_009409 3300059652 Bacteria 1153
607 Ga0587107_070446 3300059652 Bacteria 637
608 Ga0587114_022077 3300059655 Bacteria 907
609 Ga0587119_018222 3300059658 Bacteria 875
610 Ga0587071_125848 3300060344 Bacteria 617
611 Ga0587111_0012978 3300060346 Bacteria 1481
612 Ga0587111_0099644 3300060346 Bacteria 722
613 Ga0587111_0199644 3300060346 Bacteria 566
614 Ga0207711_10907428
615 LJQas_1012689
616 JGI24752J21851_1003590
617 JGI24737J22298_10024842
618 JGI24738J21930_10008993
619 Ga0006759J45824_1040862
620 Ga0007410J51695_1021220
621 Ga0007409J51694_1034732
622 Ga0007416J51690_1059353
623 Ga0007416J51690_1135492
624 Ga0007429J51699_1023882
625 Ga0007429J51699_1073541
626 Ga0058859_10031235
627 Ga0058859_10072571
628 Ga0058859_11771399
629 Ga0058859_11806325
630 Ga0058863_10011583
631 Ga0058863_10019978
632 Ga0058863_10025698
633 Ga0058863_10160997
634 Ga0058863_11927537
635 Ga0058861_10031427
636 Ga0058861_10068166
637 Ga0058861_10100634
638 Ga0058861_10174494
639 Ga0058860_12149395
640 Ga0058860_12169105
641 Ga0058860_12224385
642 Ga0058862_10015645
643 Ga0058862_10026066
644 Ga0058862_10053905
645 Ga0058862_10121865
646 Ga0058862_10180327
647 Ga0058862_12768226
648 Ga0058862_12775103
649 Ga0058862_12822515
650 Ga0058862_12870049
651 Ga0065712_10105869
652 Ga0065712_10246953
653 Ga0065715_10219187
654 Ga0070658_10002530
655 Ga0070658_10027578
656 Ga0070658_10089531
657 Ga0070658_10268770
658 Ga0070658_10372861
659 Ga0070658_10501341
660 Ga0070658_10569541
661 Ga0070676_10093025
662 Ga0070676_10132340
663 Ga0070683_100000662
664 Ga0070683_100003547
665 Ga0070683_100017034
666 Ga0070683_100057123
667 Ga0070683_100069251
668 Ga0070683_100171623
669 Ga0070683_100183978
670 Ga0070683_100322487
671 Ga0070683_100495166
672 Ga0070690_100075352
673 Ga0070690_100108436
674 Ga0070690_101003806
675 Ga0070670_100008774
676 Ga0070670_100084678
677 Ga0070670_100290046
678 Ga0070677_10094646
679 Ga0068869_100006227
680 Ga0070666_10084739
681 Ga0070680_100006760
682 Ga0070680_100046871
683 Ga0070680_100419539
684 Ga0070680_100596973
685 Ga0070682_100002639
686 Ga0070682_100723328
687 Ga0068868_100707797
688 Ga0070660_100423221
689 Ga0070689_100844357
690 Ga0070687_100435113
691 Ga0070661_100027604
692 Ga0070661_100086675
693 Ga0070661_100216428
694 Ga0070661_100624971
695 Ga0070661_100633806
696 Ga0070692_10370413
697 Ga0070668_100076225
698 Ga0070669_100014167
699 Ga0070669_100277876
700 Ga0070669_100711883
701 Ga0070669_100863143
702 Ga0070675_100001662
703 Ga0070675_100116171
704 Ga0070675_100701642
705 Ga0070675_100824202
706 Ga0070671_100131468
707 Ga0070671_100518071
708 Ga0070674_100231784
709 Ga0070673_100118119
710 Ga0070673_100189519
711 Ga0070673_100295875
712 Ga0070673_100445715
713 Ga0070673_100609365
714 Ga0070688_100004495
715 Ga0070659_100013361
716 Ga0070659_100045299
717 Ga0070659_100180618
718 Ga0070659_100259581
719 Ga0070667_100316185
720 Ga0070667_100870998
721 Ga0070709_10004433
722 Ga0070714_100123476
723 Ga0070714_101319056
724 Ga0070713_100045324
725 Ga0070713_100075174
726 Ga0070710_10309376
727 Ga0070701_10301713
728 Ga0070701_10681073
729 Ga0070711_100222579
730 Ga0070711_100344906
731 Ga0070705_100880341
732 Ga0070694_100994804
733 Ga0070708_100017280
734 Ga0070663_100583791
735 Ga0070662_100161194
736 Ga0070681_10026256
737 Ga0070681_10054797
738 Ga0070681_10135556
739 Ga0070681_10415097
740 Ga0068867_100023307
741 Ga0070685_10109256
742 Ga0070706_100488462
743 Ga0070698_100337410
744 Ga0070679_100000771
745 Ga0070679_100005023
746 Ga0070679_100082272
747 Ga0070679_100087543
748 Ga0070679_100253998
749 Ga0070684_100004296
750 Ga0070684_100015882
751 Ga0070684_100088411
752 Ga0070684_100112014
753 Ga0070684_100178147
754 Ga0070684_100939700
755 Ga0070684_101010613
756 Ga0068853_100276435
757 Ga0068853_101508768
758 Ga0070672_100035408
759 Ga0070672_100083137
760 Ga0070672_100275162
761 Ga0070672_101282597
762 Ga0070686_101478739
763 Ga0070696_100239800
764 Ga0070693_101109436
765 Ga0070704_100585658
766 Ga0068855_100114484
767 Ga0068855_100960826
768 Ga0070664_100016816
769 Ga0070664_100215244
770 Ga0070664_100623148
771 Ga0068857_100004677
772 Ga0068857_100022826
773 Ga0068857_100094341
774 Ga0068857_101199528
775 Ga0068854_100779860
776 Ga0068854_100999353
777 Ga0068856_100037691
778 Ga0068856_100092780
779 Ga0068856_100162634
780 Ga0068856_100416410
781 Ga0070702_100006432
782 Ga0070702_100116480
783 Ga0070702_100285054
784 Ga0068852_100215707
785 Ga0068852_100347488
786 Ga0068852_101486673
787 Ga0068859_100088363
788 Ga0068859_100112215
789 Ga0068859_101679150
790 Ga0068864_100024854
791 Ga0068866_10098877
792 Ga0068861_100619558
793 Ga0068851_10172401
794 Ga0068851_10214314
795 Ga0068870_10012644
796 Ga0068863_100029136
797 Ga0068863_100069225
798 Ga0068858_100147199
799 Ga0068858_100192377
800 Ga0068858_101409200
801 Ga0068860_100021657
802 Ga0068862_100058772
803 Ga0068862_100423028
804 Ga0075432_10153999
805 Ga0070716_100529257
806 Ga0070712_100125839
807 Ga0097621_100010975
808 Ga0097621_100272783
809 Ga0068871_100284792
810 Ga0068871_100316158
811 Ga0068871_101344292
812 Ga0075434_101383660
813 Ga0075429_100303956
814 Ga0068865_100005638
815 Ga0097620_100088359
816 Ga0097620_100112208
817 Ga0097620_101679142
818 Ga0075435_101270120
819 Ga0105240_10267128
820 Ga0111539_10187731
821 Ga0111539_10233831
822 Ga0105245_10187854
823 Ga0105243_10051387
824 Ga0105243_10886061
825 Ga0105243_11528073
826 Ga0105241_10008171
827 Ga0105241_10141303
828 Ga0105241_11003878
829 Ga0105242_10101363
830 Ga0105242_10287784
831 Ga0105242_10362970
832 Ga0105242_11328191
833 Ga0105248_10077657
834 Ga0105248_10325266
835 Ga0105248_10570335
836 Ga0105248_11120906
837 Ga0105237_10197173
838 Ga0105237_10445491
839 Ga0105237_10553013
840 Ga0105237_11044972
841 Ga0105238_10069130
842 Ga0105238_10493845
843 Ga0105238_10798874
844 Ga0105249_10130805
845 Ga0105239_10025248
846 Ga0105239_10427565
847 Ga0105239_11049295
848 Ga0105246_10001421
849 Ga0105246_10596453
850 Ga0157373_10135434
851 Ga0157373_10274111
852 Ga0157373_10450611
853 Ga0157373_10868718
854 Ga0157371_10018782
855 Ga0157371_10066051
856 Ga0157371_10205383
857 Ga0157371_10733877
858 Ga0157371_11312407
859 Ga0157370_10007324
860 Ga0157370_10310553
861 Ga0157370_10393560
862 Ga0157370_10695108
863 Ga0157370_10852887
864 Ga0157369_10059499
865 Ga0157369_10217042
866 Ga0157369_10396672
867 Ga0157369_10545452
868 Ga0157369_10805984
869 Ga0157369_10956670
870 Ga0157374_10251765
871 Ga0157374_10422228
872 Ga0157378_10171220
873 Ga0157378_11311516
874 Ga0163162_10041886
875 Ga0163162_10397847
876 Ga0163162_10463736
877 Ga0157372_10194884
878 Ga0157372_10214535
879 Ga0157372_10405406
880 Ga0157372_10505550
881 Ga0157372_10749839
882 Ga0157372_10809219
883 Ga0157372_11055312
884 Ga0157372_11082912
885 Ga0157375_10016467
886 Ga0157375_10615385
887 Ga0157375_10744470
888 Ga0163163_10458713
889 Ga0163163_10514615
890 Ga0157380_10177783
891 Ga0157377_10006216
892 Ga0157377_10602755
893 Ga0157379_10214043
894 Ga0157376_10986349
895 Ga0182007_10094832
896 Ga0182007_10145981
897 Ga0163161_10106798
898 Ga0206356_10071443
899 Ga0206356_10458780
900 Ga0206356_10858288
901 Ga0206356_11088513
902 Ga0206356_11707898
903 Ga0206349_1385913
904 Ga0206355_1022390
905 Ga0206351_10392633
906 Ga0206352_10170617
907 Ga0206352_10186617
908 Ga0206352_10463369
909 Ga0206352_10780591
910 Ga0206352_10987980
911 Ga0206350_11319129
912 Ga0206354_11533883
913 Ga0224712_10141538
914 Ga0207697_10158761
915 Ga0207656_10025013
916 Ga0207656_10112090
917 Ga0207682_10094051
918 Ga0207682_10106266
919 Ga0207682_10246966
920 Ga0207642_10037832
921 Ga0207688_10087613
922 Ga0207647_10095405
923 Ga0207685_10055812
924 Ga0207699_10032403
925 Ga0207645_10003859
926 Ga0207645_10458004
927 Ga0207643_10024386
928 Ga0207643_10466052
929 Ga0207705_10054893
930 Ga0207705_10114841
931 Ga0207705_10186495
932 Ga0207705_10313805
933 Ga0207654_10057461
934 Ga0207654_10814900
935 Ga0207707_10006540
936 Ga0207707_10009547
937 Ga0207707_10348257
938 Ga0207707_10522385
939 Ga0207695_10012644
940 Ga0207671_10250869
941 Ga0207693_10052380
942 Ga0207693_10732457
943 Ga0207663_10036893
944 Ga0207663_10038395
945 Ga0207663_10296715
946 Ga0207663_10355872
947 Ga0207660_10008227
948 Ga0207660_10009120
949 Ga0207660_10920253
950 Ga0207662_10001709
951 Ga0207657_10041175
952 Ga0207657_10126471
953 Ga0207649_10314641
954 Ga0207652_10003240
955 Ga0207652_10055753
956 Ga0207652_10070046
957 Ga0207652_10175589
958 Ga0207681_10004359
959 Ga0207681_11063034
960 Ga0207694_10120264
961 Ga0207650_10002341
962 Ga0207650_10049790
963 Ga0207659_10005988
964 Ga0207659_10576600
965 Ga0207659_10648374
966 Ga0207687_10166331
967 Ga0207687_10292241
968 Ga0207700_10024941
969 Ga0207700_10376199
970 Ga0207664_10006700
971 Ga0207664_10049834
972 Ga0207644_10238659
973 Ga0207644_10246538
974 Ga0207644_10411415
975 Ga0207690_10008263
976 Ga0207690_10036856
977 Ga0207686_10021294
978 Ga0207686_10142532
979 Ga0207686_11442138
980 Ga0207709_11155616
981 Ga0207670_10131140
982 Ga0207670_10805599
983 Ga0207669_10134761
984 Ga0207704_10007324
985 Ga0207691_10036983
986 Ga0207691_10054622
987 Ga0207691_10300556
988 Ga0207691_10748588
989 Ga0207711_10140777
990 Ga0207689_10002618
991 Ga0207661_10003817
992 Ga0207661_10068651
993 Ga0207661_10111017
994 Ga0207661_10135219
995 Ga0207661_10210766
996 Ga0207661_10517084
997 Ga0207661_11180243
998 Ga0207679_10001825
999 Ga0207679_10629173
1000 Ga0207667_10058152
1001 Ga0207667_10117398
1002 Ga0207667_10769188
1003 Ga0207651_10076222
1004 Ga0207651_10135290
1005 Ga0207651_10207994
1006 Ga0207651_10989825
1007 Ga0207712_10430976
1008 Ga0207712_10883219
1009 Ga0207668_10015561
1010 Ga0207658_11598351
1011 Ga0207677_10549543
1012 Ga0207703_10068730
1013 Ga0207703_10447393
1014 Ga0207639_11109279
1015 Ga0207678_10284573
1016 Ga0207678_10299760
1017 Ga0207678_10752195
1018 Ga0207708_10277693
1019 Ga0207702_10012764
1020 Ga0207702_10228532
1021 Ga0207702_10265467
1022 Ga0207702_10271109
1023 Ga0207702_10823257
1024 Ga0207641_10043525
1025 Ga0207641_10996400
1026 Ga0207648_10007649
1027 Ga0207676_10016488
1028 Ga0207676_10294957
1029 Ga0207674_10002535
1030 Ga0207674_10026110
1031 Ga0207674_10026159
1032 Ga0207674_10494805
1033 Ga0207674_10888353
1034 Ga0207675_100132057
1035 Ga0207698_10179186
1036 Ga0207428_10201907
1037 Ga0268265_10038929
1038 Ga0268264_10091803
1039 Ga0307408_100874958
1040 Ga0307413_10012801
1041 Ga0307410_10249149
1042 Ga0307406_10074765
1043 Ga0307409_100046838
1044 Ga0307416_100947453
1045 Ga0307416_101084829
1046 Ga0307414_10135109
1047 Ga0307414_10652751
1048 Ga0307415_100105915
1049 Ga0307415_100173988
1050 Ga0307415_100445546
1051 Ga0307415_100567230
1052 Ga0373948_0094813
1053 Ga0373936_0477670
1054 Ga0373945_0117639
1055 Ga0373954_0045633
1056 Ga0373957_0126894
1057 Ga0373943_0029448
1058 Ga0373943_0281684
1059 Ga0373955_0016306
1060 Ga0373955_0052973
1061 Ga0373955_0328400
1062 Ga0373961_0046461
1063 Ga0373924_0062334
1064 Ga0373935_0245403
1065 Ga0373927_0033533
1066 Ga0373927_0197044
1067 Ga0373933_0051813
1068 Ga0373937_0015856
1069 Ga0373937_0166609
1070 Ga0373937_0969823
1071 Ga0373925_0031465
1072 Ga0373925_0037683
1073 Ga0395900_0323581
1074 Ga0395905_0139084
1075 Ga0395901_0434478
1076 Ga0436363_1599808
1077 Ga0466961_0279357
1078 Ga0451576_0054679
1079 Ga0451576_2595716
1080 Ga0466967_0026287
1081 Ga0495592_0086410
1082 Ga0495629_0024153
1083 Ga0495651_0073973
1084 Ga0495651_0162192
1085 Ga0495651_0413669
1086 Ga0495653_0045292
1087 Ga0495580_0013439
1088 Ga0495582_0165473
1089 Ga0495582_0200302
1090 Ga0495639_0288650
1091 Ga0495662_0029855
1092 Ga0495662_0156645
1093 Ga0495664_0009895
1094 Ga0495664_0529448
1095 Ga0495594_0002515
1096 Ga0495594_0009546
1097 Ga0495596_0197002
1098 Ga0495608_0018028
1099 Ga0495608_0753323
1100 Ga0495628_0260991
1101 Ga0495628_0267701
1102 Ga0495630_0017051
1103 Ga0495642_0178357
1104 Ga0495652_0003351
1105 Ga0495652_0045072
1106 Ga0495665_0020004
1107 Ga0495640_0224938
1108 Ga0495586_0051997
1109 Ga0495586_0055944
1110 Ga0495587_0000747
1111 Ga0495587_0023334
1112 Ga0495587_0482106
1113 Ga0495587_0758948
1114 Ga0495598_0187645
1115 Ga0495645_0000475
1116 Ga0495645_0000710
1117 Ga0495667_0001590
1118 Ga0495668_0464353
1119 Ga0495634_0335479
1120 Ga0495634_0405658
1121 Ga0495634_0449592
1122 Ga0495635_0032403
1123 Ga0495635_0487325
1124 Ga0495588_0206409
1125 Ga0495588_0744960
1126 Ga0495657_0062418
1127 Ga0495657_0151763
1128 Ga0495599_0003240
1129 Ga0495599_0003716
1130 Ga0495623_0032621
1131 Ga0495623_0121170
1132 Ga0495646_0042427
1133 Ga0495669_0204211
1134 Ga0495669_0231076
1135 Ga0495613_0043113
1136 Ga0495613_0158496
1137 Ga0495600_0069926
1138 Ga0495600_0260587
1139 Ga0495581_0033867
1140 Ga0495581_0163615
1141 Ga0495581_0361763
1142 Ga0495674_0186240
1143 Ga0495674_0210436
1144 Ga0495674_0530969
1145 Ga0495675_0041679
1146 Ga0495675_0202812
1147 Ga0495675_0230660
1148 Ga0495675_0312896
1149 Ga0495684_0006808
1150 Ga0495684_0011453
1151 Ga0495684_0036669
1152 Ga0495593_0038393
1153 Ga0495593_0401541
1154 Ga0495602_0035269
1155 Ga0495602_0236891
1156 Ga0496100_0139361
1157 Ga0496101_0253254
1158 Ga0496104_0165984
1159 Ga0496105_0393646
1160 Ga0496106_0843071
1161 Ga0496108_0085778
1162 Ga0496109_0310571
1163 Ga0496109_0397457
1164 Ga0496110_0167276
1165 Ga0496111_0510874
1166 Ga0496111_0723183
1167 Ga0496112_0014015
1168 Ga0496112_0024153
1169 Ga0496113_0311334
1170 Ga0496113_0495052
1171 Ga0496114_0491060
1172 Ga0496115_0485705
1173 Ga0501319_012248
1174 Ga0501320_068171
1175 Ga0501043_0054688
1176 Ga0501047_0002195
1177 Ga0501070_0061053
1178 Ga0501080_0824137
1179 Ga0501044_1573271
1180 nmdc:mga09592_264993_c1
1181 nmdc:mga08y16_168621_c1
1182 nmdc:mga08y16_307808_c1
1183 nmdc:mga0rr50_907305_c1
1184 Ga0495601_0037316
1185 Ga0495612_0387974
1186 Ga0495595_0335050
1187 Ga0495619_0190541
1188 Ga0587066_077996
1189 Ga0587066_101130
1190 Ga0587070_037976
1191 Ga0587070_059351
1192 Ga0587070_091628
1193 Ga0587073_0194169
1194 Ga0587077_013632
1195 Ga0587077_055521
1196 Ga0587077_073292
1197 Ga0587077_103608
1198 Ga0587080_016079
1199 Ga0587080_146217
1200 Ga0587082_019893
1201 Ga0587083_0088097
1202 Ga0587083_0164164
1203 Ga0587086_010142
1204 Ga0587088_066854
1205 Ga0587095_001316
1206 Ga0587109_114101
1207 Ga0587115_015858
1208 Ga0587069_013657
1209 Ga0587072_010267
1210 Ga0587072_145146
1211 Ga0587075_011241
1212 Ga0587075_047138
1213 Ga0587076_055010
1214 Ga0587079_033951
1215 Ga0587079_064580
1216 Ga0587079_149367
1217 Ga0587100_026929
1218 Ga0587107_005191
1219 Ga0587107_009409
1220 Ga0587107_070446
1221 Ga0587114_022077
1222 Ga0587119_018222
1223 Ga0587071_125848
1224 Ga0587111_0012978
1225 Ga0587111_0099644
1226 Ga0587111_0199644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

10

132

0.86

Map