F469110

General Info

Members Datasets Scaffolds Average Seq Length
611 422 522 108

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2928531327|2928533232
Length 120
Sequence IPIDTVMRALADPTRRAVYERIVRAEEITVADLTRHSGVSQGAVSQHLKALKTAGLVAERPEGRRVYYRVQPQGLAPLVDWMSHYGVFWRDRFDDLRALLKDIDPPEFAPKDTDRKDTAK

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
3 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
4 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
5 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
6 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
9 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
10 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
11 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
12 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
13 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
14 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
15 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
16 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
17 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
18 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
19 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
20 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
21 2643221573 Lysobacter sp. Root604 Isolate Unclassified
22 2643221583 Caulobacter sp. Root655 Isolate Unclassified
23 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
24 2643221720 Lysobacter sp. Root916 Isolate Unclassified
25 2643221723 Ensifer sp. Root278 Isolate Unclassified
26 2643221728 Lysobacter sp. Root983 Isolate Unclassified
27 2718217882 Rhizobium sp. N741 Isolate Nodule
28 2718218009 Rhizobium sp. N561 Isolate Nodule
29 2718218363 Rhizobium sp. N113 Isolate Nodule
30 2718218366 Rhizobium sp. N621 Isolate Nodule
31 2721755514 Rhizobium sp. N6212 Isolate Nodule
32 2721755810 Rhizobium sp. N871 Isolate Nodule
33 2728369365 Rhizobium sp. N1341 Isolate Nodule
34 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
35 2791355260 Rhizobium sp. L9 Isolate Nodule
36 2791355264 Rhizobium sp. S9 Isolate Nodule
37 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
38 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
39 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
40 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
41 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
42 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
43 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
44 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
45 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
46 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
47 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
48 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
49 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
50 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
51 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
52 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
53 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
54 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
55 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
56 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
57 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
58 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
59 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
60 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
61 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
62 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
63 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
64 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
65 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
66 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
67 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
68 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
69 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
70 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
71 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
72 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
73 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
74 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
75 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
76 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
77 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
78 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
79 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
80 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
81 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
82 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
83 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
84 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
85 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
86 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
87 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
88 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
89 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
90 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
91 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
92 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
93 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
95 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
98 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
99 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
100 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
101 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
102 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
103 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
104 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
105 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
106 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
107 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
108 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
109 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
110 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
111 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
112 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
113 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
117 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
118 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
119 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
120 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
121 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
122 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
123 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
124 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
127 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
128 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
129 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
130 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
131 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
132 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
133 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
134 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
135 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
136 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
137 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
138 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
139 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
140 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
141 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
142 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
143 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
144 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
145 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
146 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
147 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
148 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
149 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
150 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
151 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
152 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
154 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
155 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
156 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
157 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
160 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
161 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
162 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
163 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
168 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
171 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
172 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
173 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
174 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
175 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
176 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
180 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
184 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
187 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
188 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
191 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
192 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
193 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
194 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
195 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
196 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
207 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
235 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
245 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
248 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
253 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
254 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
255 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
256 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
257 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
264 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
270 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
271 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
272 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
273 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
274 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
275 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
276 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
277 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
278 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
279 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
280 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
281 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
282 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
283 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
284 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
287 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
288 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
289 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
290 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
291 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
292 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
302 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
336 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
341 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
342 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
345 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
346 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
362 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
374 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
379 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
380 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
381 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
382 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
383 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
384 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
385 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
386 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
387 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
388 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
389 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
390 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
391 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
392 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
393 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
394 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
395 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
396 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
397 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
400 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
401 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
402 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
403 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
404 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
405 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
409 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
410 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
411 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
412 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
413 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
414 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
415 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
416 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
417 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
420 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
421 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
422 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.43
Metatranscriptomes 0
Isolates 14.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.24
Nodule 12.93
Rhizoplane 2.78
Rhizosphere 52.7
Stem 0
Stem Tuber 0
Unclassified 8.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10084512 3300001979 Bacteria 826
2 JGI24739J22299_10008629 3300001989 Bacteria 3803
3 JGI24737J22298_10017277 3300001990 Bacteria 2326
4 JGI24735J21928_10046128 3300002067 Bacteria 1264
5 JGI25158J39367_1012298 3300002739 Bacteria 1129
6 JGI25159J45721_1000015 3300002987 Bacteria 142431
7 JGI25151J46595_10011614 3300003187 Bacteria 4042
8 JGI25406J46586_10000047 3300003203 Bacteria 54770
9 JGI25406J46586_10162247 3300003203 Bacteria 652
10 JGI25153J46596_10029812 3300003215 Bacteria 1866
11 JGI25153J46596_10088291 3300003215 Bacteria 755
12 rootL2_10150296 3300003322 Bacteria 1965
13 JGI25160J50197_1000003 3300003354 Bacteria 482719
14 JGI25161J50226_1000741 3300003374 Bacteria 12537
15 Ga0055526_1004390 3300003771 Bacteria 8501
16 Ga0055537_1001778 3300003773 Bacteria 7891
17 Ga0055524_1016620 3300003775 Bacteria 2630
18 Ga0055524_1032933 3300003775 Bacteria 1459
19 Ga0055524_1053979 3300003775 Bacteria 884
20 Ga0055536_1001123 3300003781 Bacteria 16800
21 Ga0055528_1005639 3300003790 Bacteria 5784
22 Ga0055528_1005709 3300003790 Bacteria 5740
23 Ga0055530_10004321 3300003791 Bacteria 7390
24 Ga0055540_1014995 3300003792 Bacteria 2280
25 Ga0055543_1000034 3300004625 Bacteria 128668
26 Ga0065165_1000025 3300005262 Bacteria 246909
27 Ga0070658_10005436 3300005327 Bacteria 10336
28 Ga0070670_100000235 3300005331 Bacteria 50382
29 Ga0068869_100134555 3300005334 Bacteria 1903
30 Ga0070666_10000008 3300005335 Bacteria 293415
31 Ga0070660_100918789 3300005339 Bacteria 738
32 Ga0070661_100013390 3300005344 Bacteria 5757
33 Ga0070668_100508162 3300005347 Bacteria 1044
34 Ga0070668_101746660 3300005347 Bacteria 572
35 Ga0070669_100025480 3300005353 Bacteria 4248
36 Ga0070659_100029353 3300005366 Bacteria 4250
37 Ga0070659_100092438 3300005366 Bacteria 2426
38 Ga0070713_100866624 3300005436 Bacteria 868
39 Ga0070713_100964051 3300005436 Bacteria 822
40 Ga0070694_100746068 3300005444 Bacteria 799
41 Ga0070708_100162634 3300005445 Bacteria 2081
42 Ga0070708_100455554 3300005445 Bacteria 1207
43 Ga0070708_100668742 3300005445 Bacteria 978
44 Ga0070681_10811087 3300005458 Bacteria 853
45 Ga0070681_11493962 3300005458 Bacteria 600
46 Ga0070707_100312332 3300005468 Bacteria 1528
47 Ga0070707_100314217 3300005468 Bacteria 1523
48 Ga0070698_100084065 3300005471 Bacteria 3172
49 Ga0070698_100672616 3300005471 Bacteria 977
50 Ga0070698_100850709 3300005471 Bacteria 857
51 Ga0070699_100446269 3300005518 Bacteria 1173
52 Ga0070679_100195102 3300005530 Bacteria 1992
53 Ga0070697_100232175 3300005536 Bacteria 1574
54 Ga0070665_100236483 3300005548 Bacteria 1827
55 Ga0070665_101227012 3300005548 Bacteria 760
56 Ga0070665_101401654 3300005548 Bacteria 708
57 Ga0068857_100489906 3300005577 Bacteria 1153
58 Ga0068857_100846873 3300005577 Bacteria 875
59 Ga0068857_101376929 3300005577 Bacteria 686
60 Ga0068854_101241198 3300005578 Bacteria 669
61 Ga0068856_100507351 3300005614 Bacteria 1227
62 Ga0070702_100163688 3300005615 Bacteria 1440
63 Ga0068859_100552461 3300005617 Bacteria 1246
64 Ga0068864_102046421 3300005618 Bacteria 579
65 Ga0068866_10157037 3300005718 Bacteria 1323
66 Ga0068861_100009698 3300005719 Bacteria 6657
67 Ga0068870_10133752 3300005840 Bacteria 1443
68 Ga0068858_101382844 3300005842 Bacteria 693
69 Ga0068860_100575520 3300005843 Bacteria 1130
70 Ga0068862_100376168 3300005844 Bacteria 1324
71 Ga0068862_101190291 3300005844 Bacteria 760
72 Ga0081455_10158241 3300005937 Bacteria 1739
73 Ga0081538_10010032 3300005981 Bacteria 7811
74 Ga0081539_10000140 3300005985 Bacteria 166746
75 Ga0081539_10094066 3300005985 Bacteria 1543
76 Ga0070717_11139108 3300006028 Bacteria 710
77 Ga0075365_10028635 3300006038 Bacteria 3554
78 Ga0075365_10689049 3300006038 Bacteria 722
79 Ga0075368_10169854 3300006042 Bacteria 916
80 Ga0075368_10421137 3300006042 Bacteria 588
81 Ga0075363_100577628 3300006048 Bacteria 672
82 Ga0075364_10164049 3300006051 Bacteria 1501
83 Ga0070716_100391439 3300006173 Bacteria 997
84 Ga0070712_100678991 3300006175 Bacteria 877
85 Ga0075362_10086380 3300006177 Bacteria 1452
86 Ga0075362_10115528 3300006177 Bacteria 1267
87 Ga0075362_10357615 3300006177 Bacteria 732
88 Ga0075362_10401752 3300006177 Bacteria 691
89 Ga0075367_10157244 3300006178 Bacteria 1413
90 Ga0075369_10196386 3300006186 Bacteria 931
91 Ga0075369_10228758 3300006186 Bacteria 861
92 Ga0075366_10037335 3300006195 Bacteria 2868
93 Ga0075366_10101137 3300006195 Bacteria 1730
94 Ga0075366_10186459 3300006195 Bacteria 1260
95 Ga0075366_10203828 3300006195 Bacteria 1203
96 Ga0075366_10354921 3300006195 Bacteria 900
97 Ga0075366_10528986 3300006195 Bacteria 729
98 Ga0075366_10686968 3300006195 Bacteria 635
99 Ga0097621_100119917 3300006237 Bacteria 2230
100 Ga0075370_10247149 3300006353 Bacteria 1057
101 Ga0075370_10683893 3300006353 Bacteria 623
102 Ga0075428_101211399 3300006844 Bacteria 796
103 Ga0075430_100616516 3300006846 Bacteria 895
104 Ga0075433_10392128 3300006852 Bacteria 1225
105 Ga0068865_100597552 3300006881 Bacteria 932
106 Ga0068865_101895344 3300006881 Bacteria 540
107 Ga0097620_100552445 3300006931 Bacteria 1246
108 Ga0079104_1002956 3300006946 Bacteria 8390
109 Ga0099794_10070864 3300007265 Bacteria 1707
110 Ga0099794_10425017 3300007265 Bacteria 695
111 Ga0099795_10321646 3300007788 Bacteria 685
112 Ga0105240_10482952 3300009093 Bacteria 1381
113 Ga0111539_10000100 3300009094 Bacteria 91427
114 Ga0111539_10474741 3300009094 Bacteria 1456
115 Ga0111539_11169860 3300009094 Bacteria 894
116 Ga0105247_11598278 3300009101 Bacteria 535
117 Ga0114129_10036405 3300009147 Bacteria 6950
118 Ga0114129_10244130 3300009147 Bacteria 2413
119 Ga0114129_10764461 3300009147 Bacteria 1236
120 Ga0114129_11428232 3300009147 Bacteria 853
121 Ga0105243_10096309 3300009148 Bacteria 2448
122 Ga0105243_11883532 3300009148 Bacteria 631
123 Ga0105248_11243612 3300009177 Bacteria 842
124 Ga0105237_10032217 3300009545 Bacteria 5308
125 Ga0105237_10627370 3300009545 Bacteria 1082
126 Ga0105238_10000178 3300009551 Bacteria 69458
127 Ga0105249_10139742 3300009553 Bacteria 2321
128 Ga0105249_11286628 3300009553 Bacteria 803
129 Ga0123340_1065581 3300009763 Bacteria 951
130 Ga0123341_1006881 3300009765 Bacteria 10327
131 Ga0123342_1020394 3300009766 Bacteria 4851
132 Ga0099796_10032210 3300010159 Bacteria 1716
133 Ga0099796_10068079 3300010159 Bacteria 1279
134 Ga0099796_10486174 3300010159 Bacteria 552
135 Ga0105239_12875280 3300010375 Bacteria 562
136 Ga0105246_10025133 3300011119 Bacteria 3881
137 Ga0105246_10828819 3300011119 Bacteria 823
138 Ga0157373_10500353 3300013100 Bacteria 878
139 Ga0157373_10655404 3300013100 Bacteria 767
140 Ga0157371_10289731 3300013102 Bacteria 1184
141 Ga0157369_10045197 3300013105 Bacteria 4791
142 Ga0171463_1001 3300013249 Bacteria 1406070
143 Ga0163162_10000110 3300013306 Bacteria 73989
144 Ga0163162_10125090 3300013306 Bacteria 2677
145 Ga0163162_10573563 3300013306 Bacteria 1256
146 Ga0163162_11029712 3300013306 Bacteria 931
147 Ga0157372_10044853 3300013307 Bacteria 4901
148 Ga0157375_12108384 3300013308 Bacteria 671
149 Ga0157375_12802651 3300013308 Bacteria 583
150 Ga0163163_12210725 3300014325 Bacteria 609
151 Ga0163163_12679547 3300014325 Bacteria 556
152 Ga0157380_10091712 3300014326 Bacteria 2509
153 Ga0157380_10164708 3300014326 Bacteria 1931
154 Ga0157376_11081489 3300014969 Bacteria 827
155 Ga0182005_1054497 3300015265 Bacteria 1089
156 Ga0183363_1038 3300015690 Bacteria 43720
157 Ga0163161_10260187 3300017792 Bacteria 1355
158 Ga0213871_10023477 3300021441 Bacteria 1553
159 Ga0228711_1003229 3300022739 Bacteria 25290
160 Ga0228710_1000004 3300022740 Bacteria 250560
161 Ga0228598_1093986 3300024227 Bacteria 604
162 Ga0209436_100130 3300025208 Bacteria 37375
163 Ga0207425_1043790 3300025245 Bacteria 842
164 Ga0209565_1001017 3300025263 Bacteria 14345
165 Ga0209673_1000910 3300025273 Bacteria 37777
166 Ga0209673_1001024 3300025273 Bacteria 33282
167 Ga0209673_1002323 3300025273 Bacteria 13481
168 Ga0209130_1000005 3300025284 Bacteria 599620
169 Ga0209675_1057472 3300025291 Bacteria 779
170 Ga0209676_1001927 3300025292 Bacteria 16772
171 Ga0209025_1000105 3300025294 Bacteria 224157
172 Ga0209564_1000113 3300025295 Bacteria 211564
173 Ga0209564_1003780 3300025295 Bacteria 9853
174 Ga0209564_1025276 3300025295 Bacteria 2003
175 Ga0209564_1027096 3300025295 Bacteria 1871
176 Ga0209758_1000005 3300025297 Bacteria 1368918
177 Ga0209758_1003851 3300025297 Bacteria 13164
178 Ga0209758_1004830 3300025297 Bacteria 10876
179 Ga0209758_1051278 3300025297 Bacteria 1438
180 Ga0209050_1005247 3300025298 Bacteria 8259
181 Ga0209256_1002310 3300025299 Bacteria 15981
182 Ga0209256_1003107 3300025299 Bacteria 12151
183 Ga0209256_1003175 3300025299 Bacteria 11916
184 Ga0209256_1013685 3300025299 Bacteria 2992
185 Ga0207426_1000015 3300025302 Bacteria 599316
186 Ga0209051_1001056 3300025303 Bacteria 25758
187 Ga0209051_1013650 3300025303 Bacteria 3849
188 Ga0209257_1001948 3300025304 Bacteria 22281
189 Ga0209257_1058438 3300025304 Bacteria 1056
190 Ga0207688_10027060 3300025901 Bacteria 3155
191 Ga0207680_10000005 3300025903 Bacteria 660983
192 Ga0207647_10001693 3300025904 Bacteria 17005
193 Ga0207705_10023654 3300025909 Bacteria 4383
194 Ga0207695_10639275 3300025913 Bacteria 945
195 Ga0207671_10039392 3300025914 Bacteria 3500
196 Ga0207693_10211944 3300025915 Bacteria 1523
197 Ga0207660_10908104 3300025917 Bacteria 719
198 Ga0207657_11451853 3300025919 Bacteria 514
199 Ga0207649_10016493 3300025920 Bacteria 4168
200 Ga0207652_10205094 3300025921 Bacteria 1774
201 Ga0207646_10307836 3300025922 Bacteria 1431
202 Ga0207694_10000187 3300025924 Bacteria 62967
203 Ga0207650_10000203 3300025925 Bacteria 68710
204 Ga0207700_10749489 3300025928 Bacteria 873
205 Ga0207690_10038025 3300025932 Bacteria 3129
206 Ga0207690_10389008 3300025932 Bacteria 1110
207 Ga0207706_10285910 3300025933 Bacteria 1438
208 Ga0207689_10332131 3300025942 Bacteria 1262
209 Ga0207712_10989079 3300025961 Bacteria 746
210 Ga0207668_10079935 3300025972 Bacteria 2367
211 Ga0207668_11636581 3300025972 Bacteria 581
212 Ga0207703_11320044 3300026035 Bacteria 694
213 Ga0207676_11128580 3300026095 Bacteria 776
214 Ga0207674_10313265 3300026116 Bacteria 1518
215 Ga0207674_10840815 3300026116 Bacteria 885
216 Ga0207675_100014309 3300026118 Bacteria 7396
217 Ga0207675_100717469 3300026118 Bacteria 1009
218 Ga0207683_10088453 3300026121 Bacteria 2756
219 Ga0209281_1000134 3300027111 Bacteria 185406
220 Ga0209179_1004773 3300027512 Bacteria 2072
221 Ga0209282_1000013 3300027666 Bacteria 215053
222 Ga0209588_1064150 3300027671 Bacteria 1187
223 Ga0209998_10059000 3300027717 Bacteria 901
224 Ga0209974_10003650 3300027876 Bacteria 5526
225 Ga0207428_10000096 3300027907 Bacteria 123081
226 Ga0207428_10500653 3300027907 Bacteria 882
227 Ga0268266_10000051 3300028379 Bacteria 296231
228 Ga0268265_10172519 3300028380 Bacteria 1850
229 Ga0268265_11122688 3300028380 Bacteria 781
230 Ga0268264_10541884 3300028381 Bacteria 1140
231 Ga0265334_10095297 3300028573 Bacteria 1082
232 Ga0307517_10289394 3300028786 Bacteria 927
233 Ga0307515_10005291 3300028794 Bacteria 26238
234 Ga0307515_10048367 3300028794 Bacteria 6431
235 Ga0307515_10097511 3300028794 Bacteria 3592
236 Ga0307515_10256910 3300028794 Bacteria 1490
237 Ga0307515_10371254 3300028794 Bacteria 1067
238 Ga0307512_10449855 3300030522 Bacteria 520
239 Ga0265340_10147136 3300031247 Bacteria 1075
240 Ga0307513_10004959 3300031456 Bacteria 17650
241 Ga0307513_10008740 3300031456 Bacteria 12903
242 Ga0307513_10019885 3300031456 Bacteria 7978
243 Ga0307513_10023597 3300031456 Bacteria 7183
244 Ga0307513_10630643 3300031456 Bacteria 780
245 Ga0307509_10000008 3300031507 Bacteria 354271
246 Ga0307408_100502098 3300031548 Bacteria 1062
247 Ga0307408_100636626 3300031548 Bacteria 952
248 Ga0307508_10761986 3300031616 Bacteria 582
249 Ga0307514_10493317 3300031649 Bacteria 585
250 Ga0307516_10011416 3300031730 Bacteria 9650
251 Ga0307516_10014057 3300031730 Bacteria 8487
252 Ga0307516_10106482 3300031730 Bacteria 2614
253 Ga0307516_10848554 3300031730 Bacteria 577
254 Ga0307413_11584061 3300031824 Bacteria 581
255 Ga0307410_11445997 3300031852 Bacteria 604
256 Ga0315914_1000004 3300031967 Bacteria 288534
257 Ga0307409_100207807 3300031995 Bacteria 1757
258 Ga0307409_101503347 3300031995 Bacteria 701
259 Ga0307416_101061083 3300032002 Bacteria 914
260 Ga0307414_10533009 3300032004 Bacteria 1044
261 Ga0307411_10066715 3300032005 Bacteria 2419
262 Ga0307411_11256555 3300032005 Bacteria 673
263 Ga0307510_10004361 3300033180 Bacteria 16655
264 Ga0315913_1008800 3300033430 Bacteria 11917
265 Ga0315915_1000003 3300033464 Bacteria 407996
266 Ga0373936_0089938 3300035113 Bacteria 1286
267 Ga0373955_0701424 3300035172 Bacteria 621
268 Ga0373937_1841019 3300036401 Bacteria 552
269 Ga0373925_0091442 3300037068 Bacteria 2327
270 Ga0237816_05962 3300039145 Bacteria 805
271 Ga0436360_1260730 3300039438 Bacteria 7257
272 Ga0451787_206899 3300041441 Bacteria 789
273 Ga0451789_1137576 3300041443 Bacteria 743
274 Ga0451791_0250196 3300041451 Bacteria 557
275 Ga0451791_0840209 3300041451 Bacteria 1585
276 Ga0451791_1103342 3300041451 Bacteria 529
277 Ga0451793_1673673 3300041452 Bacteria 839
278 Ga0451798_0370119 3300041458 Bacteria 675
279 Ga0451798_0831548 3300041458 Bacteria 532
280 Ga0451800_0954538 3300041459 Bacteria 782
281 Ga0451802_0270859 3300041460 Bacteria 1315
282 Ga0451807_1014837 3300041486 Bacteria 821
283 Ga0451807_2369701 3300041486 Bacteria 603
284 Ga0451833_1488514 3300041491 Bacteria 2254
285 Ga0451839_0757778 3300041496 Bacteria 1524
286 Ga0451839_0799513 3300041496 Bacteria 599
287 Ga0451845_0029820 3300041501 Bacteria 699
288 Ga0451845_0773355 3300041501 Bacteria 1123
289 Ga0451847_0214195 3300041503 Bacteria 1509
290 Ga0451849_0122095 3300041505 Bacteria 3585
291 Ga0451849_0216237 3300041505 Bacteria 527
292 Ga0451849_0831447 3300041505 Bacteria 1198
293 Ga0451849_1567097 3300041505 Bacteria 1403
294 Ga0451855_2043013 3300041511 Bacteria 979
295 Ga0451853_1004850 3300041512 Bacteria 1124
296 Ga0439445_0067643 3300042004 Bacteria 985
297 Ga0439449_0111301 3300042007 Bacteria 1014
298 Ga0439452_056552 3300042010 Bacteria 887
299 Ga0439455_0211271 3300042012 Bacteria 563
300 Ga0450898_045138 3300042134 Bacteria 841
301 Ga0439446_0002554 3300042156 Bacteria 4383
302 Ga0466970_0426283 3300044765 Bacteria 759
303 Ga0495627_000407 3300046453 Bacteria 38017
304 Ga0495603_0127020 3300046455 Bacteria 1486
305 Ga0495629_0009289 3300046459 Bacteria 7194
306 Ga0495638_0001482 3300046460 Bacteria 21206
307 Ga0495638_0003450 3300046460 Bacteria 12448
308 Ga0495638_0453387 3300046460 Bacteria 654
309 Ga0495650_0000027 3300046471 Bacteria 475071
310 Ga0495650_0000068 3300046471 Bacteria 266671
311 Ga0495650_0005807 3300046471 Bacteria 7871
312 Ga0495650_0331498 3300046471 Bacteria 505
313 Ga0495605_0053760 3300046474 Bacteria 1952
314 Ga0495605_0093565 3300046474 Bacteria 1390
315 Ga0495584_0014383 3300046491 Bacteria 4030
316 Ga0495584_0706464 3300046491 Bacteria 514
317 Ga0495585_0029125 3300046492 Bacteria 3145
318 Ga0495585_0387033 3300046492 Bacteria 675
319 Ga0495596_0002870 3300046500 Bacteria 8974
320 Ga0495596_0088067 3300046500 Bacteria 1205
321 Ga0495607_0058618 3300046501 Bacteria 2200
322 Ga0495606_0005676 3300046507 Bacteria 11812
323 Ga0495606_0088338 3300046507 Bacteria 1911
324 Ga0495606_0273977 3300046507 Bacteria 926
325 Ga0495606_0597953 3300046507 Bacteria 542
326 Ga0495610_0000111 3300046512 Bacteria 95122
327 Ga0495610_0105993 3300046512 Bacteria 1252
328 Ga0495610_0108702 3300046512 Bacteria 1231
329 Ga0495616_0277065 3300046513 Bacteria 714
330 Ga0495620_0027728 3300046515 Bacteria 2646
331 Ga0495620_0029571 3300046515 Bacteria 2533
332 Ga0495620_0204601 3300046515 Bacteria 759
333 Ga0495620_0246868 3300046515 Bacteria 681
334 Ga0495620_0356979 3300046515 Bacteria 554
335 Ga0495631_0025231 3300046518 Bacteria 2739
336 Ga0495631_0094180 3300046518 Bacteria 1289
337 Ga0495631_0261887 3300046518 Bacteria 737
338 Ga0495631_0408511 3300046518 Bacteria 578
339 Ga0495632_0075564 3300046519 Bacteria 1612
340 Ga0495632_0340546 3300046519 Bacteria 660
341 Ga0495637_0039480 3300046520 Bacteria 2037
342 Ga0495643_0021433 3300046522 Bacteria 3707
343 Ga0495643_0023670 3300046522 Bacteria 3489
344 Ga0495643_0086517 3300046522 Bacteria 1623
345 Ga0495643_0104390 3300046522 Bacteria 1448
346 Ga0495643_0176128 3300046522 Bacteria 1042
347 Ga0495643_0294009 3300046522 Bacteria 743
348 Ga0495643_0522782 3300046522 Bacteria 508
349 Ga0495644_0030514 3300046523 Bacteria 2035
350 Ga0495648_0027461 3300046524 Bacteria 3808
351 Ga0495648_0331386 3300046524 Bacteria 702
352 Ga0495663_0065808 3300046525 Bacteria 1146
353 Ga0495642_0244600 3300046528 Bacteria 784
354 Ga0495652_0983122 3300046529 Bacteria 553
355 Ga0495654_0000051 3300046530 Bacteria 145932
356 Ga0495654_0220588 3300046530 Bacteria 802
357 Ga0495609_0002341 3300046538 Bacteria 11693
358 Ga0495621_0227270 3300046539 Bacteria 757
359 Ga0495597_0172065 3300046542 Bacteria 879
360 Ga0495622_0037936 3300046557 Bacteria 2243
361 Ga0495622_0145140 3300046557 Bacteria 1076
362 Ga0495633_0053268 3300046558 Bacteria 1905
363 Ga0495633_0059309 3300046558 Bacteria 1795
364 Ga0495656_0011297 3300046615 Bacteria 3275
365 Ga0495668_0264943 3300046616 Bacteria 941
366 Ga0495668_0661646 3300046616 Bacteria 577
367 Ga0495611_0013215 3300046648 Bacteria 3513
368 Ga0495625_0014131 3300046660 Bacteria 6389
369 Ga0495625_0078069 3300046660 Bacteria 2311
370 Ga0495625_0080911 3300046660 Bacteria 2261
371 Ga0495625_0099729 3300046660 Bacteria 1997
372 Ga0495625_0222795 3300046660 Bacteria 1235
373 Ga0495625_0483051 3300046660 Bacteria 760
374 Ga0495625_0905869 3300046660 Bacteria 505
375 Ga0495635_0633388 3300046663 Bacteria 697
376 Ga0495659_0083916 3300046664 Bacteria 1213
377 Ga0495659_0421969 3300046664 Bacteria 578
378 Ga0495661_0095093 3300046665 Bacteria 1688
379 Ga0495661_0125187 3300046665 Bacteria 1415
380 Ga0495661_0333450 3300046665 Bacteria 751
381 Ga0495588_0024755 3300046674 Bacteria 2985
382 Ga0495624_0194317 3300046690 Bacteria 1234
383 Ga0495670_0077140 3300046691 Bacteria 1694
384 Ga0495670_0356316 3300046691 Bacteria 788
385 Ga0495670_0378776 3300046691 Unclassified 763
386 Ga0495671_0230892 3300046692 Bacteria 895
387 Ga0495671_0590848 3300046692 Unclassified 528
388 Ga0495649_0319192 3300046694 Bacteria 788
389 Ga0495649_0375567 3300046694 Bacteria 716
390 Ga0495589_0013549 3300046794 Bacteria 4205
391 Ga0495589_0020332 3300046794 Bacteria 3396
392 Ga0495589_0058705 3300046794 Bacteria 1892
393 Ga0495589_0563997 3300046794 Bacteria 519
394 Ga0495600_0045733 3300046809 Bacteria 2856
395 Ga0495660_0258695 3300046810 Bacteria 804
396 Ga0495636_0049141 3300047318 Bacteria 1763
397 Ga0495672_0010003 3300047320 Bacteria 6801
398 Ga0495672_0042238 3300047320 Bacteria 2751
399 Ga0495672_0056243 3300047320 Bacteria 2290
400 Ga0495672_0226920 3300047320 Bacteria 919
401 Ga0495687_157183 3300047443 Bacteria 770
402 Ga0495677_0016610 3300047445 Bacteria 2671
403 Ga0495679_118205 3300047446 Bacteria 726
404 Ga0495673_0000091 3300047469 Bacteria 187985
405 Ga0495673_0008898 3300047469 Bacteria 5596
406 Ga0495681_0092893 3300047470 Bacteria 1329
407 Ga0495681_0277828 3300047470 Bacteria 654
408 Ga0495686_0023057 3300047472 Bacteria 4112
409 Ga0495686_0175496 3300047472 Bacteria 1244
410 Ga0495686_0180678 3300047472 Bacteria 1222
411 Ga0495686_0363682 3300047472 Bacteria 784
412 Ga0495593_0439620 3300047673 Bacteria 653
413 Ga0495626_0007371 3300048091 Bacteria 6127
414 Ga0495626_0049928 3300048091 Bacteria 1935
415 Ga0496102_0629566 3300048905 Bacteria 996
416 Ga0496114_1155747 3300048917 Bacteria 660
417 Ga0496115_0017368 3300048918 Bacteria 5499
418 Ga0496115_0037006 3300048918 Bacteria 3866
419 Ga0496120_0126705 3300048923 Bacteria 1313
420 Ga0496121_0111863 3300048924 Bacteria 2081
421 Ga0496125_0052011 3300048928 Bacteria 3372
422 Ga0496126_0222599 3300048929 Bacteria 1584
423 Ga0501034_1262481 3300049571 Bacteria 616
424 Ga0501036_1470274 3300049572 Unclassified 552
425 Ga0501037_0586263 3300049573 Bacteria 750
426 Ga0501047_0014401 3300049581 Bacteria 7519
427 Ga0501067_0307052 3300049583 Bacteria 883
428 Ga0501069_0246570 3300049585 Bacteria 1041
429 Ga0501073_0070304 3300049589 Bacteria 2438
430 Ga0501219_008463 3300049703 Bacteria 753
431 Ga0501225_0099242 3300049705 Bacteria 850
432 Ga0501080_0043020 3300049742 Bacteria 4205
433 Ga0501083_0029947 3300049744 Bacteria 3740
434 Ga0501044_0279489 3300049823 Bacteria 1603
435 nmdc:mga03683_178746_c1 3300050489 Bacteria 967
436 nmdc:mga03683_249769_c1 3300050489 Bacteria 824
437 nmdc:mga03683_261591_c1 3300050489 Bacteria 805
438 nmdc:mga03683_354154_c1 3300050489 Bacteria 695
439 nmdc:mga03n38_243577_c1 3300050490 Bacteria 947
440 nmdc:mga00v17_686255_c1 3300050491 Bacteria 657
441 nmdc:mga0yw44_179788_c1 3300050492 Bacteria 1392
442 nmdc:mga0yw44_273792_c1 3300050492 Bacteria 1127
443 nmdc:mga0yw44_98505_c1 3300050492 Bacteria 1859
444 nmdc:mga0k408_160611_c1 3300050493 Bacteria 1339
445 nmdc:mga0k408_272633_c1 3300050493 Bacteria 1010
446 nmdc:mga0k408_276849_c1 3300050493 Bacteria 1002
447 nmdc:mga0k408_67114_c1 3300050493 Bacteria 2090
448 nmdc:mga0k408_91122_c1 3300050493 Bacteria 1791
449 nmdc:mga06z11_568770_c1 3300050494 Bacteria 689
450 nmdc:mga06z11_920307_c1 3300050494 Bacteria 533
451 nmdc:mga07m45_301529_c1 3300050496 Bacteria 932
452 nmdc:mga07m45_359509_c1 3300050496 Bacteria 846
453 nmdc:mga07m45_45342_c1 3300050496 Bacteria 2469
454 nmdc:mga07m45_612147_c1 3300050496 Bacteria 629
455 nmdc:mga05p37_134895_c1 3300050507 Bacteria 3028
456 nmdc:mga05p37_1796307_c1 3300050507 Bacteria 592
457 nmdc:mga05p37_229130_c1 3300050507 Bacteria 2239
458 nmdc:mga09592_1685440_c1 3300050508 Bacteria 511
459 nmdc:mga0qj67_622586_c1 3300050509 Bacteria 862
460 nmdc:mga06r32_588782_c1 3300050510 Bacteria 1084
461 nmdc:mga08y16_62_c1 3300050511 Bacteria 89583
462 nmdc:mga08y16_656325_c1 3300050511 Bacteria 1053
463 nmdc:mga08y16_922451_c1 3300050511 Bacteria 858
464 nmdc:mga0a205_1187039_c1 3300050515 Bacteria 611
465 nmdc:mga0sz30_198887_c1 3300050516 Bacteria 890
466 Ga0500610_0002738 3300053079 Bacteria 6585
467 Ga0495655_0275306 3300053083 Bacteria 572
468 Ga0500578_0771256 3300053086 Bacteria 511
469 Ga0500643_019214 3300053087 Bacteria 2254
470 Ga0500644_0282582 3300053088 Bacteria 707
471 Ga0500646_0023676 3300053090 Bacteria 1648
472 Ga0500646_0069364 3300053090 Bacteria 1054
473 Ga0500646_0161947 3300053090 Bacteria 747
474 Ga0500566_0005190 3300053094 Bacteria 7755
475 Ga0500650_0192214 3300053098 Bacteria 932
476 Ga0500650_0305895 3300053098 Bacteria 703
477 Ga0500554_072482 3300053102 Bacteria 1123
478 Ga0500555_174956 3300053103 Bacteria 520
479 Ga0500556_0001096 3300053104 Bacteria 13560
480 Ga0500562_016324 3300053108 Bacteria 1909
481 Ga0500562_034602 3300053108 Bacteria 1337
482 Ga0500569_090839 3300053109 Bacteria 989
483 Ga0500594_0065146 3300053118 Bacteria 1059
484 Ga0500595_004320 3300053119 Bacteria 6402
485 Ga0500614_095057 3300053123 Bacteria 852
486 Ga0500642_0030447 3300053130 Bacteria 2245
487 Ga0500655_121993 3300053133 Bacteria 553
488 Ga0500658_0000367 3300053134 Bacteria 19903
489 Ga0500658_0001583 3300053134 Bacteria 9094
490 Ga0500658_0035889 3300053134 Bacteria 1965
491 Ga0500658_0048739 3300053134 Bacteria 1723
492 Ga0500658_0053565 3300053134 Bacteria 1655
493 Ga0500568_0005567 3300053139 Bacteria 6487
494 Ga0500568_0006793 3300053139 Bacteria 5703
495 Ga0500577_0013986 3300053142 Bacteria 2468
496 Ga0500577_0053937 3300053142 Bacteria 1521
497 Ga0500588_0036503 3300053146 Bacteria 1454
498 Ga0500590_000501 3300053148 Bacteria 13503
499 Ga0500603_000554 3300053150 Bacteria 9409
500 Ga0500604_0003450 3300053151 Bacteria 4258
501 Ga0500604_0076081 3300053151 Bacteria 1078
502 Ga0500604_0228427 3300053151 Bacteria 642
503 Ga0500616_0008119 3300053153 Bacteria 6565
504 Ga0500616_0043193 3300053153 Bacteria 2410
505 Ga0500616_0055491 3300053153 Bacteria 2072
506 Ga0500616_0085793 3300053153 Bacteria 1571
507 Ga0500622_0436837 3300053156 Bacteria 524
508 Ga0500627_0014585 3300053158 Bacteria 3014
509 Ga0500627_0092263 3300053158 Bacteria 1356
510 Ga0500634_0299346 3300053161 Bacteria 639
511 Ga0500639_013853 3300053163 Bacteria 4239
512 Ga0500637_0030423 3300053178 Bacteria 3004
513 Ga0500611_006365 3300053727 Bacteria 1716
514 Ga0500645_001569 3300053730 Bacteria 11375
515 Ga0500645_038697 3300053730 Bacteria 1414
516 Ga0500645_103035 3300053730 Bacteria 804
517 Ga0500609_000896 3300053731 Bacteria 4467
518 Ga0500587_000134 3300053739 Bacteria 6898
519 Ga0590074_060023 3300059423 Bacteria 706
520 Ga0590075_034695 3300059424 Bacteria 1284
521 Ga0590077_042502 3300059426 Bacteria 1012
522 Ga0501082_0010091 3300060353 Bacteria 8137

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0905869 Ga0495625_0905869_133_423 96
2 3300006177 Ga0075362_10401752 Ga0075362_104017522 99
3 3300006195 Ga0075366_10101137 Ga0075366_101011372 99
4 3300006195 Ga0075366_10186459 Ga0075366_101864592 99
5 3300009147 Ga0114129_10244130 Ga0114129_102441304 99
6 3300009553 Ga0105249_11286628 Ga0105249_112866282 99
7 3300028794 Ga0307515_10256910 Ga0307515_102569103 99
8 3300031456 Ga0307513_10019885 Ga0307513_1001988510 99
9 3300041458 Ga0451798_0370119 Ga0451798_0370119_10_309 99
10 3300041458 Ga0451798_0831548 Ga0451798_0831548_126_425 99
11 3300041486 Ga0451807_1014837 Ga0451807_1014837_24_323 99
12 3300041505 Ga0451849_0216237 Ga0451849_0216237_140_439 99
13 3300042012 Ga0439455_0211271 Ga0439455_0211271_158_457 99
14 3300042134 Ga0450898_045138 Ga0450898_045138_412_711 99
15 3300046471 Ga0495650_0005807 Ga0495650_0005807_3549_3848 99
16 3300046519 Ga0495632_0340546 Ga0495632_0340546_30_329 99
17 3300046665 Ga0495661_0333450 Ga0495661_0333450_376_675 99
18 3300046691 Ga0495670_0356316 Ga0495670_0356316_248_547 99
19 3300047446 Ga0495679_118205 Ga0495679_118205_344_643 99
20 3300047673 Ga0495593_0439620 Ga0495593_0439620_17_316 99
21 3300050489 nmdc:mga03683_261591_c1 nmdc:mga03683_261591_c1_149_448 99
22 3300050494 nmdc:mga06z11_920307_c1 nmdc:mga06z11_920307_c1_16_315 99
23 3300050507 nmdc:mga05p37_229130_c1 nmdc:mga05p37_229130_c1_434_733 99
24 3300050508 nmdc:mga09592_1685440_c1 nmdc:mga09592_1685440_c1_104_403 99
25 3300053139 Ga0500568_0006793 Ga0500568_0006793_809_1108 99
26 3300046471 Ga0495650_0331498 Ga0495650_0331498_111_422 103
27 iso_pu_bacteria 2920760137 2920764372 104
28 iso_pu_bacteria 2928531327 2928533232 104
29 iso_pu_bacteria 2510917020 2511125448 105
30 iso_pu_bacteria 2512875026 2512973129 105
31 iso_pu_bacteria 2513237085 2513580573 105
32 iso_pu_bacteria 2513237089 2513603490 105
33 iso_pu_bacteria 2513237156 2513983191 105
34 iso_pu_bacteria 2513237160 2514005730 105
35 iso_pu_bacteria 2513237162 2514022961 105
36 iso_pu_bacteria 2513237351 2514591369 105
37 iso_pu_bacteria 2515154113 2515638579 105
38 iso_pu_bacteria 2515154114 2515647192 105
39 iso_pu_bacteria 2515154134 2515743159 105
40 iso_pu_bacteria 2516653085 2517075092 105
41 iso_pu_bacteria 2517287029 2517405497 105
42 iso_pu_bacteria 2517487022 2517571868 105
43 iso_pu_bacteria 2582581306 2585265451 105
44 iso_pu_bacteria 2582581865 2585388469 105
45 iso_pu_bacteria 2582581866 2585392346 105
46 iso_pu_bacteria 2585427526 2585525254 105
47 iso_pu_bacteria 2643221545 2643748427 105
48 iso_pu_bacteria 2643221573 2643880918 105
49 iso_pu_bacteria 2643221583 2643926664 105
50 iso_pu_bacteria 2643221691 2644510100 105
51 iso_pu_bacteria 2643221720 2644661487 105
52 iso_pu_bacteria 2643221728 2644699568 105
53 iso_pu_bacteria 2718217882 2719179910 105
54 iso_pu_bacteria 2718218009 2719730659 105
55 iso_pu_bacteria 2718218363 2721146003 105
56 iso_pu_bacteria 2718218366 2721162883 105
57 iso_pu_bacteria 2721755514 2722839053 105
58 iso_pu_bacteria 2721755810 2724043415 105
59 iso_pu_bacteria 2728369365 2730163147 105
60 iso_pu_bacteria 2775506901 2776261402 105
61 iso_pu_bacteria 2791355260 2793324969 105
62 iso_pu_bacteria 2791355264 2793349321 105
63 iso_pu_bacteria 2802428858 2802718698 105
64 iso_pu_bacteria 2802428859 2802724376 105
65 iso_pu_bacteria 2802428860 2802729960 105
66 iso_pu_bacteria 2802428861 2802737303 105
67 iso_pu_bacteria 2802428862 2802742219 105
68 iso_pu_bacteria 2802428863 2802748902 105
69 iso_pu_bacteria 2838686498 2838688993 105
70 iso_pu_bacteria 2838729681 2838731288 105
71 iso_pu_bacteria 2838742623 2838743818 105
72 iso_pu_bacteria 2842156927 2842159671 105
73 iso_pu_bacteria 2842163707 2842169458 105
74 iso_pu_bacteria 2842180545 2842183713 105
75 iso_pu_bacteria 2842229732 2842233807 105
76 iso_pu_bacteria 2842243621 2842245282 105
77 iso_pu_bacteria 2842257432 2842260068 105
78 iso_pu_bacteria 2842271015 2842278589 105
79 iso_pu_bacteria 2842285085 2842290288 105
80 iso_pu_bacteria 2842304105 2842307147 105
81 iso_pu_bacteria 2842402390 2842408123 105
82 iso_pu_bacteria 2842409023 2842414884 105
83 iso_pu_bacteria 2842415677 2842421425 105
84 iso_pu_bacteria 2844454524 2844455518 105
85 iso_pu_bacteria 2852387548 2852393395 105
86 iso_pu_bacteria 2915980308 2915982626 105
87 iso_pu_bacteria 2916061851 2916063989 105
88 iso_pu_bacteria 2921250672 2921256399 105
89 iso_pu_bacteria 2933570622 2933572740 105
90 iso_pu_bacteria 2935901341 2935906682 105
91 iso_pu_bacteria 2937029754 2937030512 105
92 iso_pu_bacteria 2937036028 2937038979 105
93 iso_pu_bacteria 2937078374 2937083852 105
94 iso_pu_bacteria 2937084907 2937088614 105
95 iso_pu_bacteria 2941499720 2941506601 105
96 iso_pu_bacteria 2957375807 2957377945 105
97 iso_pu_bacteria 2957437181 2957438708 105
98 iso_pu_bacteria 2960591022 2960593240 105
99 iso_pu_bacteria 2960631154 2960635300 105
100 iso_pu_bacteria 2960680706 2960682586 105
101 iso_pu_bacteria 2960693952 2960697846 105
102 iso_pu_bacteria 2967686174 2967688524 105
103 iso_pu_bacteria 2967728569 2967732839 105
104 iso_pu_bacteria 2970026789 2970031890 105
105 iso_pu_bacteria 2970122695 2970122707 105
106 iso_pu_bacteria 2970143518 2970145229 105
107 iso_pu_bacteria 2977544691 2977547000 105
108 iso_pu_bacteria 8003999396 8004003540 105
109 iso_pu_bacteria 8005307578 8005310905 105
110 iso_pu_bacteria 8046767195 8046774451 105
111 iso_pu_bacteria 8057575449 8057579353 105
112 3300028573 Ga0265334_10095297 Ga0265334_100952971 106
113 3300031247 Ga0265340_10147136 Ga0265340_101471363 106
114 iso_pu_bacteria 2599185352 2600195361 106
115 iso_pu_bacteria 2643221723 2644671553 106
116 iso_pu_bacteria 2920822456 2920822912 106
117 3300049572 Ga0501036_1470274 Ga0501036_1470274_26_349 107
118 iso_pu_bacteria 2842357229 2842362971 107
119 3300009147 Ga0114129_10036405 Ga0114129_100364056 108
120 3300046455 Ga0495603_0127020 Ga0495603_0127020_844_1170 108
121 3300046507 Ga0495606_0597953 Ga0495606_0597953_167_493 108
122 3300046524 Ga0495648_0027461 Ga0495648_0027461_2353_2679 108
123 3300050507 nmdc:mga05p37_134895_c1 nmdc:mga05p37_134895_c1_1334_1660 108
124 3300053102 Ga0500554_072482 Ga0500554_072482_123_449 108
125 3300053150 Ga0500603_000554 Ga0500603_000554_7667_7993 108
126 3300053178 Ga0500637_0030423 Ga0500637_0030423_1096_1422 108
127 3300001979 JGI24740J21852_10084512 JGI24740J21852_100845122 109
128 3300001989 JGI24739J22299_10008629 JGI24739J22299_100086296 109
129 3300001990 JGI24737J22298_10017277 JGI24737J22298_100172772 109
130 3300002067 JGI24735J21928_10046128 JGI24735J21928_100461282 109
131 3300002739 JGI25158J39367_1012298 JGI25158J39367_10122982 109
132 3300002987 JGI25159J45721_1000015 JGI25159J45721_100001572 109
133 3300003187 JGI25151J46595_10011614 JGI25151J46595_100116143 109
134 3300003203 JGI25406J46586_10000047 JGI25406J46586_1000004726 109
135 3300003203 JGI25406J46586_10162247 JGI25406J46586_101622472 109
136 3300003215 JGI25153J46596_10029812 JGI25153J46596_100298123 109
137 3300003215 JGI25153J46596_10088291 JGI25153J46596_100882912 109
138 3300003322 rootL2_10150296 rootL2_101502963 109
139 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003112 109
140 3300003374 JGI25161J50226_1000741 JGI25161J50226_10007414 109
141 3300003771 Ga0055526_1004390 Ga0055526_100439011 109
142 3300003773 Ga0055537_1001778 Ga0055537_10017786 109
143 3300003775 Ga0055524_1016620 Ga0055524_10166204 109
144 3300003775 Ga0055524_1032933 Ga0055524_10329332 109
145 3300003775 Ga0055524_1053979 Ga0055524_10539791 109
146 3300003781 Ga0055536_1001123 Ga0055536_100112318 109
147 3300003790 Ga0055528_1005639 Ga0055528_10056393 109
148 3300003790 Ga0055528_1005709 Ga0055528_10057093 109
149 3300003791 Ga0055530_10004321 Ga0055530_100043219 109
150 3300003792 Ga0055540_1014995 Ga0055540_10149953 109
151 3300004625 Ga0055543_1000034 Ga0055543_100003442 109
152 3300005262 Ga0065165_1000025 Ga0065165_1000025221 109
153 3300005327 Ga0070658_10005436 Ga0070658_100054364 109
154 3300005331 Ga0070670_100000235 Ga0070670_10000023519 109
155 3300005334 Ga0068869_100134555 Ga0068869_1001345553 109
156 3300005335 Ga0070666_10000008 Ga0070666_1000000883 109
157 3300005339 Ga0070660_100918789 Ga0070660_1009187892 109
158 3300005344 Ga0070661_100013390 Ga0070661_1000133904 109
159 3300005347 Ga0070668_100508162 Ga0070668_1005081621 109
160 3300005347 Ga0070668_101746660 Ga0070668_1017466602 109
161 3300005353 Ga0070669_100025480 Ga0070669_1000254806 109
162 3300005366 Ga0070659_100029353 Ga0070659_1000293535 109
163 3300005366 Ga0070659_100092438 Ga0070659_1000924383 109
164 3300005436 Ga0070713_100866624 Ga0070713_1008666242 109
165 3300005436 Ga0070713_100964051 Ga0070713_1009640512 109
166 3300005444 Ga0070694_100746068 Ga0070694_1007460681 109
167 3300005445 Ga0070708_100162634 Ga0070708_1001626344 109
168 3300005445 Ga0070708_100455554 Ga0070708_1004555542 109
169 3300005445 Ga0070708_100668742 Ga0070708_1006687422 109
170 3300005458 Ga0070681_10811087 Ga0070681_108110872 109
171 3300005458 Ga0070681_11493962 Ga0070681_114939621 109
172 3300005468 Ga0070707_100312332 Ga0070707_1003123322 109
173 3300005468 Ga0070707_100314217 Ga0070707_1003142173 109
174 3300005471 Ga0070698_100084065 Ga0070698_1000840652 109
175 3300005471 Ga0070698_100672616 Ga0070698_1006726162 109
176 3300005471 Ga0070698_100850709 Ga0070698_1008507092 109
177 3300005518 Ga0070699_100446269 Ga0070699_1004462692 109
178 3300005530 Ga0070679_100195102 Ga0070679_1001951023 109
179 3300005536 Ga0070697_100232175 Ga0070697_1002321753 109
180 3300005548 Ga0070665_100236483 Ga0070665_1002364832 109
181 3300005548 Ga0070665_101227012 Ga0070665_1012270122 109
182 3300005548 Ga0070665_101401654 Ga0070665_1014016542 109
183 3300005577 Ga0068857_100489906 Ga0068857_1004899062 109
184 3300005577 Ga0068857_100846873 Ga0068857_1008468732 109
185 3300005577 Ga0068857_101376929 Ga0068857_1013769292 109
186 3300005578 Ga0068854_101241198 Ga0068854_1012411982 109
187 3300005614 Ga0068856_100507351 Ga0068856_1005073513 109
188 3300005615 Ga0070702_100163688 Ga0070702_1001636881 109
189 3300005617 Ga0068859_100552461 Ga0068859_1005524612 109
190 3300005618 Ga0068864_102046421 Ga0068864_1020464211 109
191 3300005718 Ga0068866_10157037 Ga0068866_101570372 109
192 3300005719 Ga0068861_100009698 Ga0068861_1000096984 109
193 3300005840 Ga0068870_10133752 Ga0068870_101337522 109
194 3300005842 Ga0068858_101382844 Ga0068858_1013828442 109
195 3300005843 Ga0068860_100575520 Ga0068860_1005755202 109
196 3300005844 Ga0068862_100376168 Ga0068862_1003761682 109
197 3300005844 Ga0068862_101190291 Ga0068862_1011902912 109
198 3300005937 Ga0081455_10158241 Ga0081455_101582413 109
199 3300005981 Ga0081538_10010032 Ga0081538_100100328 109
200 3300005985 Ga0081539_10000140 Ga0081539_1000014079 109
201 3300005985 Ga0081539_10094066 Ga0081539_100940662 109
202 3300006028 Ga0070717_11139108 Ga0070717_111391081 109
203 3300006038 Ga0075365_10028635 Ga0075365_100286357 109
204 3300006038 Ga0075365_10689049 Ga0075365_106890492 109
205 3300006042 Ga0075368_10169854 Ga0075368_101698541 109
206 3300006042 Ga0075368_10421137 Ga0075368_104211371 109
207 3300006048 Ga0075363_100577628 Ga0075363_1005776282 109
208 3300006051 Ga0075364_10164049 Ga0075364_101640491 109
209 3300006173 Ga0070716_100391439 Ga0070716_1003914393 109
210 3300006175 Ga0070712_100678991 Ga0070712_1006789911 109
211 3300006177 Ga0075362_10086380 Ga0075362_100863802 109
212 3300006177 Ga0075362_10115528 Ga0075362_101155282 109
213 3300006177 Ga0075362_10357615 Ga0075362_103576152 109
214 3300006178 Ga0075367_10157244 Ga0075367_101572443 109
215 3300006186 Ga0075369_10196386 Ga0075369_101963862 109
216 3300006186 Ga0075369_10228758 Ga0075369_102287582 109
217 3300006195 Ga0075366_10037335 Ga0075366_100373355 109
218 3300006195 Ga0075366_10203828 Ga0075366_102038282 109
219 3300006195 Ga0075366_10354921 Ga0075366_103549212 109
220 3300006195 Ga0075366_10528986 Ga0075366_105289862 109
221 3300006195 Ga0075366_10686968 Ga0075366_106869682 109
222 3300006237 Ga0097621_100119917 Ga0097621_1001199173 109
223 3300006353 Ga0075370_10247149 Ga0075370_102471493 109
224 3300006353 Ga0075370_10683893 Ga0075370_106838932 109
225 3300006844 Ga0075428_101211399 Ga0075428_1012113991 109
226 3300006846 Ga0075430_100616516 Ga0075430_1006165162 109
227 3300006852 Ga0075433_10392128 Ga0075433_103921282 109
228 3300006881 Ga0068865_100597552 Ga0068865_1005975522 109
229 3300006881 Ga0068865_101895344 Ga0068865_1018953441 109
230 3300006931 Ga0097620_100552445 Ga0097620_1005524452 109
231 3300006946 Ga0079104_1002956 Ga0079104_100295611 109
232 3300007265 Ga0099794_10070864 Ga0099794_100708643 109
233 3300007265 Ga0099794_10425017 Ga0099794_104250171 109
234 3300007788 Ga0099795_10321646 Ga0099795_103216462 109
235 3300009093 Ga0105240_10482952 Ga0105240_104829523 109
236 3300009094 Ga0111539_10000100 Ga0111539_1000010052 109
237 3300009094 Ga0111539_10474741 Ga0111539_104747413 109
238 3300009094 Ga0111539_11169860 Ga0111539_111698602 109
239 3300009101 Ga0105247_11598278 Ga0105247_115982782 109
240 3300009147 Ga0114129_10764461 Ga0114129_107644611 109
241 3300009147 Ga0114129_11428232 Ga0114129_114282322 109
242 3300009148 Ga0105243_10096309 Ga0105243_100963093 109
243 3300009148 Ga0105243_11883532 Ga0105243_118835321 109
244 3300009177 Ga0105248_11243612 Ga0105248_112436122 109
245 3300009545 Ga0105237_10032217 Ga0105237_100322177 109
246 3300009545 Ga0105237_10627370 Ga0105237_106273703 109
247 3300009551 Ga0105238_10000178 Ga0105238_1000017814 109
248 3300009553 Ga0105249_10139742 Ga0105249_101397422 109
249 3300009763 Ga0123340_1065581 Ga0123340_10655812 109
250 3300009765 Ga0123341_1006881 Ga0123341_100688115 109
251 3300009766 Ga0123342_1020394 Ga0123342_10203944 109
252 3300010159 Ga0099796_10032210 Ga0099796_100322103 109
253 3300010159 Ga0099796_10068079 Ga0099796_100680793 109
254 3300010159 Ga0099796_10486174 Ga0099796_104861741 109
255 3300010375 Ga0105239_12875280 Ga0105239_128752801 109
256 3300011119 Ga0105246_10025133 Ga0105246_100251333 109
257 3300011119 Ga0105246_10828819 Ga0105246_108288192 109
258 3300013100 Ga0157373_10500353 Ga0157373_105003532 109
259 3300013100 Ga0157373_10655404 Ga0157373_106554041 109
260 3300013102 Ga0157371_10289731 Ga0157371_102897312 109
261 3300013105 Ga0157369_10045197 Ga0157369_100451973 109
262 3300013249 Ga0171463_1001 Ga0171463_10011165 109
263 3300013306 Ga0163162_10000110 Ga0163162_100001107 109
264 3300013306 Ga0163162_10125090 Ga0163162_101250901 109
265 3300013306 Ga0163162_10573563 Ga0163162_105735631 109
266 3300013306 Ga0163162_11029712 Ga0163162_110297122 109
267 3300013307 Ga0157372_10044853 Ga0157372_100448534 109
268 3300013308 Ga0157375_12108384 Ga0157375_121083842 109
269 3300013308 Ga0157375_12802651 Ga0157375_128026511 109
270 3300014325 Ga0163163_12210725 Ga0163163_122107251 109
271 3300014325 Ga0163163_12679547 Ga0163163_126795472 109
272 3300014326 Ga0157380_10091712 Ga0157380_100917122 109
273 3300014326 Ga0157380_10164708 Ga0157380_101647083 109
274 3300014969 Ga0157376_11081489 Ga0157376_110814892 109
275 3300015265 Ga0182005_1054497 Ga0182005_10544972 109
276 3300015690 Ga0183363_1038 Ga0183363_103824 109
277 3300017792 Ga0163161_10260187 Ga0163161_102601871 109
278 3300021441 Ga0213871_10023477 Ga0213871_100234773 109
279 3300022739 Ga0228711_1003229 Ga0228711_100322912 109
280 3300022740 Ga0228710_1000004 Ga0228710_100000434 109
281 3300024227 Ga0228598_1093986 Ga0228598_10939861 109
282 3300025208 Ga0209436_100130 Ga0209436_10013015 109
283 3300025245 Ga0207425_1043790 Ga0207425_10437902 109
284 3300025263 Ga0209565_1001017 Ga0209565_100101710 109
285 3300025273 Ga0209673_1000910 Ga0209673_100091030 109
286 3300025273 Ga0209673_1001024 Ga0209673_100102434 109
287 3300025273 Ga0209673_1002323 Ga0209673_100232314 109
288 3300025284 Ga0209130_1000005 Ga0209130_1000005369 109
289 3300025291 Ga0209675_1057472 Ga0209675_10574722 109
290 3300025292 Ga0209676_1001927 Ga0209676_100192718 109
291 3300025294 Ga0209025_1000105 Ga0209025_100010549 109
292 3300025295 Ga0209564_1000113 Ga0209564_100011357 109
293 3300025295 Ga0209564_1003780 Ga0209564_10037805 109
294 3300025295 Ga0209564_1025276 Ga0209564_10252762 109
295 3300025295 Ga0209564_1027096 Ga0209564_10270963 109
296 3300025297 Ga0209758_1000005 Ga0209758_1000005154 109
297 3300025297 Ga0209758_1003851 Ga0209758_100385112 109
298 3300025297 Ga0209758_1004830 Ga0209758_10048303 109
299 3300025297 Ga0209758_1051278 Ga0209758_10512782 109
300 3300025298 Ga0209050_1005247 Ga0209050_10052475 109
301 3300025299 Ga0209256_1002310 Ga0209256_10023109 109
302 3300025299 Ga0209256_1003107 Ga0209256_100310715 109
303 3300025299 Ga0209256_1003175 Ga0209256_100317513 109
304 3300025299 Ga0209256_1013685 Ga0209256_10136854 109
305 3300025302 Ga0207426_1000015 Ga0207426_1000015230 109
306 3300025303 Ga0209051_1001056 Ga0209051_10010569 109
307 3300025303 Ga0209051_1013650 Ga0209051_10136504 109
308 3300025304 Ga0209257_1001948 Ga0209257_100194816 109
309 3300025304 Ga0209257_1058438 Ga0209257_10584382 109
310 3300025901 Ga0207688_10027060 Ga0207688_100270603 109
311 3300025903 Ga0207680_10000005 Ga0207680_10000005153 109
312 3300025904 Ga0207647_10001693 Ga0207647_1000169310 109
313 3300025909 Ga0207705_10023654 Ga0207705_100236545 109
314 3300025913 Ga0207695_10639275 Ga0207695_106392752 109
315 3300025914 Ga0207671_10039392 Ga0207671_100393925 109
316 3300025915 Ga0207693_10211944 Ga0207693_102119443 109
317 3300025917 Ga0207660_10908104 Ga0207660_109081042 109
318 3300025919 Ga0207657_11451853 Ga0207657_114518531 109
319 3300025920 Ga0207649_10016493 Ga0207649_100164934 109
320 3300025921 Ga0207652_10205094 Ga0207652_102050944 109
321 3300025922 Ga0207646_10307836 Ga0207646_103078363 109
322 3300025924 Ga0207694_10000187 Ga0207694_100001879 109
323 3300025925 Ga0207650_10000203 Ga0207650_1000020340 109
324 3300025928 Ga0207700_10749489 Ga0207700_107494892 109
325 3300025932 Ga0207690_10038025 Ga0207690_100380253 109
326 3300025932 Ga0207690_10389008 Ga0207690_103890081 109
327 3300025933 Ga0207706_10285910 Ga0207706_102859101 109
328 3300025942 Ga0207689_10332131 Ga0207689_103321313 109
329 3300025961 Ga0207712_10989079 Ga0207712_109890792 109
330 3300025972 Ga0207668_10079935 Ga0207668_100799353 109
331 3300025972 Ga0207668_11636581 Ga0207668_116365812 109
332 3300026035 Ga0207703_11320044 Ga0207703_113200441 109
333 3300026095 Ga0207676_11128580 Ga0207676_111285801 109
334 3300026116 Ga0207674_10313265 Ga0207674_103132652 109
335 3300026116 Ga0207674_10840815 Ga0207674_108408151 109
336 3300026118 Ga0207675_100014309 Ga0207675_1000143093 109
337 3300026118 Ga0207675_100717469 Ga0207675_1007174691 109
338 3300026121 Ga0207683_10088453 Ga0207683_100884533 109
339 3300027111 Ga0209281_1000134 Ga0209281_100013430 109
340 3300027512 Ga0209179_1004773 Ga0209179_10047735 109
341 3300027666 Ga0209282_1000013 Ga0209282_10000134 109
342 3300027671 Ga0209588_1064150 Ga0209588_10641502 109
343 3300027717 Ga0209998_10059000 Ga0209998_100590002 109
344 3300027876 Ga0209974_10003650 Ga0209974_100036504 109
345 3300027907 Ga0207428_10000096 Ga0207428_1000009617 109
346 3300027907 Ga0207428_10500653 Ga0207428_105006531 109
347 3300028379 Ga0268266_10000051 Ga0268266_10000051152 109
348 3300028380 Ga0268265_10172519 Ga0268265_101725193 109
349 3300028380 Ga0268265_11122688 Ga0268265_111226882 109
350 3300028381 Ga0268264_10541884 Ga0268264_105418842 109
351 3300028786 Ga0307517_10289394 Ga0307517_102893942 109
352 3300028794 Ga0307515_10005291 Ga0307515_1000529117 109
353 3300028794 Ga0307515_10048367 Ga0307515_100483676 109
354 3300028794 Ga0307515_10097511 Ga0307515_100975113 109
355 3300028794 Ga0307515_10371254 Ga0307515_103712542 109
356 3300030522 Ga0307512_10449855 Ga0307512_104498551 109
357 3300031456 Ga0307513_10004959 Ga0307513_1000495910 109
358 3300031456 Ga0307513_10008740 Ga0307513_1000874011 109
359 3300031456 Ga0307513_10023597 Ga0307513_100235976 109
360 3300031456 Ga0307513_10630643 Ga0307513_106306432 109
361 3300031507 Ga0307509_10000008 Ga0307509_1000000820 109
362 3300031548 Ga0307408_100502098 Ga0307408_1005020982 109
363 3300031548 Ga0307408_100636626 Ga0307408_1006366263 109
364 3300031616 Ga0307508_10761986 Ga0307508_107619862 109
365 3300031649 Ga0307514_10493317 Ga0307514_104933171 109
366 3300031730 Ga0307516_10011416 Ga0307516_100114163 109
367 3300031730 Ga0307516_10014057 Ga0307516_100140577 109
368 3300031730 Ga0307516_10106482 Ga0307516_101064822 109
369 3300031730 Ga0307516_10848554 Ga0307516_108485542 109
370 3300031824 Ga0307413_11584061 Ga0307413_115840612 109
371 3300031852 Ga0307410_11445997 Ga0307410_114459972 109
372 3300031967 Ga0315914_1000004 Ga0315914_100000439 109
373 3300031995 Ga0307409_100207807 Ga0307409_1002078073 109
374 3300031995 Ga0307409_101503347 Ga0307409_1015033472 109
375 3300032002 Ga0307416_101061083 Ga0307416_1010610831 109
376 3300032004 Ga0307414_10533009 Ga0307414_105330092 109
377 3300032005 Ga0307411_10066715 Ga0307411_100667151 109
378 3300032005 Ga0307411_11256555 Ga0307411_112565552 109
379 3300033180 Ga0307510_10004361 Ga0307510_100043616 109
380 3300033430 Ga0315913_1008800 Ga0315913_100880014 109
381 3300033464 Ga0315915_1000003 Ga0315915_1000003146 109
382 3300035113 Ga0373936_0089938 Ga0373936_0089938_857_1186 109
383 3300035172 Ga0373955_0701424 Ga0373955_0701424_157_492 109
384 3300036401 Ga0373937_1841019 Ga0373937_1841019_70_399 109
385 3300037068 Ga0373925_0091442 Ga0373925_0091442_1549_1878 109
386 3300039145 Ga0237816_05962 Ga0237816_05962_276_605 109
387 3300039438 Ga0436360_1260730 Ga0436360_1260730_3370_3699 109
388 3300041441 Ga0451787_206899 Ga0451787_206899_305_634 109
389 3300041443 Ga0451789_1137576 Ga0451789_1137576_99_428 109
390 3300041451 Ga0451791_0250196 Ga0451791_0250196_27_356 109
391 3300041451 Ga0451791_0840209 Ga0451791_0840209_194_523 109
392 3300041451 Ga0451791_1103342 Ga0451791_1103342_26_355 109
393 3300041452 Ga0451793_1673673 Ga0451793_1673673_466_795 109
394 3300041459 Ga0451800_0954538 Ga0451800_0954538_441_770 109
395 3300041460 Ga0451802_0270859 Ga0451802_0270859_827_1156 109
396 3300041486 Ga0451807_2369701 Ga0451807_2369701_106_435 109
397 3300041491 Ga0451833_1488514 Ga0451833_1488514_1033_1362 109
398 3300041496 Ga0451839_0757778 Ga0451839_0757778_192_521 109
399 3300041496 Ga0451839_0799513 Ga0451839_0799513_37_378 109
400 3300041501 Ga0451845_0029820 Ga0451845_0029820_315_644 109
401 3300041501 Ga0451845_0773355 Ga0451845_0773355_129_458 109
402 3300041503 Ga0451847_0214195 Ga0451847_0214195_645_974 109
403 3300041505 Ga0451849_0122095 Ga0451849_0122095_3199_3528 109
404 3300041505 Ga0451849_0831447 Ga0451849_0831447_228_557 109
405 3300041505 Ga0451849_1567097 Ga0451849_1567097_598_927 109
406 3300041511 Ga0451855_2043013 Ga0451855_2043013_181_510 109
407 3300041512 Ga0451853_1004850 Ga0451853_1004850_66_395 109
408 3300042004 Ga0439445_0067643 Ga0439445_0067643_146_475 109
409 3300042007 Ga0439449_0111301 Ga0439449_0111301_620_949 109
410 3300042010 Ga0439452_056552 Ga0439452_056552_544_873 109
411 3300042156 Ga0439446_0002554 Ga0439446_0002554_1727_2056 109
412 3300044765 Ga0466970_0426283 Ga0466970_0426283_100_429 109
413 3300046453 Ga0495627_000407 Ga0495627_000407_23506_23835 109
414 3300046459 Ga0495629_0009289 Ga0495629_0009289_2592_2921 109
415 3300046460 Ga0495638_0001482 Ga0495638_0001482_15714_16043 109
416 3300046460 Ga0495638_0003450 Ga0495638_0003450_2704_3033 109
417 3300046460 Ga0495638_0453387 Ga0495638_0453387_38_367 109
418 3300046471 Ga0495650_0000027 Ga0495650_0000027_193139_193480 109
419 3300046471 Ga0495650_0000068 Ga0495650_0000068_235596_235925 109
420 3300046474 Ga0495605_0053760 Ga0495605_0053760_977_1306 109
421 3300046474 Ga0495605_0093565 Ga0495605_0093565_480_809 109
422 3300046491 Ga0495584_0014383 Ga0495584_0014383_609_938 109
423 3300046491 Ga0495584_0706464 Ga0495584_0706464_49_378 109
424 3300046492 Ga0495585_0029125 Ga0495585_0029125_2791_3120 109
425 3300046492 Ga0495585_0387033 Ga0495585_0387033_301_630 109
426 3300046500 Ga0495596_0002870 Ga0495596_0002870_1217_1546 109
427 3300046500 Ga0495596_0088067 Ga0495596_0088067_562_891 109
428 3300046501 Ga0495607_0058618 Ga0495607_0058618_31_360 109
429 3300046507 Ga0495606_0005676 Ga0495606_0005676_3081_3410 109
430 3300046507 Ga0495606_0088338 Ga0495606_0088338_229_558 109
431 3300046507 Ga0495606_0273977 Ga0495606_0273977_291_620 109
432 3300046512 Ga0495610_0000111 Ga0495610_0000111_24266_24595 109
433 3300046512 Ga0495610_0105993 Ga0495610_0105993_238_567 109
434 3300046512 Ga0495610_0108702 Ga0495610_0108702_95_424 109
435 3300046513 Ga0495616_0277065 Ga0495616_0277065_41_370 109
436 3300046515 Ga0495620_0027728 Ga0495620_0027728_2226_2555 109
437 3300046515 Ga0495620_0029571 Ga0495620_0029571_874_1203 109
438 3300046515 Ga0495620_0204601 Ga0495620_0204601_34_363 109
439 3300046515 Ga0495620_0246868 Ga0495620_0246868_51_380 109
440 3300046515 Ga0495620_0356979 Ga0495620_0356979_180_509 109
441 3300046518 Ga0495631_0025231 Ga0495631_0025231_1094_1423 109
442 3300046518 Ga0495631_0094180 Ga0495631_0094180_278_607 109
443 3300046518 Ga0495631_0261887 Ga0495631_0261887_332_661 109
444 3300046518 Ga0495631_0408511 Ga0495631_0408511_47_376 109
445 3300046519 Ga0495632_0075564 Ga0495632_0075564_1138_1467 109
446 3300046520 Ga0495637_0039480 Ga0495637_0039480_318_650 109
447 3300046522 Ga0495643_0021433 Ga0495643_0021433_878_1207 109
448 3300046522 Ga0495643_0023670 Ga0495643_0023670_2119_2448 109
449 3300046522 Ga0495643_0086517 Ga0495643_0086517_35_364 109
450 3300046522 Ga0495643_0104390 Ga0495643_0104390_613_942 109
451 3300046522 Ga0495643_0176128 Ga0495643_0176128_404_733 109
452 3300046522 Ga0495643_0294009 Ga0495643_0294009_262_597 109
453 3300046522 Ga0495643_0522782 Ga0495643_0522782_79_408 109
454 3300046523 Ga0495644_0030514 Ga0495644_0030514_234_563 109
455 3300046524 Ga0495648_0331386 Ga0495648_0331386_134_463 109
456 3300046525 Ga0495663_0065808 Ga0495663_0065808_56_385 109
457 3300046528 Ga0495642_0244600 Ga0495642_0244600_330_659 109
458 3300046529 Ga0495652_0983122 Ga0495652_0983122_55_384 109
459 3300046530 Ga0495654_0000051 Ga0495654_0000051_114822_115151 109
460 3300046530 Ga0495654_0220588 Ga0495654_0220588_190_519 109
461 3300046538 Ga0495609_0002341 Ga0495609_0002341_2808_3137 109
462 3300046539 Ga0495621_0227270 Ga0495621_0227270_355_684 109
463 3300046542 Ga0495597_0172065 Ga0495597_0172065_30_359 109
464 3300046557 Ga0495622_0037936 Ga0495622_0037936_459_788 109
465 3300046557 Ga0495622_0145140 Ga0495622_0145140_542_871 109
466 3300046558 Ga0495633_0053268 Ga0495633_0053268_362_691 109
467 3300046558 Ga0495633_0059309 Ga0495633_0059309_214_543 109
468 3300046615 Ga0495656_0011297 Ga0495656_0011297_321_650 109
469 3300046616 Ga0495668_0264943 Ga0495668_0264943_158_487 109
470 3300046616 Ga0495668_0661646 Ga0495668_0661646_186_515 109
471 3300046648 Ga0495611_0013215 Ga0495611_0013215_1496_1825 109
472 3300046660 Ga0495625_0014131 Ga0495625_0014131_5966_6295 109
473 3300046660 Ga0495625_0078069 Ga0495625_0078069_332_661 109
474 3300046660 Ga0495625_0080911 Ga0495625_0080911_293_622 109
475 3300046660 Ga0495625_0099729 Ga0495625_0099729_392_721 109
476 3300046660 Ga0495625_0222795 Ga0495625_0222795_656_985 109
477 3300046660 Ga0495625_0483051 Ga0495625_0483051_276_605 109
478 3300046663 Ga0495635_0633388 Ga0495635_0633388_51_380 109
479 3300046664 Ga0495659_0083916 Ga0495659_0083916_393_722 109
480 3300046664 Ga0495659_0421969 Ga0495659_0421969_48_377 109
481 3300046665 Ga0495661_0095093 Ga0495661_0095093_309_638 109
482 3300046665 Ga0495661_0125187 Ga0495661_0125187_787_1116 109
483 3300046674 Ga0495588_0024755 Ga0495588_0024755_327_656 109
484 3300046690 Ga0495624_0194317 Ga0495624_0194317_515_844 109
485 3300046691 Ga0495670_0077140 Ga0495670_0077140_429_758 109
486 3300046691 Ga0495670_0378776 Ga0495670_0378776_32_361 109
487 3300046692 Ga0495671_0230892 Ga0495671_0230892_207_536 109
488 3300046692 Ga0495671_0590848 Ga0495671_0590848_166_495 109
489 3300046694 Ga0495649_0319192 Ga0495649_0319192_19_348 109
490 3300046694 Ga0495649_0375567 Ga0495649_0375567_26_355 109
491 3300046794 Ga0495589_0013549 Ga0495589_0013549_2741_3070 109
492 3300046794 Ga0495589_0020332 Ga0495589_0020332_1286_1615 109
493 3300046794 Ga0495589_0058705 Ga0495589_0058705_864_1193 109
494 3300046794 Ga0495589_0563997 Ga0495589_0563997_22_351 109
495 3300046809 Ga0495600_0045733 Ga0495600_0045733_926_1255 109
496 3300046810 Ga0495660_0258695 Ga0495660_0258695_306_635 109
497 3300047318 Ga0495636_0049141 Ga0495636_0049141_799_1128 109
498 3300047320 Ga0495672_0010003 Ga0495672_0010003_4153_4482 109
499 3300047320 Ga0495672_0042238 Ga0495672_0042238_1686_2021 109
500 3300047320 Ga0495672_0056243 Ga0495672_0056243_1255_1584 109
501 3300047320 Ga0495672_0226920 Ga0495672_0226920_549_878 109
502 3300047443 Ga0495687_157183 Ga0495687_157183_40_369 109
503 3300047445 Ga0495677_0016610 Ga0495677_0016610_1108_1437 109
504 3300047469 Ga0495673_0000091 Ga0495673_0000091_158374_158703 109
505 3300047469 Ga0495673_0008898 Ga0495673_0008898_3901_4230 109
506 3300047470 Ga0495681_0092893 Ga0495681_0092893_838_1167 109
507 3300047470 Ga0495681_0277828 Ga0495681_0277828_106_435 109
508 3300047472 Ga0495686_0023057 Ga0495686_0023057_2362_2694 109
509 3300047472 Ga0495686_0175496 Ga0495686_0175496_580_909 109
510 3300047472 Ga0495686_0180678 Ga0495686_0180678_353_682 109
511 3300047472 Ga0495686_0363682 Ga0495686_0363682_202_531 109
512 3300048091 Ga0495626_0007371 Ga0495626_0007371_4899_5228 109
513 3300048091 Ga0495626_0049928 Ga0495626_0049928_1171_1500 109
514 3300048905 Ga0496102_0629566 Ga0496102_0629566_56_385 109
515 3300048917 Ga0496114_1155747 Ga0496114_1155747_93_422 109
516 3300048918 Ga0496115_0017368 Ga0496115_0017368_4758_5087 109
517 3300048918 Ga0496115_0037006 Ga0496115_0037006_1296_1625 109
518 3300048923 Ga0496120_0126705 Ga0496120_0126705_433_762 109
519 3300048924 Ga0496121_0111863 Ga0496121_0111863_1018_1347 109
520 3300048928 Ga0496125_0052011 Ga0496125_0052011_43_372 109
521 3300048929 Ga0496126_0222599 Ga0496126_0222599_312_641 109
522 3300049571 Ga0501034_1262481 Ga0501034_1262481_203_547 109
523 3300049573 Ga0501037_0586263 Ga0501037_0586263_337_681 109
524 3300049581 Ga0501047_0014401 Ga0501047_0014401_1357_1701 109
525 3300049583 Ga0501067_0307052 Ga0501067_0307052_517_861 109
526 3300049585 Ga0501069_0246570 Ga0501069_0246570_499_843 109
527 3300049589 Ga0501073_0070304 Ga0501073_0070304_1022_1366 109
528 3300049703 Ga0501219_008463 Ga0501219_008463_273_602 109
529 3300049705 Ga0501225_0099242 Ga0501225_0099242_492_821 109
530 3300049742 Ga0501080_0043020 Ga0501080_0043020_1480_1824 109
531 3300049744 Ga0501083_0029947 Ga0501083_0029947_2045_2389 109
532 3300049823 Ga0501044_0279489 Ga0501044_0279489_61_405 109
533 3300050489 nmdc:mga03683_178746_c1 nmdc:mga03683_178746_c1_420_749 109
534 3300050489 nmdc:mga03683_249769_c1 nmdc:mga03683_249769_c1_349_678 109
535 3300050489 nmdc:mga03683_354154_c1 nmdc:mga03683_354154_c1_351_680 109
536 3300050490 nmdc:mga03n38_243577_c1 nmdc:mga03n38_243577_c1_44_373 109
537 3300050491 nmdc:mga00v17_686255_c1 nmdc:mga00v17_686255_c1_300_629 109
538 3300050492 nmdc:mga0yw44_179788_c1 nmdc:mga0yw44_179788_c1_606_935 109
539 3300050492 nmdc:mga0yw44_273792_c1 nmdc:mga0yw44_273792_c1_745_1083 109
540 3300050492 nmdc:mga0yw44_98505_c1 nmdc:mga0yw44_98505_c1_605_934 109
541 3300050493 nmdc:mga0k408_160611_c1 nmdc:mga0k408_160611_c1_136_465 109
542 3300050493 nmdc:mga0k408_272633_c1 nmdc:mga0k408_272633_c1_445_774 109
543 3300050493 nmdc:mga0k408_276849_c1 nmdc:mga0k408_276849_c1_337_666 109
544 3300050493 nmdc:mga0k408_67114_c1 nmdc:mga0k408_67114_c1_1564_1893 109
545 3300050493 nmdc:mga0k408_91122_c1 nmdc:mga0k408_91122_c1_394_723 109
546 3300050494 nmdc:mga06z11_568770_c1 nmdc:mga06z11_568770_c1_238_567 109
547 3300050496 nmdc:mga07m45_301529_c1 nmdc:mga07m45_301529_c1_299_628 109
548 3300050496 nmdc:mga07m45_359509_c1 nmdc:mga07m45_359509_c1_484_813 109
549 3300050496 nmdc:mga07m45_45342_c1 nmdc:mga07m45_45342_c1_1504_1833 109
550 3300050496 nmdc:mga07m45_612147_c1 nmdc:mga07m45_612147_c1_167_496 109
551 3300050507 nmdc:mga05p37_1796307_c1 nmdc:mga05p37_1796307_c1_49_378 109
552 3300050509 nmdc:mga0qj67_622586_c1 nmdc:mga0qj67_622586_c1_481_810 109
553 3300050510 nmdc:mga06r32_588782_c1 nmdc:mga06r32_588782_c1_708_1037 109
554 3300050511 nmdc:mga08y16_62_c1 nmdc:mga08y16_62_c1_32840_33169 109
555 3300050511 nmdc:mga08y16_656325_c1 nmdc:mga08y16_656325_c1_232_561 109
556 3300050511 nmdc:mga08y16_922451_c1 nmdc:mga08y16_922451_c1_460_789 109
557 3300050515 nmdc:mga0a205_1187039_c1 nmdc:mga0a205_1187039_c1_160_489 109
558 3300050516 nmdc:mga0sz30_198887_c1 nmdc:mga0sz30_198887_c1_122_451 109
559 3300053079 Ga0500610_0002738 Ga0500610_0002738_3453_3785 109
560 3300053083 Ga0495655_0275306 Ga0495655_0275306_175_504 109
561 3300053086 Ga0500578_0771256 Ga0500578_0771256_130_459 109
562 3300053087 Ga0500643_019214 Ga0500643_019214_264_593 109
563 3300053088 Ga0500644_0282582 Ga0500644_0282582_246_575 109
564 3300053090 Ga0500646_0023676 Ga0500646_0023676_944_1273 109
565 3300053090 Ga0500646_0069364 Ga0500646_0069364_315_644 109
566 3300053090 Ga0500646_0161947 Ga0500646_0161947_319_648 109
567 3300053094 Ga0500566_0005190 Ga0500566_0005190_321_650 109
568 3300053098 Ga0500650_0192214 Ga0500650_0192214_443_772 109
569 3300053098 Ga0500650_0305895 Ga0500650_0305895_46_375 109
570 3300053103 Ga0500555_174956 Ga0500555_174956_111_440 109
571 3300053104 Ga0500556_0001096 Ga0500556_0001096_4270_4602 109
572 3300053108 Ga0500562_016324 Ga0500562_016324_657_986 109
573 3300053108 Ga0500562_034602 Ga0500562_034602_51_380 109
574 3300053109 Ga0500569_090839 Ga0500569_090839_459_788 109
575 3300053118 Ga0500594_0065146 Ga0500594_0065146_670_999 109
576 3300053119 Ga0500595_004320 Ga0500595_004320_155_484 109
577 3300053123 Ga0500614_095057 Ga0500614_095057_192_521 109
578 3300053130 Ga0500642_0030447 Ga0500642_0030447_261_590 109
579 3300053133 Ga0500655_121993 Ga0500655_121993_190_519 109
580 3300053134 Ga0500658_0000367 Ga0500658_0000367_10701_11030 109
581 3300053134 Ga0500658_0001583 Ga0500658_0001583_7797_8126 109
582 3300053134 Ga0500658_0035889 Ga0500658_0035889_1583_1912 109
583 3300053134 Ga0500658_0048739 Ga0500658_0048739_1242_1571 109
584 3300053134 Ga0500658_0053565 Ga0500658_0053565_361_690 109
585 3300053139 Ga0500568_0005567 Ga0500568_0005567_2414_2743 109
586 3300053142 Ga0500577_0013986 Ga0500577_0013986_1648_1977 109
587 3300053142 Ga0500577_0053937 Ga0500577_0053937_701_1030 109
588 3300053146 Ga0500588_0036503 Ga0500588_0036503_970_1302 109
589 3300053148 Ga0500590_000501 Ga0500590_000501_7323_7652 109
590 3300053151 Ga0500604_0003450 Ga0500604_0003450_1451_1780 109
591 3300053151 Ga0500604_0076081 Ga0500604_0076081_726_1055 109
592 3300053151 Ga0500604_0228427 Ga0500604_0228427_233_562 109
593 3300053153 Ga0500616_0008119 Ga0500616_0008119_3683_4015 109
594 3300053153 Ga0500616_0043193 Ga0500616_0043193_328_657 109
595 3300053153 Ga0500616_0055491 Ga0500616_0055491_1306_1635 109
596 3300053153 Ga0500616_0085793 Ga0500616_0085793_940_1269 109
597 3300053156 Ga0500622_0436837 Ga0500622_0436837_71_400 109
598 3300053158 Ga0500627_0014585 Ga0500627_0014585_1720_2049 109
599 3300053158 Ga0500627_0092263 Ga0500627_0092263_873_1202 109
600 3300053161 Ga0500634_0299346 Ga0500634_0299346_155_484 109
601 3300053163 Ga0500639_013853 Ga0500639_013853_3397_3726 109
602 3300053727 Ga0500611_006365 Ga0500611_006365_346_675 109
603 3300053730 Ga0500645_001569 Ga0500645_001569_1714_2043 109
604 3300053730 Ga0500645_038697 Ga0500645_038697_735_1064 109
605 3300053730 Ga0500645_103035 Ga0500645_103035_229_558 109
606 3300053731 Ga0500609_000896 Ga0500609_000896_1692_2021 109
607 3300053739 Ga0500587_000134 Ga0500587_000134_5207_5536 109
608 3300059423 Ga0590074_060023 Ga0590074_060023_34_363 109
609 3300059424 Ga0590075_034695 Ga0590075_034695_511_840 109
610 3300059426 Ga0590077_042502 Ga0590077_042502_537_866 109
611 3300060353 Ga0501082_0010091 Ga0501082_0010091_7208_7552 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

10

60

0.97

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

12

58

0.97

PF01978

TrmB

Sugar-specific transcriptional regulator TrmB

16

73

0.95

PF12802

MarR_2

MarR family

20

65

0.86

PF01022

HTH_5

Bacterial regulatory protein, arsR family

12

59

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9312 3 87
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9239 6 94
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9196 4 91
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9178 19 75
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9064 1 94
ID Description Score Start End Superfamily
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9343 12 74 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9285 4 86 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9239 6 94 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9179 16 73 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9178 19 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G2IVA2-F1-model_v4 HTH arsR-type domain-containing protein 0.9654 3 78 GO:0003700
AF-A0A1B1NDG5-F1-model_v4 Transcriptional regulator, ArsR family 0.9629 10 89 GO:0003700
AF-C1B651-F1-model_v4 Putative ArsR family transcriptional regulator 0.9623 3 89 GO:0003700
AF-A0A3M1EE61-F1-model_v4 Transcriptional regulator 0.9619 4 79 GO:0003700
AF-A0A1G2IGX9-F1-model_v4 HTH arsR-type domain-containing protein 0.9618 3 76 GO:0003700

Feature Viewer

pLDDT pTM Quality
90.46 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map