F469110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 611 | 422 | 522 | 108 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2928531327|2928533232 |
| Length | 120 |
| Sequence | IPIDTVMRALADPTRRAVYERIVRAEEITVADLTRHSGVSQGAVSQHLKALKTAGLVAERPEGRRVYYRVQPQGLAPLVDWMSHYGVFWRDRFDDLRALLKDIDPPEFAPKDTDRKDTAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 3 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 4 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 5 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 6 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 7 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 8 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 9 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 10 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 11 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 12 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 13 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 14 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 15 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 16 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 17 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 18 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 19 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 20 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 21 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 22 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 23 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 24 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 25 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 26 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 27 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 28 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 29 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 30 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 31 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 32 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 33 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 34 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 35 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 36 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 37 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 38 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 39 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 40 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 41 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 42 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 43 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 44 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 45 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 46 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 47 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 48 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 49 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 50 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 51 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 52 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 53 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 54 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 55 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 56 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 57 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 58 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 59 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 60 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 61 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 62 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 63 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 64 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 65 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 66 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 67 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 68 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 69 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 70 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 71 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 72 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 73 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 74 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 75 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 76 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 77 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 78 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 79 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 80 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 81 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 82 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 83 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 84 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 85 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 86 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 87 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 88 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 89 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 90 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 91 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 92 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 93 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 95 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 96 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 97 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 98 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 99 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 100 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 101 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 102 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 103 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 104 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 105 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 106 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 107 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 110 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 120 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 122 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 124 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 127 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 128 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 129 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 131 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 132 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 133 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 134 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 135 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 136 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 137 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 138 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 139 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 140 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 141 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 143 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 144 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 145 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 146 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 149 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 150 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 151 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 152 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 154 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 155 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 156 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 157 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 158 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 160 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 161 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 162 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 172 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 173 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 174 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 175 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 181 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 189 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 191 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 192 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 193 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 194 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 248 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 253 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 254 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 255 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 256 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 257 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 263 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 264 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 265 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 270 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 271 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 280 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 281 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 282 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 283 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 284 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 287 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 288 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 289 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 290 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 291 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 292 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 351 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 352 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 353 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 354 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 362 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 383 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 384 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 386 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 388 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 389 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 390 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 392 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 393 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 395 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 396 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 397 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 402 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 404 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 406 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 409 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 410 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 411 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 412 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 415 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 416 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 417 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 420 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 421 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 422 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.43 |
| Metatranscriptomes | 0 |
| Isolates | 14.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.24 |
| Nodule | 12.93 |
| Rhizoplane | 2.78 |
| Rhizosphere | 52.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10084512 | 3300001979 | Bacteria | 826 |
| 2 | JGI24739J22299_10008629 | 3300001989 | Bacteria | 3803 |
| 3 | JGI24737J22298_10017277 | 3300001990 | Bacteria | 2326 |
| 4 | JGI24735J21928_10046128 | 3300002067 | Bacteria | 1264 |
| 5 | JGI25158J39367_1012298 | 3300002739 | Bacteria | 1129 |
| 6 | JGI25159J45721_1000015 | 3300002987 | Bacteria | 142431 |
| 7 | JGI25151J46595_10011614 | 3300003187 | Bacteria | 4042 |
| 8 | JGI25406J46586_10000047 | 3300003203 | Bacteria | 54770 |
| 9 | JGI25406J46586_10162247 | 3300003203 | Bacteria | 652 |
| 10 | JGI25153J46596_10029812 | 3300003215 | Bacteria | 1866 |
| 11 | JGI25153J46596_10088291 | 3300003215 | Bacteria | 755 |
| 12 | rootL2_10150296 | 3300003322 | Bacteria | 1965 |
| 13 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 14 | JGI25161J50226_1000741 | 3300003374 | Bacteria | 12537 |
| 15 | Ga0055526_1004390 | 3300003771 | Bacteria | 8501 |
| 16 | Ga0055537_1001778 | 3300003773 | Bacteria | 7891 |
| 17 | Ga0055524_1016620 | 3300003775 | Bacteria | 2630 |
| 18 | Ga0055524_1032933 | 3300003775 | Bacteria | 1459 |
| 19 | Ga0055524_1053979 | 3300003775 | Bacteria | 884 |
| 20 | Ga0055536_1001123 | 3300003781 | Bacteria | 16800 |
| 21 | Ga0055528_1005639 | 3300003790 | Bacteria | 5784 |
| 22 | Ga0055528_1005709 | 3300003790 | Bacteria | 5740 |
| 23 | Ga0055530_10004321 | 3300003791 | Bacteria | 7390 |
| 24 | Ga0055540_1014995 | 3300003792 | Bacteria | 2280 |
| 25 | Ga0055543_1000034 | 3300004625 | Bacteria | 128668 |
| 26 | Ga0065165_1000025 | 3300005262 | Bacteria | 246909 |
| 27 | Ga0070658_10005436 | 3300005327 | Bacteria | 10336 |
| 28 | Ga0070670_100000235 | 3300005331 | Bacteria | 50382 |
| 29 | Ga0068869_100134555 | 3300005334 | Bacteria | 1903 |
| 30 | Ga0070666_10000008 | 3300005335 | Bacteria | 293415 |
| 31 | Ga0070660_100918789 | 3300005339 | Bacteria | 738 |
| 32 | Ga0070661_100013390 | 3300005344 | Bacteria | 5757 |
| 33 | Ga0070668_100508162 | 3300005347 | Bacteria | 1044 |
| 34 | Ga0070668_101746660 | 3300005347 | Bacteria | 572 |
| 35 | Ga0070669_100025480 | 3300005353 | Bacteria | 4248 |
| 36 | Ga0070659_100029353 | 3300005366 | Bacteria | 4250 |
| 37 | Ga0070659_100092438 | 3300005366 | Bacteria | 2426 |
| 38 | Ga0070713_100866624 | 3300005436 | Bacteria | 868 |
| 39 | Ga0070713_100964051 | 3300005436 | Bacteria | 822 |
| 40 | Ga0070694_100746068 | 3300005444 | Bacteria | 799 |
| 41 | Ga0070708_100162634 | 3300005445 | Bacteria | 2081 |
| 42 | Ga0070708_100455554 | 3300005445 | Bacteria | 1207 |
| 43 | Ga0070708_100668742 | 3300005445 | Bacteria | 978 |
| 44 | Ga0070681_10811087 | 3300005458 | Bacteria | 853 |
| 45 | Ga0070681_11493962 | 3300005458 | Bacteria | 600 |
| 46 | Ga0070707_100312332 | 3300005468 | Bacteria | 1528 |
| 47 | Ga0070707_100314217 | 3300005468 | Bacteria | 1523 |
| 48 | Ga0070698_100084065 | 3300005471 | Bacteria | 3172 |
| 49 | Ga0070698_100672616 | 3300005471 | Bacteria | 977 |
| 50 | Ga0070698_100850709 | 3300005471 | Bacteria | 857 |
| 51 | Ga0070699_100446269 | 3300005518 | Bacteria | 1173 |
| 52 | Ga0070679_100195102 | 3300005530 | Bacteria | 1992 |
| 53 | Ga0070697_100232175 | 3300005536 | Bacteria | 1574 |
| 54 | Ga0070665_100236483 | 3300005548 | Bacteria | 1827 |
| 55 | Ga0070665_101227012 | 3300005548 | Bacteria | 760 |
| 56 | Ga0070665_101401654 | 3300005548 | Bacteria | 708 |
| 57 | Ga0068857_100489906 | 3300005577 | Bacteria | 1153 |
| 58 | Ga0068857_100846873 | 3300005577 | Bacteria | 875 |
| 59 | Ga0068857_101376929 | 3300005577 | Bacteria | 686 |
| 60 | Ga0068854_101241198 | 3300005578 | Bacteria | 669 |
| 61 | Ga0068856_100507351 | 3300005614 | Bacteria | 1227 |
| 62 | Ga0070702_100163688 | 3300005615 | Bacteria | 1440 |
| 63 | Ga0068859_100552461 | 3300005617 | Bacteria | 1246 |
| 64 | Ga0068864_102046421 | 3300005618 | Bacteria | 579 |
| 65 | Ga0068866_10157037 | 3300005718 | Bacteria | 1323 |
| 66 | Ga0068861_100009698 | 3300005719 | Bacteria | 6657 |
| 67 | Ga0068870_10133752 | 3300005840 | Bacteria | 1443 |
| 68 | Ga0068858_101382844 | 3300005842 | Bacteria | 693 |
| 69 | Ga0068860_100575520 | 3300005843 | Bacteria | 1130 |
| 70 | Ga0068862_100376168 | 3300005844 | Bacteria | 1324 |
| 71 | Ga0068862_101190291 | 3300005844 | Bacteria | 760 |
| 72 | Ga0081455_10158241 | 3300005937 | Bacteria | 1739 |
| 73 | Ga0081538_10010032 | 3300005981 | Bacteria | 7811 |
| 74 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 75 | Ga0081539_10094066 | 3300005985 | Bacteria | 1543 |
| 76 | Ga0070717_11139108 | 3300006028 | Bacteria | 710 |
| 77 | Ga0075365_10028635 | 3300006038 | Bacteria | 3554 |
| 78 | Ga0075365_10689049 | 3300006038 | Bacteria | 722 |
| 79 | Ga0075368_10169854 | 3300006042 | Bacteria | 916 |
| 80 | Ga0075368_10421137 | 3300006042 | Bacteria | 588 |
| 81 | Ga0075363_100577628 | 3300006048 | Bacteria | 672 |
| 82 | Ga0075364_10164049 | 3300006051 | Bacteria | 1501 |
| 83 | Ga0070716_100391439 | 3300006173 | Bacteria | 997 |
| 84 | Ga0070712_100678991 | 3300006175 | Bacteria | 877 |
| 85 | Ga0075362_10086380 | 3300006177 | Bacteria | 1452 |
| 86 | Ga0075362_10115528 | 3300006177 | Bacteria | 1267 |
| 87 | Ga0075362_10357615 | 3300006177 | Bacteria | 732 |
| 88 | Ga0075362_10401752 | 3300006177 | Bacteria | 691 |
| 89 | Ga0075367_10157244 | 3300006178 | Bacteria | 1413 |
| 90 | Ga0075369_10196386 | 3300006186 | Bacteria | 931 |
| 91 | Ga0075369_10228758 | 3300006186 | Bacteria | 861 |
| 92 | Ga0075366_10037335 | 3300006195 | Bacteria | 2868 |
| 93 | Ga0075366_10101137 | 3300006195 | Bacteria | 1730 |
| 94 | Ga0075366_10186459 | 3300006195 | Bacteria | 1260 |
| 95 | Ga0075366_10203828 | 3300006195 | Bacteria | 1203 |
| 96 | Ga0075366_10354921 | 3300006195 | Bacteria | 900 |
| 97 | Ga0075366_10528986 | 3300006195 | Bacteria | 729 |
| 98 | Ga0075366_10686968 | 3300006195 | Bacteria | 635 |
| 99 | Ga0097621_100119917 | 3300006237 | Bacteria | 2230 |
| 100 | Ga0075370_10247149 | 3300006353 | Bacteria | 1057 |
| 101 | Ga0075370_10683893 | 3300006353 | Bacteria | 623 |
| 102 | Ga0075428_101211399 | 3300006844 | Bacteria | 796 |
| 103 | Ga0075430_100616516 | 3300006846 | Bacteria | 895 |
| 104 | Ga0075433_10392128 | 3300006852 | Bacteria | 1225 |
| 105 | Ga0068865_100597552 | 3300006881 | Bacteria | 932 |
| 106 | Ga0068865_101895344 | 3300006881 | Bacteria | 540 |
| 107 | Ga0097620_100552445 | 3300006931 | Bacteria | 1246 |
| 108 | Ga0079104_1002956 | 3300006946 | Bacteria | 8390 |
| 109 | Ga0099794_10070864 | 3300007265 | Bacteria | 1707 |
| 110 | Ga0099794_10425017 | 3300007265 | Bacteria | 695 |
| 111 | Ga0099795_10321646 | 3300007788 | Bacteria | 685 |
| 112 | Ga0105240_10482952 | 3300009093 | Bacteria | 1381 |
| 113 | Ga0111539_10000100 | 3300009094 | Bacteria | 91427 |
| 114 | Ga0111539_10474741 | 3300009094 | Bacteria | 1456 |
| 115 | Ga0111539_11169860 | 3300009094 | Bacteria | 894 |
| 116 | Ga0105247_11598278 | 3300009101 | Bacteria | 535 |
| 117 | Ga0114129_10036405 | 3300009147 | Bacteria | 6950 |
| 118 | Ga0114129_10244130 | 3300009147 | Bacteria | 2413 |
| 119 | Ga0114129_10764461 | 3300009147 | Bacteria | 1236 |
| 120 | Ga0114129_11428232 | 3300009147 | Bacteria | 853 |
| 121 | Ga0105243_10096309 | 3300009148 | Bacteria | 2448 |
| 122 | Ga0105243_11883532 | 3300009148 | Bacteria | 631 |
| 123 | Ga0105248_11243612 | 3300009177 | Bacteria | 842 |
| 124 | Ga0105237_10032217 | 3300009545 | Bacteria | 5308 |
| 125 | Ga0105237_10627370 | 3300009545 | Bacteria | 1082 |
| 126 | Ga0105238_10000178 | 3300009551 | Bacteria | 69458 |
| 127 | Ga0105249_10139742 | 3300009553 | Bacteria | 2321 |
| 128 | Ga0105249_11286628 | 3300009553 | Bacteria | 803 |
| 129 | Ga0123340_1065581 | 3300009763 | Bacteria | 951 |
| 130 | Ga0123341_1006881 | 3300009765 | Bacteria | 10327 |
| 131 | Ga0123342_1020394 | 3300009766 | Bacteria | 4851 |
| 132 | Ga0099796_10032210 | 3300010159 | Bacteria | 1716 |
| 133 | Ga0099796_10068079 | 3300010159 | Bacteria | 1279 |
| 134 | Ga0099796_10486174 | 3300010159 | Bacteria | 552 |
| 135 | Ga0105239_12875280 | 3300010375 | Bacteria | 562 |
| 136 | Ga0105246_10025133 | 3300011119 | Bacteria | 3881 |
| 137 | Ga0105246_10828819 | 3300011119 | Bacteria | 823 |
| 138 | Ga0157373_10500353 | 3300013100 | Bacteria | 878 |
| 139 | Ga0157373_10655404 | 3300013100 | Bacteria | 767 |
| 140 | Ga0157371_10289731 | 3300013102 | Bacteria | 1184 |
| 141 | Ga0157369_10045197 | 3300013105 | Bacteria | 4791 |
| 142 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 143 | Ga0163162_10000110 | 3300013306 | Bacteria | 73989 |
| 144 | Ga0163162_10125090 | 3300013306 | Bacteria | 2677 |
| 145 | Ga0163162_10573563 | 3300013306 | Bacteria | 1256 |
| 146 | Ga0163162_11029712 | 3300013306 | Bacteria | 931 |
| 147 | Ga0157372_10044853 | 3300013307 | Bacteria | 4901 |
| 148 | Ga0157375_12108384 | 3300013308 | Bacteria | 671 |
| 149 | Ga0157375_12802651 | 3300013308 | Bacteria | 583 |
| 150 | Ga0163163_12210725 | 3300014325 | Bacteria | 609 |
| 151 | Ga0163163_12679547 | 3300014325 | Bacteria | 556 |
| 152 | Ga0157380_10091712 | 3300014326 | Bacteria | 2509 |
| 153 | Ga0157380_10164708 | 3300014326 | Bacteria | 1931 |
| 154 | Ga0157376_11081489 | 3300014969 | Bacteria | 827 |
| 155 | Ga0182005_1054497 | 3300015265 | Bacteria | 1089 |
| 156 | Ga0183363_1038 | 3300015690 | Bacteria | 43720 |
| 157 | Ga0163161_10260187 | 3300017792 | Bacteria | 1355 |
| 158 | Ga0213871_10023477 | 3300021441 | Bacteria | 1553 |
| 159 | Ga0228711_1003229 | 3300022739 | Bacteria | 25290 |
| 160 | Ga0228710_1000004 | 3300022740 | Bacteria | 250560 |
| 161 | Ga0228598_1093986 | 3300024227 | Bacteria | 604 |
| 162 | Ga0209436_100130 | 3300025208 | Bacteria | 37375 |
| 163 | Ga0207425_1043790 | 3300025245 | Bacteria | 842 |
| 164 | Ga0209565_1001017 | 3300025263 | Bacteria | 14345 |
| 165 | Ga0209673_1000910 | 3300025273 | Bacteria | 37777 |
| 166 | Ga0209673_1001024 | 3300025273 | Bacteria | 33282 |
| 167 | Ga0209673_1002323 | 3300025273 | Bacteria | 13481 |
| 168 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 169 | Ga0209675_1057472 | 3300025291 | Bacteria | 779 |
| 170 | Ga0209676_1001927 | 3300025292 | Bacteria | 16772 |
| 171 | Ga0209025_1000105 | 3300025294 | Bacteria | 224157 |
| 172 | Ga0209564_1000113 | 3300025295 | Bacteria | 211564 |
| 173 | Ga0209564_1003780 | 3300025295 | Bacteria | 9853 |
| 174 | Ga0209564_1025276 | 3300025295 | Bacteria | 2003 |
| 175 | Ga0209564_1027096 | 3300025295 | Bacteria | 1871 |
| 176 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 177 | Ga0209758_1003851 | 3300025297 | Bacteria | 13164 |
| 178 | Ga0209758_1004830 | 3300025297 | Bacteria | 10876 |
| 179 | Ga0209758_1051278 | 3300025297 | Bacteria | 1438 |
| 180 | Ga0209050_1005247 | 3300025298 | Bacteria | 8259 |
| 181 | Ga0209256_1002310 | 3300025299 | Bacteria | 15981 |
| 182 | Ga0209256_1003107 | 3300025299 | Bacteria | 12151 |
| 183 | Ga0209256_1003175 | 3300025299 | Bacteria | 11916 |
| 184 | Ga0209256_1013685 | 3300025299 | Bacteria | 2992 |
| 185 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 186 | Ga0209051_1001056 | 3300025303 | Bacteria | 25758 |
| 187 | Ga0209051_1013650 | 3300025303 | Bacteria | 3849 |
| 188 | Ga0209257_1001948 | 3300025304 | Bacteria | 22281 |
| 189 | Ga0209257_1058438 | 3300025304 | Bacteria | 1056 |
| 190 | Ga0207688_10027060 | 3300025901 | Bacteria | 3155 |
| 191 | Ga0207680_10000005 | 3300025903 | Bacteria | 660983 |
| 192 | Ga0207647_10001693 | 3300025904 | Bacteria | 17005 |
| 193 | Ga0207705_10023654 | 3300025909 | Bacteria | 4383 |
| 194 | Ga0207695_10639275 | 3300025913 | Bacteria | 945 |
| 195 | Ga0207671_10039392 | 3300025914 | Bacteria | 3500 |
| 196 | Ga0207693_10211944 | 3300025915 | Bacteria | 1523 |
| 197 | Ga0207660_10908104 | 3300025917 | Bacteria | 719 |
| 198 | Ga0207657_11451853 | 3300025919 | Bacteria | 514 |
| 199 | Ga0207649_10016493 | 3300025920 | Bacteria | 4168 |
| 200 | Ga0207652_10205094 | 3300025921 | Bacteria | 1774 |
| 201 | Ga0207646_10307836 | 3300025922 | Bacteria | 1431 |
| 202 | Ga0207694_10000187 | 3300025924 | Bacteria | 62967 |
| 203 | Ga0207650_10000203 | 3300025925 | Bacteria | 68710 |
| 204 | Ga0207700_10749489 | 3300025928 | Bacteria | 873 |
| 205 | Ga0207690_10038025 | 3300025932 | Bacteria | 3129 |
| 206 | Ga0207690_10389008 | 3300025932 | Bacteria | 1110 |
| 207 | Ga0207706_10285910 | 3300025933 | Bacteria | 1438 |
| 208 | Ga0207689_10332131 | 3300025942 | Bacteria | 1262 |
| 209 | Ga0207712_10989079 | 3300025961 | Bacteria | 746 |
| 210 | Ga0207668_10079935 | 3300025972 | Bacteria | 2367 |
| 211 | Ga0207668_11636581 | 3300025972 | Bacteria | 581 |
| 212 | Ga0207703_11320044 | 3300026035 | Bacteria | 694 |
| 213 | Ga0207676_11128580 | 3300026095 | Bacteria | 776 |
| 214 | Ga0207674_10313265 | 3300026116 | Bacteria | 1518 |
| 215 | Ga0207674_10840815 | 3300026116 | Bacteria | 885 |
| 216 | Ga0207675_100014309 | 3300026118 | Bacteria | 7396 |
| 217 | Ga0207675_100717469 | 3300026118 | Bacteria | 1009 |
| 218 | Ga0207683_10088453 | 3300026121 | Bacteria | 2756 |
| 219 | Ga0209281_1000134 | 3300027111 | Bacteria | 185406 |
| 220 | Ga0209179_1004773 | 3300027512 | Bacteria | 2072 |
| 221 | Ga0209282_1000013 | 3300027666 | Bacteria | 215053 |
| 222 | Ga0209588_1064150 | 3300027671 | Bacteria | 1187 |
| 223 | Ga0209998_10059000 | 3300027717 | Bacteria | 901 |
| 224 | Ga0209974_10003650 | 3300027876 | Bacteria | 5526 |
| 225 | Ga0207428_10000096 | 3300027907 | Bacteria | 123081 |
| 226 | Ga0207428_10500653 | 3300027907 | Bacteria | 882 |
| 227 | Ga0268266_10000051 | 3300028379 | Bacteria | 296231 |
| 228 | Ga0268265_10172519 | 3300028380 | Bacteria | 1850 |
| 229 | Ga0268265_11122688 | 3300028380 | Bacteria | 781 |
| 230 | Ga0268264_10541884 | 3300028381 | Bacteria | 1140 |
| 231 | Ga0265334_10095297 | 3300028573 | Bacteria | 1082 |
| 232 | Ga0307517_10289394 | 3300028786 | Bacteria | 927 |
| 233 | Ga0307515_10005291 | 3300028794 | Bacteria | 26238 |
| 234 | Ga0307515_10048367 | 3300028794 | Bacteria | 6431 |
| 235 | Ga0307515_10097511 | 3300028794 | Bacteria | 3592 |
| 236 | Ga0307515_10256910 | 3300028794 | Bacteria | 1490 |
| 237 | Ga0307515_10371254 | 3300028794 | Bacteria | 1067 |
| 238 | Ga0307512_10449855 | 3300030522 | Bacteria | 520 |
| 239 | Ga0265340_10147136 | 3300031247 | Bacteria | 1075 |
| 240 | Ga0307513_10004959 | 3300031456 | Bacteria | 17650 |
| 241 | Ga0307513_10008740 | 3300031456 | Bacteria | 12903 |
| 242 | Ga0307513_10019885 | 3300031456 | Bacteria | 7978 |
| 243 | Ga0307513_10023597 | 3300031456 | Bacteria | 7183 |
| 244 | Ga0307513_10630643 | 3300031456 | Bacteria | 780 |
| 245 | Ga0307509_10000008 | 3300031507 | Bacteria | 354271 |
| 246 | Ga0307408_100502098 | 3300031548 | Bacteria | 1062 |
| 247 | Ga0307408_100636626 | 3300031548 | Bacteria | 952 |
| 248 | Ga0307508_10761986 | 3300031616 | Bacteria | 582 |
| 249 | Ga0307514_10493317 | 3300031649 | Bacteria | 585 |
| 250 | Ga0307516_10011416 | 3300031730 | Bacteria | 9650 |
| 251 | Ga0307516_10014057 | 3300031730 | Bacteria | 8487 |
| 252 | Ga0307516_10106482 | 3300031730 | Bacteria | 2614 |
| 253 | Ga0307516_10848554 | 3300031730 | Bacteria | 577 |
| 254 | Ga0307413_11584061 | 3300031824 | Bacteria | 581 |
| 255 | Ga0307410_11445997 | 3300031852 | Bacteria | 604 |
| 256 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 257 | Ga0307409_100207807 | 3300031995 | Bacteria | 1757 |
| 258 | Ga0307409_101503347 | 3300031995 | Bacteria | 701 |
| 259 | Ga0307416_101061083 | 3300032002 | Bacteria | 914 |
| 260 | Ga0307414_10533009 | 3300032004 | Bacteria | 1044 |
| 261 | Ga0307411_10066715 | 3300032005 | Bacteria | 2419 |
| 262 | Ga0307411_11256555 | 3300032005 | Bacteria | 673 |
| 263 | Ga0307510_10004361 | 3300033180 | Bacteria | 16655 |
| 264 | Ga0315913_1008800 | 3300033430 | Bacteria | 11917 |
| 265 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 266 | Ga0373936_0089938 | 3300035113 | Bacteria | 1286 |
| 267 | Ga0373955_0701424 | 3300035172 | Bacteria | 621 |
| 268 | Ga0373937_1841019 | 3300036401 | Bacteria | 552 |
| 269 | Ga0373925_0091442 | 3300037068 | Bacteria | 2327 |
| 270 | Ga0237816_05962 | 3300039145 | Bacteria | 805 |
| 271 | Ga0436360_1260730 | 3300039438 | Bacteria | 7257 |
| 272 | Ga0451787_206899 | 3300041441 | Bacteria | 789 |
| 273 | Ga0451789_1137576 | 3300041443 | Bacteria | 743 |
| 274 | Ga0451791_0250196 | 3300041451 | Bacteria | 557 |
| 275 | Ga0451791_0840209 | 3300041451 | Bacteria | 1585 |
| 276 | Ga0451791_1103342 | 3300041451 | Bacteria | 529 |
| 277 | Ga0451793_1673673 | 3300041452 | Bacteria | 839 |
| 278 | Ga0451798_0370119 | 3300041458 | Bacteria | 675 |
| 279 | Ga0451798_0831548 | 3300041458 | Bacteria | 532 |
| 280 | Ga0451800_0954538 | 3300041459 | Bacteria | 782 |
| 281 | Ga0451802_0270859 | 3300041460 | Bacteria | 1315 |
| 282 | Ga0451807_1014837 | 3300041486 | Bacteria | 821 |
| 283 | Ga0451807_2369701 | 3300041486 | Bacteria | 603 |
| 284 | Ga0451833_1488514 | 3300041491 | Bacteria | 2254 |
| 285 | Ga0451839_0757778 | 3300041496 | Bacteria | 1524 |
| 286 | Ga0451839_0799513 | 3300041496 | Bacteria | 599 |
| 287 | Ga0451845_0029820 | 3300041501 | Bacteria | 699 |
| 288 | Ga0451845_0773355 | 3300041501 | Bacteria | 1123 |
| 289 | Ga0451847_0214195 | 3300041503 | Bacteria | 1509 |
| 290 | Ga0451849_0122095 | 3300041505 | Bacteria | 3585 |
| 291 | Ga0451849_0216237 | 3300041505 | Bacteria | 527 |
| 292 | Ga0451849_0831447 | 3300041505 | Bacteria | 1198 |
| 293 | Ga0451849_1567097 | 3300041505 | Bacteria | 1403 |
| 294 | Ga0451855_2043013 | 3300041511 | Bacteria | 979 |
| 295 | Ga0451853_1004850 | 3300041512 | Bacteria | 1124 |
| 296 | Ga0439445_0067643 | 3300042004 | Bacteria | 985 |
| 297 | Ga0439449_0111301 | 3300042007 | Bacteria | 1014 |
| 298 | Ga0439452_056552 | 3300042010 | Bacteria | 887 |
| 299 | Ga0439455_0211271 | 3300042012 | Bacteria | 563 |
| 300 | Ga0450898_045138 | 3300042134 | Bacteria | 841 |
| 301 | Ga0439446_0002554 | 3300042156 | Bacteria | 4383 |
| 302 | Ga0466970_0426283 | 3300044765 | Bacteria | 759 |
| 303 | Ga0495627_000407 | 3300046453 | Bacteria | 38017 |
| 304 | Ga0495603_0127020 | 3300046455 | Bacteria | 1486 |
| 305 | Ga0495629_0009289 | 3300046459 | Bacteria | 7194 |
| 306 | Ga0495638_0001482 | 3300046460 | Bacteria | 21206 |
| 307 | Ga0495638_0003450 | 3300046460 | Bacteria | 12448 |
| 308 | Ga0495638_0453387 | 3300046460 | Bacteria | 654 |
| 309 | Ga0495650_0000027 | 3300046471 | Bacteria | 475071 |
| 310 | Ga0495650_0000068 | 3300046471 | Bacteria | 266671 |
| 311 | Ga0495650_0005807 | 3300046471 | Bacteria | 7871 |
| 312 | Ga0495650_0331498 | 3300046471 | Bacteria | 505 |
| 313 | Ga0495605_0053760 | 3300046474 | Bacteria | 1952 |
| 314 | Ga0495605_0093565 | 3300046474 | Bacteria | 1390 |
| 315 | Ga0495584_0014383 | 3300046491 | Bacteria | 4030 |
| 316 | Ga0495584_0706464 | 3300046491 | Bacteria | 514 |
| 317 | Ga0495585_0029125 | 3300046492 | Bacteria | 3145 |
| 318 | Ga0495585_0387033 | 3300046492 | Bacteria | 675 |
| 319 | Ga0495596_0002870 | 3300046500 | Bacteria | 8974 |
| 320 | Ga0495596_0088067 | 3300046500 | Bacteria | 1205 |
| 321 | Ga0495607_0058618 | 3300046501 | Bacteria | 2200 |
| 322 | Ga0495606_0005676 | 3300046507 | Bacteria | 11812 |
| 323 | Ga0495606_0088338 | 3300046507 | Bacteria | 1911 |
| 324 | Ga0495606_0273977 | 3300046507 | Bacteria | 926 |
| 325 | Ga0495606_0597953 | 3300046507 | Bacteria | 542 |
| 326 | Ga0495610_0000111 | 3300046512 | Bacteria | 95122 |
| 327 | Ga0495610_0105993 | 3300046512 | Bacteria | 1252 |
| 328 | Ga0495610_0108702 | 3300046512 | Bacteria | 1231 |
| 329 | Ga0495616_0277065 | 3300046513 | Bacteria | 714 |
| 330 | Ga0495620_0027728 | 3300046515 | Bacteria | 2646 |
| 331 | Ga0495620_0029571 | 3300046515 | Bacteria | 2533 |
| 332 | Ga0495620_0204601 | 3300046515 | Bacteria | 759 |
| 333 | Ga0495620_0246868 | 3300046515 | Bacteria | 681 |
| 334 | Ga0495620_0356979 | 3300046515 | Bacteria | 554 |
| 335 | Ga0495631_0025231 | 3300046518 | Bacteria | 2739 |
| 336 | Ga0495631_0094180 | 3300046518 | Bacteria | 1289 |
| 337 | Ga0495631_0261887 | 3300046518 | Bacteria | 737 |
| 338 | Ga0495631_0408511 | 3300046518 | Bacteria | 578 |
| 339 | Ga0495632_0075564 | 3300046519 | Bacteria | 1612 |
| 340 | Ga0495632_0340546 | 3300046519 | Bacteria | 660 |
| 341 | Ga0495637_0039480 | 3300046520 | Bacteria | 2037 |
| 342 | Ga0495643_0021433 | 3300046522 | Bacteria | 3707 |
| 343 | Ga0495643_0023670 | 3300046522 | Bacteria | 3489 |
| 344 | Ga0495643_0086517 | 3300046522 | Bacteria | 1623 |
| 345 | Ga0495643_0104390 | 3300046522 | Bacteria | 1448 |
| 346 | Ga0495643_0176128 | 3300046522 | Bacteria | 1042 |
| 347 | Ga0495643_0294009 | 3300046522 | Bacteria | 743 |
| 348 | Ga0495643_0522782 | 3300046522 | Bacteria | 508 |
| 349 | Ga0495644_0030514 | 3300046523 | Bacteria | 2035 |
| 350 | Ga0495648_0027461 | 3300046524 | Bacteria | 3808 |
| 351 | Ga0495648_0331386 | 3300046524 | Bacteria | 702 |
| 352 | Ga0495663_0065808 | 3300046525 | Bacteria | 1146 |
| 353 | Ga0495642_0244600 | 3300046528 | Bacteria | 784 |
| 354 | Ga0495652_0983122 | 3300046529 | Bacteria | 553 |
| 355 | Ga0495654_0000051 | 3300046530 | Bacteria | 145932 |
| 356 | Ga0495654_0220588 | 3300046530 | Bacteria | 802 |
| 357 | Ga0495609_0002341 | 3300046538 | Bacteria | 11693 |
| 358 | Ga0495621_0227270 | 3300046539 | Bacteria | 757 |
| 359 | Ga0495597_0172065 | 3300046542 | Bacteria | 879 |
| 360 | Ga0495622_0037936 | 3300046557 | Bacteria | 2243 |
| 361 | Ga0495622_0145140 | 3300046557 | Bacteria | 1076 |
| 362 | Ga0495633_0053268 | 3300046558 | Bacteria | 1905 |
| 363 | Ga0495633_0059309 | 3300046558 | Bacteria | 1795 |
| 364 | Ga0495656_0011297 | 3300046615 | Bacteria | 3275 |
| 365 | Ga0495668_0264943 | 3300046616 | Bacteria | 941 |
| 366 | Ga0495668_0661646 | 3300046616 | Bacteria | 577 |
| 367 | Ga0495611_0013215 | 3300046648 | Bacteria | 3513 |
| 368 | Ga0495625_0014131 | 3300046660 | Bacteria | 6389 |
| 369 | Ga0495625_0078069 | 3300046660 | Bacteria | 2311 |
| 370 | Ga0495625_0080911 | 3300046660 | Bacteria | 2261 |
| 371 | Ga0495625_0099729 | 3300046660 | Bacteria | 1997 |
| 372 | Ga0495625_0222795 | 3300046660 | Bacteria | 1235 |
| 373 | Ga0495625_0483051 | 3300046660 | Bacteria | 760 |
| 374 | Ga0495625_0905869 | 3300046660 | Bacteria | 505 |
| 375 | Ga0495635_0633388 | 3300046663 | Bacteria | 697 |
| 376 | Ga0495659_0083916 | 3300046664 | Bacteria | 1213 |
| 377 | Ga0495659_0421969 | 3300046664 | Bacteria | 578 |
| 378 | Ga0495661_0095093 | 3300046665 | Bacteria | 1688 |
| 379 | Ga0495661_0125187 | 3300046665 | Bacteria | 1415 |
| 380 | Ga0495661_0333450 | 3300046665 | Bacteria | 751 |
| 381 | Ga0495588_0024755 | 3300046674 | Bacteria | 2985 |
| 382 | Ga0495624_0194317 | 3300046690 | Bacteria | 1234 |
| 383 | Ga0495670_0077140 | 3300046691 | Bacteria | 1694 |
| 384 | Ga0495670_0356316 | 3300046691 | Bacteria | 788 |
| 385 | Ga0495670_0378776 | 3300046691 | Unclassified | 763 |
| 386 | Ga0495671_0230892 | 3300046692 | Bacteria | 895 |
| 387 | Ga0495671_0590848 | 3300046692 | Unclassified | 528 |
| 388 | Ga0495649_0319192 | 3300046694 | Bacteria | 788 |
| 389 | Ga0495649_0375567 | 3300046694 | Bacteria | 716 |
| 390 | Ga0495589_0013549 | 3300046794 | Bacteria | 4205 |
| 391 | Ga0495589_0020332 | 3300046794 | Bacteria | 3396 |
| 392 | Ga0495589_0058705 | 3300046794 | Bacteria | 1892 |
| 393 | Ga0495589_0563997 | 3300046794 | Bacteria | 519 |
| 394 | Ga0495600_0045733 | 3300046809 | Bacteria | 2856 |
| 395 | Ga0495660_0258695 | 3300046810 | Bacteria | 804 |
| 396 | Ga0495636_0049141 | 3300047318 | Bacteria | 1763 |
| 397 | Ga0495672_0010003 | 3300047320 | Bacteria | 6801 |
| 398 | Ga0495672_0042238 | 3300047320 | Bacteria | 2751 |
| 399 | Ga0495672_0056243 | 3300047320 | Bacteria | 2290 |
| 400 | Ga0495672_0226920 | 3300047320 | Bacteria | 919 |
| 401 | Ga0495687_157183 | 3300047443 | Bacteria | 770 |
| 402 | Ga0495677_0016610 | 3300047445 | Bacteria | 2671 |
| 403 | Ga0495679_118205 | 3300047446 | Bacteria | 726 |
| 404 | Ga0495673_0000091 | 3300047469 | Bacteria | 187985 |
| 405 | Ga0495673_0008898 | 3300047469 | Bacteria | 5596 |
| 406 | Ga0495681_0092893 | 3300047470 | Bacteria | 1329 |
| 407 | Ga0495681_0277828 | 3300047470 | Bacteria | 654 |
| 408 | Ga0495686_0023057 | 3300047472 | Bacteria | 4112 |
| 409 | Ga0495686_0175496 | 3300047472 | Bacteria | 1244 |
| 410 | Ga0495686_0180678 | 3300047472 | Bacteria | 1222 |
| 411 | Ga0495686_0363682 | 3300047472 | Bacteria | 784 |
| 412 | Ga0495593_0439620 | 3300047673 | Bacteria | 653 |
| 413 | Ga0495626_0007371 | 3300048091 | Bacteria | 6127 |
| 414 | Ga0495626_0049928 | 3300048091 | Bacteria | 1935 |
| 415 | Ga0496102_0629566 | 3300048905 | Bacteria | 996 |
| 416 | Ga0496114_1155747 | 3300048917 | Bacteria | 660 |
| 417 | Ga0496115_0017368 | 3300048918 | Bacteria | 5499 |
| 418 | Ga0496115_0037006 | 3300048918 | Bacteria | 3866 |
| 419 | Ga0496120_0126705 | 3300048923 | Bacteria | 1313 |
| 420 | Ga0496121_0111863 | 3300048924 | Bacteria | 2081 |
| 421 | Ga0496125_0052011 | 3300048928 | Bacteria | 3372 |
| 422 | Ga0496126_0222599 | 3300048929 | Bacteria | 1584 |
| 423 | Ga0501034_1262481 | 3300049571 | Bacteria | 616 |
| 424 | Ga0501036_1470274 | 3300049572 | Unclassified | 552 |
| 425 | Ga0501037_0586263 | 3300049573 | Bacteria | 750 |
| 426 | Ga0501047_0014401 | 3300049581 | Bacteria | 7519 |
| 427 | Ga0501067_0307052 | 3300049583 | Bacteria | 883 |
| 428 | Ga0501069_0246570 | 3300049585 | Bacteria | 1041 |
| 429 | Ga0501073_0070304 | 3300049589 | Bacteria | 2438 |
| 430 | Ga0501219_008463 | 3300049703 | Bacteria | 753 |
| 431 | Ga0501225_0099242 | 3300049705 | Bacteria | 850 |
| 432 | Ga0501080_0043020 | 3300049742 | Bacteria | 4205 |
| 433 | Ga0501083_0029947 | 3300049744 | Bacteria | 3740 |
| 434 | Ga0501044_0279489 | 3300049823 | Bacteria | 1603 |
| 435 | nmdc:mga03683_178746_c1 | 3300050489 | Bacteria | 967 |
| 436 | nmdc:mga03683_249769_c1 | 3300050489 | Bacteria | 824 |
| 437 | nmdc:mga03683_261591_c1 | 3300050489 | Bacteria | 805 |
| 438 | nmdc:mga03683_354154_c1 | 3300050489 | Bacteria | 695 |
| 439 | nmdc:mga03n38_243577_c1 | 3300050490 | Bacteria | 947 |
| 440 | nmdc:mga00v17_686255_c1 | 3300050491 | Bacteria | 657 |
| 441 | nmdc:mga0yw44_179788_c1 | 3300050492 | Bacteria | 1392 |
| 442 | nmdc:mga0yw44_273792_c1 | 3300050492 | Bacteria | 1127 |
| 443 | nmdc:mga0yw44_98505_c1 | 3300050492 | Bacteria | 1859 |
| 444 | nmdc:mga0k408_160611_c1 | 3300050493 | Bacteria | 1339 |
| 445 | nmdc:mga0k408_272633_c1 | 3300050493 | Bacteria | 1010 |
| 446 | nmdc:mga0k408_276849_c1 | 3300050493 | Bacteria | 1002 |
| 447 | nmdc:mga0k408_67114_c1 | 3300050493 | Bacteria | 2090 |
| 448 | nmdc:mga0k408_91122_c1 | 3300050493 | Bacteria | 1791 |
| 449 | nmdc:mga06z11_568770_c1 | 3300050494 | Bacteria | 689 |
| 450 | nmdc:mga06z11_920307_c1 | 3300050494 | Bacteria | 533 |
| 451 | nmdc:mga07m45_301529_c1 | 3300050496 | Bacteria | 932 |
| 452 | nmdc:mga07m45_359509_c1 | 3300050496 | Bacteria | 846 |
| 453 | nmdc:mga07m45_45342_c1 | 3300050496 | Bacteria | 2469 |
| 454 | nmdc:mga07m45_612147_c1 | 3300050496 | Bacteria | 629 |
| 455 | nmdc:mga05p37_134895_c1 | 3300050507 | Bacteria | 3028 |
| 456 | nmdc:mga05p37_1796307_c1 | 3300050507 | Bacteria | 592 |
| 457 | nmdc:mga05p37_229130_c1 | 3300050507 | Bacteria | 2239 |
| 458 | nmdc:mga09592_1685440_c1 | 3300050508 | Bacteria | 511 |
| 459 | nmdc:mga0qj67_622586_c1 | 3300050509 | Bacteria | 862 |
| 460 | nmdc:mga06r32_588782_c1 | 3300050510 | Bacteria | 1084 |
| 461 | nmdc:mga08y16_62_c1 | 3300050511 | Bacteria | 89583 |
| 462 | nmdc:mga08y16_656325_c1 | 3300050511 | Bacteria | 1053 |
| 463 | nmdc:mga08y16_922451_c1 | 3300050511 | Bacteria | 858 |
| 464 | nmdc:mga0a205_1187039_c1 | 3300050515 | Bacteria | 611 |
| 465 | nmdc:mga0sz30_198887_c1 | 3300050516 | Bacteria | 890 |
| 466 | Ga0500610_0002738 | 3300053079 | Bacteria | 6585 |
| 467 | Ga0495655_0275306 | 3300053083 | Bacteria | 572 |
| 468 | Ga0500578_0771256 | 3300053086 | Bacteria | 511 |
| 469 | Ga0500643_019214 | 3300053087 | Bacteria | 2254 |
| 470 | Ga0500644_0282582 | 3300053088 | Bacteria | 707 |
| 471 | Ga0500646_0023676 | 3300053090 | Bacteria | 1648 |
| 472 | Ga0500646_0069364 | 3300053090 | Bacteria | 1054 |
| 473 | Ga0500646_0161947 | 3300053090 | Bacteria | 747 |
| 474 | Ga0500566_0005190 | 3300053094 | Bacteria | 7755 |
| 475 | Ga0500650_0192214 | 3300053098 | Bacteria | 932 |
| 476 | Ga0500650_0305895 | 3300053098 | Bacteria | 703 |
| 477 | Ga0500554_072482 | 3300053102 | Bacteria | 1123 |
| 478 | Ga0500555_174956 | 3300053103 | Bacteria | 520 |
| 479 | Ga0500556_0001096 | 3300053104 | Bacteria | 13560 |
| 480 | Ga0500562_016324 | 3300053108 | Bacteria | 1909 |
| 481 | Ga0500562_034602 | 3300053108 | Bacteria | 1337 |
| 482 | Ga0500569_090839 | 3300053109 | Bacteria | 989 |
| 483 | Ga0500594_0065146 | 3300053118 | Bacteria | 1059 |
| 484 | Ga0500595_004320 | 3300053119 | Bacteria | 6402 |
| 485 | Ga0500614_095057 | 3300053123 | Bacteria | 852 |
| 486 | Ga0500642_0030447 | 3300053130 | Bacteria | 2245 |
| 487 | Ga0500655_121993 | 3300053133 | Bacteria | 553 |
| 488 | Ga0500658_0000367 | 3300053134 | Bacteria | 19903 |
| 489 | Ga0500658_0001583 | 3300053134 | Bacteria | 9094 |
| 490 | Ga0500658_0035889 | 3300053134 | Bacteria | 1965 |
| 491 | Ga0500658_0048739 | 3300053134 | Bacteria | 1723 |
| 492 | Ga0500658_0053565 | 3300053134 | Bacteria | 1655 |
| 493 | Ga0500568_0005567 | 3300053139 | Bacteria | 6487 |
| 494 | Ga0500568_0006793 | 3300053139 | Bacteria | 5703 |
| 495 | Ga0500577_0013986 | 3300053142 | Bacteria | 2468 |
| 496 | Ga0500577_0053937 | 3300053142 | Bacteria | 1521 |
| 497 | Ga0500588_0036503 | 3300053146 | Bacteria | 1454 |
| 498 | Ga0500590_000501 | 3300053148 | Bacteria | 13503 |
| 499 | Ga0500603_000554 | 3300053150 | Bacteria | 9409 |
| 500 | Ga0500604_0003450 | 3300053151 | Bacteria | 4258 |
| 501 | Ga0500604_0076081 | 3300053151 | Bacteria | 1078 |
| 502 | Ga0500604_0228427 | 3300053151 | Bacteria | 642 |
| 503 | Ga0500616_0008119 | 3300053153 | Bacteria | 6565 |
| 504 | Ga0500616_0043193 | 3300053153 | Bacteria | 2410 |
| 505 | Ga0500616_0055491 | 3300053153 | Bacteria | 2072 |
| 506 | Ga0500616_0085793 | 3300053153 | Bacteria | 1571 |
| 507 | Ga0500622_0436837 | 3300053156 | Bacteria | 524 |
| 508 | Ga0500627_0014585 | 3300053158 | Bacteria | 3014 |
| 509 | Ga0500627_0092263 | 3300053158 | Bacteria | 1356 |
| 510 | Ga0500634_0299346 | 3300053161 | Bacteria | 639 |
| 511 | Ga0500639_013853 | 3300053163 | Bacteria | 4239 |
| 512 | Ga0500637_0030423 | 3300053178 | Bacteria | 3004 |
| 513 | Ga0500611_006365 | 3300053727 | Bacteria | 1716 |
| 514 | Ga0500645_001569 | 3300053730 | Bacteria | 11375 |
| 515 | Ga0500645_038697 | 3300053730 | Bacteria | 1414 |
| 516 | Ga0500645_103035 | 3300053730 | Bacteria | 804 |
| 517 | Ga0500609_000896 | 3300053731 | Bacteria | 4467 |
| 518 | Ga0500587_000134 | 3300053739 | Bacteria | 6898 |
| 519 | Ga0590074_060023 | 3300059423 | Bacteria | 706 |
| 520 | Ga0590075_034695 | 3300059424 | Bacteria | 1284 |
| 521 | Ga0590077_042502 | 3300059426 | Bacteria | 1012 |
| 522 | Ga0501082_0010091 | 3300060353 | Bacteria | 8137 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046660 | Ga0495625_0905869 | Ga0495625_0905869_133_423 | 96 |
| 2 | 3300006177 | Ga0075362_10401752 | Ga0075362_104017522 | 99 |
| 3 | 3300006195 | Ga0075366_10101137 | Ga0075366_101011372 | 99 |
| 4 | 3300006195 | Ga0075366_10186459 | Ga0075366_101864592 | 99 |
| 5 | 3300009147 | Ga0114129_10244130 | Ga0114129_102441304 | 99 |
| 6 | 3300009553 | Ga0105249_11286628 | Ga0105249_112866282 | 99 |
| 7 | 3300028794 | Ga0307515_10256910 | Ga0307515_102569103 | 99 |
| 8 | 3300031456 | Ga0307513_10019885 | Ga0307513_1001988510 | 99 |
| 9 | 3300041458 | Ga0451798_0370119 | Ga0451798_0370119_10_309 | 99 |
| 10 | 3300041458 | Ga0451798_0831548 | Ga0451798_0831548_126_425 | 99 |
| 11 | 3300041486 | Ga0451807_1014837 | Ga0451807_1014837_24_323 | 99 |
| 12 | 3300041505 | Ga0451849_0216237 | Ga0451849_0216237_140_439 | 99 |
| 13 | 3300042012 | Ga0439455_0211271 | Ga0439455_0211271_158_457 | 99 |
| 14 | 3300042134 | Ga0450898_045138 | Ga0450898_045138_412_711 | 99 |
| 15 | 3300046471 | Ga0495650_0005807 | Ga0495650_0005807_3549_3848 | 99 |
| 16 | 3300046519 | Ga0495632_0340546 | Ga0495632_0340546_30_329 | 99 |
| 17 | 3300046665 | Ga0495661_0333450 | Ga0495661_0333450_376_675 | 99 |
| 18 | 3300046691 | Ga0495670_0356316 | Ga0495670_0356316_248_547 | 99 |
| 19 | 3300047446 | Ga0495679_118205 | Ga0495679_118205_344_643 | 99 |
| 20 | 3300047673 | Ga0495593_0439620 | Ga0495593_0439620_17_316 | 99 |
| 21 | 3300050489 | nmdc:mga03683_261591_c1 | nmdc:mga03683_261591_c1_149_448 | 99 |
| 22 | 3300050494 | nmdc:mga06z11_920307_c1 | nmdc:mga06z11_920307_c1_16_315 | 99 |
| 23 | 3300050507 | nmdc:mga05p37_229130_c1 | nmdc:mga05p37_229130_c1_434_733 | 99 |
| 24 | 3300050508 | nmdc:mga09592_1685440_c1 | nmdc:mga09592_1685440_c1_104_403 | 99 |
| 25 | 3300053139 | Ga0500568_0006793 | Ga0500568_0006793_809_1108 | 99 |
| 26 | 3300046471 | Ga0495650_0331498 | Ga0495650_0331498_111_422 | 103 |
| 27 | iso_pu_bacteria | 2920760137 | 2920764372 | 104 |
| 28 | iso_pu_bacteria | 2928531327 | 2928533232 | 104 |
| 29 | iso_pu_bacteria | 2510917020 | 2511125448 | 105 |
| 30 | iso_pu_bacteria | 2512875026 | 2512973129 | 105 |
| 31 | iso_pu_bacteria | 2513237085 | 2513580573 | 105 |
| 32 | iso_pu_bacteria | 2513237089 | 2513603490 | 105 |
| 33 | iso_pu_bacteria | 2513237156 | 2513983191 | 105 |
| 34 | iso_pu_bacteria | 2513237160 | 2514005730 | 105 |
| 35 | iso_pu_bacteria | 2513237162 | 2514022961 | 105 |
| 36 | iso_pu_bacteria | 2513237351 | 2514591369 | 105 |
| 37 | iso_pu_bacteria | 2515154113 | 2515638579 | 105 |
| 38 | iso_pu_bacteria | 2515154114 | 2515647192 | 105 |
| 39 | iso_pu_bacteria | 2515154134 | 2515743159 | 105 |
| 40 | iso_pu_bacteria | 2516653085 | 2517075092 | 105 |
| 41 | iso_pu_bacteria | 2517287029 | 2517405497 | 105 |
| 42 | iso_pu_bacteria | 2517487022 | 2517571868 | 105 |
| 43 | iso_pu_bacteria | 2582581306 | 2585265451 | 105 |
| 44 | iso_pu_bacteria | 2582581865 | 2585388469 | 105 |
| 45 | iso_pu_bacteria | 2582581866 | 2585392346 | 105 |
| 46 | iso_pu_bacteria | 2585427526 | 2585525254 | 105 |
| 47 | iso_pu_bacteria | 2643221545 | 2643748427 | 105 |
| 48 | iso_pu_bacteria | 2643221573 | 2643880918 | 105 |
| 49 | iso_pu_bacteria | 2643221583 | 2643926664 | 105 |
| 50 | iso_pu_bacteria | 2643221691 | 2644510100 | 105 |
| 51 | iso_pu_bacteria | 2643221720 | 2644661487 | 105 |
| 52 | iso_pu_bacteria | 2643221728 | 2644699568 | 105 |
| 53 | iso_pu_bacteria | 2718217882 | 2719179910 | 105 |
| 54 | iso_pu_bacteria | 2718218009 | 2719730659 | 105 |
| 55 | iso_pu_bacteria | 2718218363 | 2721146003 | 105 |
| 56 | iso_pu_bacteria | 2718218366 | 2721162883 | 105 |
| 57 | iso_pu_bacteria | 2721755514 | 2722839053 | 105 |
| 58 | iso_pu_bacteria | 2721755810 | 2724043415 | 105 |
| 59 | iso_pu_bacteria | 2728369365 | 2730163147 | 105 |
| 60 | iso_pu_bacteria | 2775506901 | 2776261402 | 105 |
| 61 | iso_pu_bacteria | 2791355260 | 2793324969 | 105 |
| 62 | iso_pu_bacteria | 2791355264 | 2793349321 | 105 |
| 63 | iso_pu_bacteria | 2802428858 | 2802718698 | 105 |
| 64 | iso_pu_bacteria | 2802428859 | 2802724376 | 105 |
| 65 | iso_pu_bacteria | 2802428860 | 2802729960 | 105 |
| 66 | iso_pu_bacteria | 2802428861 | 2802737303 | 105 |
| 67 | iso_pu_bacteria | 2802428862 | 2802742219 | 105 |
| 68 | iso_pu_bacteria | 2802428863 | 2802748902 | 105 |
| 69 | iso_pu_bacteria | 2838686498 | 2838688993 | 105 |
| 70 | iso_pu_bacteria | 2838729681 | 2838731288 | 105 |
| 71 | iso_pu_bacteria | 2838742623 | 2838743818 | 105 |
| 72 | iso_pu_bacteria | 2842156927 | 2842159671 | 105 |
| 73 | iso_pu_bacteria | 2842163707 | 2842169458 | 105 |
| 74 | iso_pu_bacteria | 2842180545 | 2842183713 | 105 |
| 75 | iso_pu_bacteria | 2842229732 | 2842233807 | 105 |
| 76 | iso_pu_bacteria | 2842243621 | 2842245282 | 105 |
| 77 | iso_pu_bacteria | 2842257432 | 2842260068 | 105 |
| 78 | iso_pu_bacteria | 2842271015 | 2842278589 | 105 |
| 79 | iso_pu_bacteria | 2842285085 | 2842290288 | 105 |
| 80 | iso_pu_bacteria | 2842304105 | 2842307147 | 105 |
| 81 | iso_pu_bacteria | 2842402390 | 2842408123 | 105 |
| 82 | iso_pu_bacteria | 2842409023 | 2842414884 | 105 |
| 83 | iso_pu_bacteria | 2842415677 | 2842421425 | 105 |
| 84 | iso_pu_bacteria | 2844454524 | 2844455518 | 105 |
| 85 | iso_pu_bacteria | 2852387548 | 2852393395 | 105 |
| 86 | iso_pu_bacteria | 2915980308 | 2915982626 | 105 |
| 87 | iso_pu_bacteria | 2916061851 | 2916063989 | 105 |
| 88 | iso_pu_bacteria | 2921250672 | 2921256399 | 105 |
| 89 | iso_pu_bacteria | 2933570622 | 2933572740 | 105 |
| 90 | iso_pu_bacteria | 2935901341 | 2935906682 | 105 |
| 91 | iso_pu_bacteria | 2937029754 | 2937030512 | 105 |
| 92 | iso_pu_bacteria | 2937036028 | 2937038979 | 105 |
| 93 | iso_pu_bacteria | 2937078374 | 2937083852 | 105 |
| 94 | iso_pu_bacteria | 2937084907 | 2937088614 | 105 |
| 95 | iso_pu_bacteria | 2941499720 | 2941506601 | 105 |
| 96 | iso_pu_bacteria | 2957375807 | 2957377945 | 105 |
| 97 | iso_pu_bacteria | 2957437181 | 2957438708 | 105 |
| 98 | iso_pu_bacteria | 2960591022 | 2960593240 | 105 |
| 99 | iso_pu_bacteria | 2960631154 | 2960635300 | 105 |
| 100 | iso_pu_bacteria | 2960680706 | 2960682586 | 105 |
| 101 | iso_pu_bacteria | 2960693952 | 2960697846 | 105 |
| 102 | iso_pu_bacteria | 2967686174 | 2967688524 | 105 |
| 103 | iso_pu_bacteria | 2967728569 | 2967732839 | 105 |
| 104 | iso_pu_bacteria | 2970026789 | 2970031890 | 105 |
| 105 | iso_pu_bacteria | 2970122695 | 2970122707 | 105 |
| 106 | iso_pu_bacteria | 2970143518 | 2970145229 | 105 |
| 107 | iso_pu_bacteria | 2977544691 | 2977547000 | 105 |
| 108 | iso_pu_bacteria | 8003999396 | 8004003540 | 105 |
| 109 | iso_pu_bacteria | 8005307578 | 8005310905 | 105 |
| 110 | iso_pu_bacteria | 8046767195 | 8046774451 | 105 |
| 111 | iso_pu_bacteria | 8057575449 | 8057579353 | 105 |
| 112 | 3300028573 | Ga0265334_10095297 | Ga0265334_100952971 | 106 |
| 113 | 3300031247 | Ga0265340_10147136 | Ga0265340_101471363 | 106 |
| 114 | iso_pu_bacteria | 2599185352 | 2600195361 | 106 |
| 115 | iso_pu_bacteria | 2643221723 | 2644671553 | 106 |
| 116 | iso_pu_bacteria | 2920822456 | 2920822912 | 106 |
| 117 | 3300049572 | Ga0501036_1470274 | Ga0501036_1470274_26_349 | 107 |
| 118 | iso_pu_bacteria | 2842357229 | 2842362971 | 107 |
| 119 | 3300009147 | Ga0114129_10036405 | Ga0114129_100364056 | 108 |
| 120 | 3300046455 | Ga0495603_0127020 | Ga0495603_0127020_844_1170 | 108 |
| 121 | 3300046507 | Ga0495606_0597953 | Ga0495606_0597953_167_493 | 108 |
| 122 | 3300046524 | Ga0495648_0027461 | Ga0495648_0027461_2353_2679 | 108 |
| 123 | 3300050507 | nmdc:mga05p37_134895_c1 | nmdc:mga05p37_134895_c1_1334_1660 | 108 |
| 124 | 3300053102 | Ga0500554_072482 | Ga0500554_072482_123_449 | 108 |
| 125 | 3300053150 | Ga0500603_000554 | Ga0500603_000554_7667_7993 | 108 |
| 126 | 3300053178 | Ga0500637_0030423 | Ga0500637_0030423_1096_1422 | 108 |
| 127 | 3300001979 | JGI24740J21852_10084512 | JGI24740J21852_100845122 | 109 |
| 128 | 3300001989 | JGI24739J22299_10008629 | JGI24739J22299_100086296 | 109 |
| 129 | 3300001990 | JGI24737J22298_10017277 | JGI24737J22298_100172772 | 109 |
| 130 | 3300002067 | JGI24735J21928_10046128 | JGI24735J21928_100461282 | 109 |
| 131 | 3300002739 | JGI25158J39367_1012298 | JGI25158J39367_10122982 | 109 |
| 132 | 3300002987 | JGI25159J45721_1000015 | JGI25159J45721_100001572 | 109 |
| 133 | 3300003187 | JGI25151J46595_10011614 | JGI25151J46595_100116143 | 109 |
| 134 | 3300003203 | JGI25406J46586_10000047 | JGI25406J46586_1000004726 | 109 |
| 135 | 3300003203 | JGI25406J46586_10162247 | JGI25406J46586_101622472 | 109 |
| 136 | 3300003215 | JGI25153J46596_10029812 | JGI25153J46596_100298123 | 109 |
| 137 | 3300003215 | JGI25153J46596_10088291 | JGI25153J46596_100882912 | 109 |
| 138 | 3300003322 | rootL2_10150296 | rootL2_101502963 | 109 |
| 139 | 3300003354 | JGI25160J50197_1000003 | JGI25160J50197_1000003112 | 109 |
| 140 | 3300003374 | JGI25161J50226_1000741 | JGI25161J50226_10007414 | 109 |
| 141 | 3300003771 | Ga0055526_1004390 | Ga0055526_100439011 | 109 |
| 142 | 3300003773 | Ga0055537_1001778 | Ga0055537_10017786 | 109 |
| 143 | 3300003775 | Ga0055524_1016620 | Ga0055524_10166204 | 109 |
| 144 | 3300003775 | Ga0055524_1032933 | Ga0055524_10329332 | 109 |
| 145 | 3300003775 | Ga0055524_1053979 | Ga0055524_10539791 | 109 |
| 146 | 3300003781 | Ga0055536_1001123 | Ga0055536_100112318 | 109 |
| 147 | 3300003790 | Ga0055528_1005639 | Ga0055528_10056393 | 109 |
| 148 | 3300003790 | Ga0055528_1005709 | Ga0055528_10057093 | 109 |
| 149 | 3300003791 | Ga0055530_10004321 | Ga0055530_100043219 | 109 |
| 150 | 3300003792 | Ga0055540_1014995 | Ga0055540_10149953 | 109 |
| 151 | 3300004625 | Ga0055543_1000034 | Ga0055543_100003442 | 109 |
| 152 | 3300005262 | Ga0065165_1000025 | Ga0065165_1000025221 | 109 |
| 153 | 3300005327 | Ga0070658_10005436 | Ga0070658_100054364 | 109 |
| 154 | 3300005331 | Ga0070670_100000235 | Ga0070670_10000023519 | 109 |
| 155 | 3300005334 | Ga0068869_100134555 | Ga0068869_1001345553 | 109 |
| 156 | 3300005335 | Ga0070666_10000008 | Ga0070666_1000000883 | 109 |
| 157 | 3300005339 | Ga0070660_100918789 | Ga0070660_1009187892 | 109 |
| 158 | 3300005344 | Ga0070661_100013390 | Ga0070661_1000133904 | 109 |
| 159 | 3300005347 | Ga0070668_100508162 | Ga0070668_1005081621 | 109 |
| 160 | 3300005347 | Ga0070668_101746660 | Ga0070668_1017466602 | 109 |
| 161 | 3300005353 | Ga0070669_100025480 | Ga0070669_1000254806 | 109 |
| 162 | 3300005366 | Ga0070659_100029353 | Ga0070659_1000293535 | 109 |
| 163 | 3300005366 | Ga0070659_100092438 | Ga0070659_1000924383 | 109 |
| 164 | 3300005436 | Ga0070713_100866624 | Ga0070713_1008666242 | 109 |
| 165 | 3300005436 | Ga0070713_100964051 | Ga0070713_1009640512 | 109 |
| 166 | 3300005444 | Ga0070694_100746068 | Ga0070694_1007460681 | 109 |
| 167 | 3300005445 | Ga0070708_100162634 | Ga0070708_1001626344 | 109 |
| 168 | 3300005445 | Ga0070708_100455554 | Ga0070708_1004555542 | 109 |
| 169 | 3300005445 | Ga0070708_100668742 | Ga0070708_1006687422 | 109 |
| 170 | 3300005458 | Ga0070681_10811087 | Ga0070681_108110872 | 109 |
| 171 | 3300005458 | Ga0070681_11493962 | Ga0070681_114939621 | 109 |
| 172 | 3300005468 | Ga0070707_100312332 | Ga0070707_1003123322 | 109 |
| 173 | 3300005468 | Ga0070707_100314217 | Ga0070707_1003142173 | 109 |
| 174 | 3300005471 | Ga0070698_100084065 | Ga0070698_1000840652 | 109 |
| 175 | 3300005471 | Ga0070698_100672616 | Ga0070698_1006726162 | 109 |
| 176 | 3300005471 | Ga0070698_100850709 | Ga0070698_1008507092 | 109 |
| 177 | 3300005518 | Ga0070699_100446269 | Ga0070699_1004462692 | 109 |
| 178 | 3300005530 | Ga0070679_100195102 | Ga0070679_1001951023 | 109 |
| 179 | 3300005536 | Ga0070697_100232175 | Ga0070697_1002321753 | 109 |
| 180 | 3300005548 | Ga0070665_100236483 | Ga0070665_1002364832 | 109 |
| 181 | 3300005548 | Ga0070665_101227012 | Ga0070665_1012270122 | 109 |
| 182 | 3300005548 | Ga0070665_101401654 | Ga0070665_1014016542 | 109 |
| 183 | 3300005577 | Ga0068857_100489906 | Ga0068857_1004899062 | 109 |
| 184 | 3300005577 | Ga0068857_100846873 | Ga0068857_1008468732 | 109 |
| 185 | 3300005577 | Ga0068857_101376929 | Ga0068857_1013769292 | 109 |
| 186 | 3300005578 | Ga0068854_101241198 | Ga0068854_1012411982 | 109 |
| 187 | 3300005614 | Ga0068856_100507351 | Ga0068856_1005073513 | 109 |
| 188 | 3300005615 | Ga0070702_100163688 | Ga0070702_1001636881 | 109 |
| 189 | 3300005617 | Ga0068859_100552461 | Ga0068859_1005524612 | 109 |
| 190 | 3300005618 | Ga0068864_102046421 | Ga0068864_1020464211 | 109 |
| 191 | 3300005718 | Ga0068866_10157037 | Ga0068866_101570372 | 109 |
| 192 | 3300005719 | Ga0068861_100009698 | Ga0068861_1000096984 | 109 |
| 193 | 3300005840 | Ga0068870_10133752 | Ga0068870_101337522 | 109 |
| 194 | 3300005842 | Ga0068858_101382844 | Ga0068858_1013828442 | 109 |
| 195 | 3300005843 | Ga0068860_100575520 | Ga0068860_1005755202 | 109 |
| 196 | 3300005844 | Ga0068862_100376168 | Ga0068862_1003761682 | 109 |
| 197 | 3300005844 | Ga0068862_101190291 | Ga0068862_1011902912 | 109 |
| 198 | 3300005937 | Ga0081455_10158241 | Ga0081455_101582413 | 109 |
| 199 | 3300005981 | Ga0081538_10010032 | Ga0081538_100100328 | 109 |
| 200 | 3300005985 | Ga0081539_10000140 | Ga0081539_1000014079 | 109 |
| 201 | 3300005985 | Ga0081539_10094066 | Ga0081539_100940662 | 109 |
| 202 | 3300006028 | Ga0070717_11139108 | Ga0070717_111391081 | 109 |
| 203 | 3300006038 | Ga0075365_10028635 | Ga0075365_100286357 | 109 |
| 204 | 3300006038 | Ga0075365_10689049 | Ga0075365_106890492 | 109 |
| 205 | 3300006042 | Ga0075368_10169854 | Ga0075368_101698541 | 109 |
| 206 | 3300006042 | Ga0075368_10421137 | Ga0075368_104211371 | 109 |
| 207 | 3300006048 | Ga0075363_100577628 | Ga0075363_1005776282 | 109 |
| 208 | 3300006051 | Ga0075364_10164049 | Ga0075364_101640491 | 109 |
| 209 | 3300006173 | Ga0070716_100391439 | Ga0070716_1003914393 | 109 |
| 210 | 3300006175 | Ga0070712_100678991 | Ga0070712_1006789911 | 109 |
| 211 | 3300006177 | Ga0075362_10086380 | Ga0075362_100863802 | 109 |
| 212 | 3300006177 | Ga0075362_10115528 | Ga0075362_101155282 | 109 |
| 213 | 3300006177 | Ga0075362_10357615 | Ga0075362_103576152 | 109 |
| 214 | 3300006178 | Ga0075367_10157244 | Ga0075367_101572443 | 109 |
| 215 | 3300006186 | Ga0075369_10196386 | Ga0075369_101963862 | 109 |
| 216 | 3300006186 | Ga0075369_10228758 | Ga0075369_102287582 | 109 |
| 217 | 3300006195 | Ga0075366_10037335 | Ga0075366_100373355 | 109 |
| 218 | 3300006195 | Ga0075366_10203828 | Ga0075366_102038282 | 109 |
| 219 | 3300006195 | Ga0075366_10354921 | Ga0075366_103549212 | 109 |
| 220 | 3300006195 | Ga0075366_10528986 | Ga0075366_105289862 | 109 |
| 221 | 3300006195 | Ga0075366_10686968 | Ga0075366_106869682 | 109 |
| 222 | 3300006237 | Ga0097621_100119917 | Ga0097621_1001199173 | 109 |
| 223 | 3300006353 | Ga0075370_10247149 | Ga0075370_102471493 | 109 |
| 224 | 3300006353 | Ga0075370_10683893 | Ga0075370_106838932 | 109 |
| 225 | 3300006844 | Ga0075428_101211399 | Ga0075428_1012113991 | 109 |
| 226 | 3300006846 | Ga0075430_100616516 | Ga0075430_1006165162 | 109 |
| 227 | 3300006852 | Ga0075433_10392128 | Ga0075433_103921282 | 109 |
| 228 | 3300006881 | Ga0068865_100597552 | Ga0068865_1005975522 | 109 |
| 229 | 3300006881 | Ga0068865_101895344 | Ga0068865_1018953441 | 109 |
| 230 | 3300006931 | Ga0097620_100552445 | Ga0097620_1005524452 | 109 |
| 231 | 3300006946 | Ga0079104_1002956 | Ga0079104_100295611 | 109 |
| 232 | 3300007265 | Ga0099794_10070864 | Ga0099794_100708643 | 109 |
| 233 | 3300007265 | Ga0099794_10425017 | Ga0099794_104250171 | 109 |
| 234 | 3300007788 | Ga0099795_10321646 | Ga0099795_103216462 | 109 |
| 235 | 3300009093 | Ga0105240_10482952 | Ga0105240_104829523 | 109 |
| 236 | 3300009094 | Ga0111539_10000100 | Ga0111539_1000010052 | 109 |
| 237 | 3300009094 | Ga0111539_10474741 | Ga0111539_104747413 | 109 |
| 238 | 3300009094 | Ga0111539_11169860 | Ga0111539_111698602 | 109 |
| 239 | 3300009101 | Ga0105247_11598278 | Ga0105247_115982782 | 109 |
| 240 | 3300009147 | Ga0114129_10764461 | Ga0114129_107644611 | 109 |
| 241 | 3300009147 | Ga0114129_11428232 | Ga0114129_114282322 | 109 |
| 242 | 3300009148 | Ga0105243_10096309 | Ga0105243_100963093 | 109 |
| 243 | 3300009148 | Ga0105243_11883532 | Ga0105243_118835321 | 109 |
| 244 | 3300009177 | Ga0105248_11243612 | Ga0105248_112436122 | 109 |
| 245 | 3300009545 | Ga0105237_10032217 | Ga0105237_100322177 | 109 |
| 246 | 3300009545 | Ga0105237_10627370 | Ga0105237_106273703 | 109 |
| 247 | 3300009551 | Ga0105238_10000178 | Ga0105238_1000017814 | 109 |
| 248 | 3300009553 | Ga0105249_10139742 | Ga0105249_101397422 | 109 |
| 249 | 3300009763 | Ga0123340_1065581 | Ga0123340_10655812 | 109 |
| 250 | 3300009765 | Ga0123341_1006881 | Ga0123341_100688115 | 109 |
| 251 | 3300009766 | Ga0123342_1020394 | Ga0123342_10203944 | 109 |
| 252 | 3300010159 | Ga0099796_10032210 | Ga0099796_100322103 | 109 |
| 253 | 3300010159 | Ga0099796_10068079 | Ga0099796_100680793 | 109 |
| 254 | 3300010159 | Ga0099796_10486174 | Ga0099796_104861741 | 109 |
| 255 | 3300010375 | Ga0105239_12875280 | Ga0105239_128752801 | 109 |
| 256 | 3300011119 | Ga0105246_10025133 | Ga0105246_100251333 | 109 |
| 257 | 3300011119 | Ga0105246_10828819 | Ga0105246_108288192 | 109 |
| 258 | 3300013100 | Ga0157373_10500353 | Ga0157373_105003532 | 109 |
| 259 | 3300013100 | Ga0157373_10655404 | Ga0157373_106554041 | 109 |
| 260 | 3300013102 | Ga0157371_10289731 | Ga0157371_102897312 | 109 |
| 261 | 3300013105 | Ga0157369_10045197 | Ga0157369_100451973 | 109 |
| 262 | 3300013249 | Ga0171463_1001 | Ga0171463_10011165 | 109 |
| 263 | 3300013306 | Ga0163162_10000110 | Ga0163162_100001107 | 109 |
| 264 | 3300013306 | Ga0163162_10125090 | Ga0163162_101250901 | 109 |
| 265 | 3300013306 | Ga0163162_10573563 | Ga0163162_105735631 | 109 |
| 266 | 3300013306 | Ga0163162_11029712 | Ga0163162_110297122 | 109 |
| 267 | 3300013307 | Ga0157372_10044853 | Ga0157372_100448534 | 109 |
| 268 | 3300013308 | Ga0157375_12108384 | Ga0157375_121083842 | 109 |
| 269 | 3300013308 | Ga0157375_12802651 | Ga0157375_128026511 | 109 |
| 270 | 3300014325 | Ga0163163_12210725 | Ga0163163_122107251 | 109 |
| 271 | 3300014325 | Ga0163163_12679547 | Ga0163163_126795472 | 109 |
| 272 | 3300014326 | Ga0157380_10091712 | Ga0157380_100917122 | 109 |
| 273 | 3300014326 | Ga0157380_10164708 | Ga0157380_101647083 | 109 |
| 274 | 3300014969 | Ga0157376_11081489 | Ga0157376_110814892 | 109 |
| 275 | 3300015265 | Ga0182005_1054497 | Ga0182005_10544972 | 109 |
| 276 | 3300015690 | Ga0183363_1038 | Ga0183363_103824 | 109 |
| 277 | 3300017792 | Ga0163161_10260187 | Ga0163161_102601871 | 109 |
| 278 | 3300021441 | Ga0213871_10023477 | Ga0213871_100234773 | 109 |
| 279 | 3300022739 | Ga0228711_1003229 | Ga0228711_100322912 | 109 |
| 280 | 3300022740 | Ga0228710_1000004 | Ga0228710_100000434 | 109 |
| 281 | 3300024227 | Ga0228598_1093986 | Ga0228598_10939861 | 109 |
| 282 | 3300025208 | Ga0209436_100130 | Ga0209436_10013015 | 109 |
| 283 | 3300025245 | Ga0207425_1043790 | Ga0207425_10437902 | 109 |
| 284 | 3300025263 | Ga0209565_1001017 | Ga0209565_100101710 | 109 |
| 285 | 3300025273 | Ga0209673_1000910 | Ga0209673_100091030 | 109 |
| 286 | 3300025273 | Ga0209673_1001024 | Ga0209673_100102434 | 109 |
| 287 | 3300025273 | Ga0209673_1002323 | Ga0209673_100232314 | 109 |
| 288 | 3300025284 | Ga0209130_1000005 | Ga0209130_1000005369 | 109 |
| 289 | 3300025291 | Ga0209675_1057472 | Ga0209675_10574722 | 109 |
| 290 | 3300025292 | Ga0209676_1001927 | Ga0209676_100192718 | 109 |
| 291 | 3300025294 | Ga0209025_1000105 | Ga0209025_100010549 | 109 |
| 292 | 3300025295 | Ga0209564_1000113 | Ga0209564_100011357 | 109 |
| 293 | 3300025295 | Ga0209564_1003780 | Ga0209564_10037805 | 109 |
| 294 | 3300025295 | Ga0209564_1025276 | Ga0209564_10252762 | 109 |
| 295 | 3300025295 | Ga0209564_1027096 | Ga0209564_10270963 | 109 |
| 296 | 3300025297 | Ga0209758_1000005 | Ga0209758_1000005154 | 109 |
| 297 | 3300025297 | Ga0209758_1003851 | Ga0209758_100385112 | 109 |
| 298 | 3300025297 | Ga0209758_1004830 | Ga0209758_10048303 | 109 |
| 299 | 3300025297 | Ga0209758_1051278 | Ga0209758_10512782 | 109 |
| 300 | 3300025298 | Ga0209050_1005247 | Ga0209050_10052475 | 109 |
| 301 | 3300025299 | Ga0209256_1002310 | Ga0209256_10023109 | 109 |
| 302 | 3300025299 | Ga0209256_1003107 | Ga0209256_100310715 | 109 |
| 303 | 3300025299 | Ga0209256_1003175 | Ga0209256_100317513 | 109 |
| 304 | 3300025299 | Ga0209256_1013685 | Ga0209256_10136854 | 109 |
| 305 | 3300025302 | Ga0207426_1000015 | Ga0207426_1000015230 | 109 |
| 306 | 3300025303 | Ga0209051_1001056 | Ga0209051_10010569 | 109 |
| 307 | 3300025303 | Ga0209051_1013650 | Ga0209051_10136504 | 109 |
| 308 | 3300025304 | Ga0209257_1001948 | Ga0209257_100194816 | 109 |
| 309 | 3300025304 | Ga0209257_1058438 | Ga0209257_10584382 | 109 |
| 310 | 3300025901 | Ga0207688_10027060 | Ga0207688_100270603 | 109 |
| 311 | 3300025903 | Ga0207680_10000005 | Ga0207680_10000005153 | 109 |
| 312 | 3300025904 | Ga0207647_10001693 | Ga0207647_1000169310 | 109 |
| 313 | 3300025909 | Ga0207705_10023654 | Ga0207705_100236545 | 109 |
| 314 | 3300025913 | Ga0207695_10639275 | Ga0207695_106392752 | 109 |
| 315 | 3300025914 | Ga0207671_10039392 | Ga0207671_100393925 | 109 |
| 316 | 3300025915 | Ga0207693_10211944 | Ga0207693_102119443 | 109 |
| 317 | 3300025917 | Ga0207660_10908104 | Ga0207660_109081042 | 109 |
| 318 | 3300025919 | Ga0207657_11451853 | Ga0207657_114518531 | 109 |
| 319 | 3300025920 | Ga0207649_10016493 | Ga0207649_100164934 | 109 |
| 320 | 3300025921 | Ga0207652_10205094 | Ga0207652_102050944 | 109 |
| 321 | 3300025922 | Ga0207646_10307836 | Ga0207646_103078363 | 109 |
| 322 | 3300025924 | Ga0207694_10000187 | Ga0207694_100001879 | 109 |
| 323 | 3300025925 | Ga0207650_10000203 | Ga0207650_1000020340 | 109 |
| 324 | 3300025928 | Ga0207700_10749489 | Ga0207700_107494892 | 109 |
| 325 | 3300025932 | Ga0207690_10038025 | Ga0207690_100380253 | 109 |
| 326 | 3300025932 | Ga0207690_10389008 | Ga0207690_103890081 | 109 |
| 327 | 3300025933 | Ga0207706_10285910 | Ga0207706_102859101 | 109 |
| 328 | 3300025942 | Ga0207689_10332131 | Ga0207689_103321313 | 109 |
| 329 | 3300025961 | Ga0207712_10989079 | Ga0207712_109890792 | 109 |
| 330 | 3300025972 | Ga0207668_10079935 | Ga0207668_100799353 | 109 |
| 331 | 3300025972 | Ga0207668_11636581 | Ga0207668_116365812 | 109 |
| 332 | 3300026035 | Ga0207703_11320044 | Ga0207703_113200441 | 109 |
| 333 | 3300026095 | Ga0207676_11128580 | Ga0207676_111285801 | 109 |
| 334 | 3300026116 | Ga0207674_10313265 | Ga0207674_103132652 | 109 |
| 335 | 3300026116 | Ga0207674_10840815 | Ga0207674_108408151 | 109 |
| 336 | 3300026118 | Ga0207675_100014309 | Ga0207675_1000143093 | 109 |
| 337 | 3300026118 | Ga0207675_100717469 | Ga0207675_1007174691 | 109 |
| 338 | 3300026121 | Ga0207683_10088453 | Ga0207683_100884533 | 109 |
| 339 | 3300027111 | Ga0209281_1000134 | Ga0209281_100013430 | 109 |
| 340 | 3300027512 | Ga0209179_1004773 | Ga0209179_10047735 | 109 |
| 341 | 3300027666 | Ga0209282_1000013 | Ga0209282_10000134 | 109 |
| 342 | 3300027671 | Ga0209588_1064150 | Ga0209588_10641502 | 109 |
| 343 | 3300027717 | Ga0209998_10059000 | Ga0209998_100590002 | 109 |
| 344 | 3300027876 | Ga0209974_10003650 | Ga0209974_100036504 | 109 |
| 345 | 3300027907 | Ga0207428_10000096 | Ga0207428_1000009617 | 109 |
| 346 | 3300027907 | Ga0207428_10500653 | Ga0207428_105006531 | 109 |
| 347 | 3300028379 | Ga0268266_10000051 | Ga0268266_10000051152 | 109 |
| 348 | 3300028380 | Ga0268265_10172519 | Ga0268265_101725193 | 109 |
| 349 | 3300028380 | Ga0268265_11122688 | Ga0268265_111226882 | 109 |
| 350 | 3300028381 | Ga0268264_10541884 | Ga0268264_105418842 | 109 |
| 351 | 3300028786 | Ga0307517_10289394 | Ga0307517_102893942 | 109 |
| 352 | 3300028794 | Ga0307515_10005291 | Ga0307515_1000529117 | 109 |
| 353 | 3300028794 | Ga0307515_10048367 | Ga0307515_100483676 | 109 |
| 354 | 3300028794 | Ga0307515_10097511 | Ga0307515_100975113 | 109 |
| 355 | 3300028794 | Ga0307515_10371254 | Ga0307515_103712542 | 109 |
| 356 | 3300030522 | Ga0307512_10449855 | Ga0307512_104498551 | 109 |
| 357 | 3300031456 | Ga0307513_10004959 | Ga0307513_1000495910 | 109 |
| 358 | 3300031456 | Ga0307513_10008740 | Ga0307513_1000874011 | 109 |
| 359 | 3300031456 | Ga0307513_10023597 | Ga0307513_100235976 | 109 |
| 360 | 3300031456 | Ga0307513_10630643 | Ga0307513_106306432 | 109 |
| 361 | 3300031507 | Ga0307509_10000008 | Ga0307509_1000000820 | 109 |
| 362 | 3300031548 | Ga0307408_100502098 | Ga0307408_1005020982 | 109 |
| 363 | 3300031548 | Ga0307408_100636626 | Ga0307408_1006366263 | 109 |
| 364 | 3300031616 | Ga0307508_10761986 | Ga0307508_107619862 | 109 |
| 365 | 3300031649 | Ga0307514_10493317 | Ga0307514_104933171 | 109 |
| 366 | 3300031730 | Ga0307516_10011416 | Ga0307516_100114163 | 109 |
| 367 | 3300031730 | Ga0307516_10014057 | Ga0307516_100140577 | 109 |
| 368 | 3300031730 | Ga0307516_10106482 | Ga0307516_101064822 | 109 |
| 369 | 3300031730 | Ga0307516_10848554 | Ga0307516_108485542 | 109 |
| 370 | 3300031824 | Ga0307413_11584061 | Ga0307413_115840612 | 109 |
| 371 | 3300031852 | Ga0307410_11445997 | Ga0307410_114459972 | 109 |
| 372 | 3300031967 | Ga0315914_1000004 | Ga0315914_100000439 | 109 |
| 373 | 3300031995 | Ga0307409_100207807 | Ga0307409_1002078073 | 109 |
| 374 | 3300031995 | Ga0307409_101503347 | Ga0307409_1015033472 | 109 |
| 375 | 3300032002 | Ga0307416_101061083 | Ga0307416_1010610831 | 109 |
| 376 | 3300032004 | Ga0307414_10533009 | Ga0307414_105330092 | 109 |
| 377 | 3300032005 | Ga0307411_10066715 | Ga0307411_100667151 | 109 |
| 378 | 3300032005 | Ga0307411_11256555 | Ga0307411_112565552 | 109 |
| 379 | 3300033180 | Ga0307510_10004361 | Ga0307510_100043616 | 109 |
| 380 | 3300033430 | Ga0315913_1008800 | Ga0315913_100880014 | 109 |
| 381 | 3300033464 | Ga0315915_1000003 | Ga0315915_1000003146 | 109 |
| 382 | 3300035113 | Ga0373936_0089938 | Ga0373936_0089938_857_1186 | 109 |
| 383 | 3300035172 | Ga0373955_0701424 | Ga0373955_0701424_157_492 | 109 |
| 384 | 3300036401 | Ga0373937_1841019 | Ga0373937_1841019_70_399 | 109 |
| 385 | 3300037068 | Ga0373925_0091442 | Ga0373925_0091442_1549_1878 | 109 |
| 386 | 3300039145 | Ga0237816_05962 | Ga0237816_05962_276_605 | 109 |
| 387 | 3300039438 | Ga0436360_1260730 | Ga0436360_1260730_3370_3699 | 109 |
| 388 | 3300041441 | Ga0451787_206899 | Ga0451787_206899_305_634 | 109 |
| 389 | 3300041443 | Ga0451789_1137576 | Ga0451789_1137576_99_428 | 109 |
| 390 | 3300041451 | Ga0451791_0250196 | Ga0451791_0250196_27_356 | 109 |
| 391 | 3300041451 | Ga0451791_0840209 | Ga0451791_0840209_194_523 | 109 |
| 392 | 3300041451 | Ga0451791_1103342 | Ga0451791_1103342_26_355 | 109 |
| 393 | 3300041452 | Ga0451793_1673673 | Ga0451793_1673673_466_795 | 109 |
| 394 | 3300041459 | Ga0451800_0954538 | Ga0451800_0954538_441_770 | 109 |
| 395 | 3300041460 | Ga0451802_0270859 | Ga0451802_0270859_827_1156 | 109 |
| 396 | 3300041486 | Ga0451807_2369701 | Ga0451807_2369701_106_435 | 109 |
| 397 | 3300041491 | Ga0451833_1488514 | Ga0451833_1488514_1033_1362 | 109 |
| 398 | 3300041496 | Ga0451839_0757778 | Ga0451839_0757778_192_521 | 109 |
| 399 | 3300041496 | Ga0451839_0799513 | Ga0451839_0799513_37_378 | 109 |
| 400 | 3300041501 | Ga0451845_0029820 | Ga0451845_0029820_315_644 | 109 |
| 401 | 3300041501 | Ga0451845_0773355 | Ga0451845_0773355_129_458 | 109 |
| 402 | 3300041503 | Ga0451847_0214195 | Ga0451847_0214195_645_974 | 109 |
| 403 | 3300041505 | Ga0451849_0122095 | Ga0451849_0122095_3199_3528 | 109 |
| 404 | 3300041505 | Ga0451849_0831447 | Ga0451849_0831447_228_557 | 109 |
| 405 | 3300041505 | Ga0451849_1567097 | Ga0451849_1567097_598_927 | 109 |
| 406 | 3300041511 | Ga0451855_2043013 | Ga0451855_2043013_181_510 | 109 |
| 407 | 3300041512 | Ga0451853_1004850 | Ga0451853_1004850_66_395 | 109 |
| 408 | 3300042004 | Ga0439445_0067643 | Ga0439445_0067643_146_475 | 109 |
| 409 | 3300042007 | Ga0439449_0111301 | Ga0439449_0111301_620_949 | 109 |
| 410 | 3300042010 | Ga0439452_056552 | Ga0439452_056552_544_873 | 109 |
| 411 | 3300042156 | Ga0439446_0002554 | Ga0439446_0002554_1727_2056 | 109 |
| 412 | 3300044765 | Ga0466970_0426283 | Ga0466970_0426283_100_429 | 109 |
| 413 | 3300046453 | Ga0495627_000407 | Ga0495627_000407_23506_23835 | 109 |
| 414 | 3300046459 | Ga0495629_0009289 | Ga0495629_0009289_2592_2921 | 109 |
| 415 | 3300046460 | Ga0495638_0001482 | Ga0495638_0001482_15714_16043 | 109 |
| 416 | 3300046460 | Ga0495638_0003450 | Ga0495638_0003450_2704_3033 | 109 |
| 417 | 3300046460 | Ga0495638_0453387 | Ga0495638_0453387_38_367 | 109 |
| 418 | 3300046471 | Ga0495650_0000027 | Ga0495650_0000027_193139_193480 | 109 |
| 419 | 3300046471 | Ga0495650_0000068 | Ga0495650_0000068_235596_235925 | 109 |
| 420 | 3300046474 | Ga0495605_0053760 | Ga0495605_0053760_977_1306 | 109 |
| 421 | 3300046474 | Ga0495605_0093565 | Ga0495605_0093565_480_809 | 109 |
| 422 | 3300046491 | Ga0495584_0014383 | Ga0495584_0014383_609_938 | 109 |
| 423 | 3300046491 | Ga0495584_0706464 | Ga0495584_0706464_49_378 | 109 |
| 424 | 3300046492 | Ga0495585_0029125 | Ga0495585_0029125_2791_3120 | 109 |
| 425 | 3300046492 | Ga0495585_0387033 | Ga0495585_0387033_301_630 | 109 |
| 426 | 3300046500 | Ga0495596_0002870 | Ga0495596_0002870_1217_1546 | 109 |
| 427 | 3300046500 | Ga0495596_0088067 | Ga0495596_0088067_562_891 | 109 |
| 428 | 3300046501 | Ga0495607_0058618 | Ga0495607_0058618_31_360 | 109 |
| 429 | 3300046507 | Ga0495606_0005676 | Ga0495606_0005676_3081_3410 | 109 |
| 430 | 3300046507 | Ga0495606_0088338 | Ga0495606_0088338_229_558 | 109 |
| 431 | 3300046507 | Ga0495606_0273977 | Ga0495606_0273977_291_620 | 109 |
| 432 | 3300046512 | Ga0495610_0000111 | Ga0495610_0000111_24266_24595 | 109 |
| 433 | 3300046512 | Ga0495610_0105993 | Ga0495610_0105993_238_567 | 109 |
| 434 | 3300046512 | Ga0495610_0108702 | Ga0495610_0108702_95_424 | 109 |
| 435 | 3300046513 | Ga0495616_0277065 | Ga0495616_0277065_41_370 | 109 |
| 436 | 3300046515 | Ga0495620_0027728 | Ga0495620_0027728_2226_2555 | 109 |
| 437 | 3300046515 | Ga0495620_0029571 | Ga0495620_0029571_874_1203 | 109 |
| 438 | 3300046515 | Ga0495620_0204601 | Ga0495620_0204601_34_363 | 109 |
| 439 | 3300046515 | Ga0495620_0246868 | Ga0495620_0246868_51_380 | 109 |
| 440 | 3300046515 | Ga0495620_0356979 | Ga0495620_0356979_180_509 | 109 |
| 441 | 3300046518 | Ga0495631_0025231 | Ga0495631_0025231_1094_1423 | 109 |
| 442 | 3300046518 | Ga0495631_0094180 | Ga0495631_0094180_278_607 | 109 |
| 443 | 3300046518 | Ga0495631_0261887 | Ga0495631_0261887_332_661 | 109 |
| 444 | 3300046518 | Ga0495631_0408511 | Ga0495631_0408511_47_376 | 109 |
| 445 | 3300046519 | Ga0495632_0075564 | Ga0495632_0075564_1138_1467 | 109 |
| 446 | 3300046520 | Ga0495637_0039480 | Ga0495637_0039480_318_650 | 109 |
| 447 | 3300046522 | Ga0495643_0021433 | Ga0495643_0021433_878_1207 | 109 |
| 448 | 3300046522 | Ga0495643_0023670 | Ga0495643_0023670_2119_2448 | 109 |
| 449 | 3300046522 | Ga0495643_0086517 | Ga0495643_0086517_35_364 | 109 |
| 450 | 3300046522 | Ga0495643_0104390 | Ga0495643_0104390_613_942 | 109 |
| 451 | 3300046522 | Ga0495643_0176128 | Ga0495643_0176128_404_733 | 109 |
| 452 | 3300046522 | Ga0495643_0294009 | Ga0495643_0294009_262_597 | 109 |
| 453 | 3300046522 | Ga0495643_0522782 | Ga0495643_0522782_79_408 | 109 |
| 454 | 3300046523 | Ga0495644_0030514 | Ga0495644_0030514_234_563 | 109 |
| 455 | 3300046524 | Ga0495648_0331386 | Ga0495648_0331386_134_463 | 109 |
| 456 | 3300046525 | Ga0495663_0065808 | Ga0495663_0065808_56_385 | 109 |
| 457 | 3300046528 | Ga0495642_0244600 | Ga0495642_0244600_330_659 | 109 |
| 458 | 3300046529 | Ga0495652_0983122 | Ga0495652_0983122_55_384 | 109 |
| 459 | 3300046530 | Ga0495654_0000051 | Ga0495654_0000051_114822_115151 | 109 |
| 460 | 3300046530 | Ga0495654_0220588 | Ga0495654_0220588_190_519 | 109 |
| 461 | 3300046538 | Ga0495609_0002341 | Ga0495609_0002341_2808_3137 | 109 |
| 462 | 3300046539 | Ga0495621_0227270 | Ga0495621_0227270_355_684 | 109 |
| 463 | 3300046542 | Ga0495597_0172065 | Ga0495597_0172065_30_359 | 109 |
| 464 | 3300046557 | Ga0495622_0037936 | Ga0495622_0037936_459_788 | 109 |
| 465 | 3300046557 | Ga0495622_0145140 | Ga0495622_0145140_542_871 | 109 |
| 466 | 3300046558 | Ga0495633_0053268 | Ga0495633_0053268_362_691 | 109 |
| 467 | 3300046558 | Ga0495633_0059309 | Ga0495633_0059309_214_543 | 109 |
| 468 | 3300046615 | Ga0495656_0011297 | Ga0495656_0011297_321_650 | 109 |
| 469 | 3300046616 | Ga0495668_0264943 | Ga0495668_0264943_158_487 | 109 |
| 470 | 3300046616 | Ga0495668_0661646 | Ga0495668_0661646_186_515 | 109 |
| 471 | 3300046648 | Ga0495611_0013215 | Ga0495611_0013215_1496_1825 | 109 |
| 472 | 3300046660 | Ga0495625_0014131 | Ga0495625_0014131_5966_6295 | 109 |
| 473 | 3300046660 | Ga0495625_0078069 | Ga0495625_0078069_332_661 | 109 |
| 474 | 3300046660 | Ga0495625_0080911 | Ga0495625_0080911_293_622 | 109 |
| 475 | 3300046660 | Ga0495625_0099729 | Ga0495625_0099729_392_721 | 109 |
| 476 | 3300046660 | Ga0495625_0222795 | Ga0495625_0222795_656_985 | 109 |
| 477 | 3300046660 | Ga0495625_0483051 | Ga0495625_0483051_276_605 | 109 |
| 478 | 3300046663 | Ga0495635_0633388 | Ga0495635_0633388_51_380 | 109 |
| 479 | 3300046664 | Ga0495659_0083916 | Ga0495659_0083916_393_722 | 109 |
| 480 | 3300046664 | Ga0495659_0421969 | Ga0495659_0421969_48_377 | 109 |
| 481 | 3300046665 | Ga0495661_0095093 | Ga0495661_0095093_309_638 | 109 |
| 482 | 3300046665 | Ga0495661_0125187 | Ga0495661_0125187_787_1116 | 109 |
| 483 | 3300046674 | Ga0495588_0024755 | Ga0495588_0024755_327_656 | 109 |
| 484 | 3300046690 | Ga0495624_0194317 | Ga0495624_0194317_515_844 | 109 |
| 485 | 3300046691 | Ga0495670_0077140 | Ga0495670_0077140_429_758 | 109 |
| 486 | 3300046691 | Ga0495670_0378776 | Ga0495670_0378776_32_361 | 109 |
| 487 | 3300046692 | Ga0495671_0230892 | Ga0495671_0230892_207_536 | 109 |
| 488 | 3300046692 | Ga0495671_0590848 | Ga0495671_0590848_166_495 | 109 |
| 489 | 3300046694 | Ga0495649_0319192 | Ga0495649_0319192_19_348 | 109 |
| 490 | 3300046694 | Ga0495649_0375567 | Ga0495649_0375567_26_355 | 109 |
| 491 | 3300046794 | Ga0495589_0013549 | Ga0495589_0013549_2741_3070 | 109 |
| 492 | 3300046794 | Ga0495589_0020332 | Ga0495589_0020332_1286_1615 | 109 |
| 493 | 3300046794 | Ga0495589_0058705 | Ga0495589_0058705_864_1193 | 109 |
| 494 | 3300046794 | Ga0495589_0563997 | Ga0495589_0563997_22_351 | 109 |
| 495 | 3300046809 | Ga0495600_0045733 | Ga0495600_0045733_926_1255 | 109 |
| 496 | 3300046810 | Ga0495660_0258695 | Ga0495660_0258695_306_635 | 109 |
| 497 | 3300047318 | Ga0495636_0049141 | Ga0495636_0049141_799_1128 | 109 |
| 498 | 3300047320 | Ga0495672_0010003 | Ga0495672_0010003_4153_4482 | 109 |
| 499 | 3300047320 | Ga0495672_0042238 | Ga0495672_0042238_1686_2021 | 109 |
| 500 | 3300047320 | Ga0495672_0056243 | Ga0495672_0056243_1255_1584 | 109 |
| 501 | 3300047320 | Ga0495672_0226920 | Ga0495672_0226920_549_878 | 109 |
| 502 | 3300047443 | Ga0495687_157183 | Ga0495687_157183_40_369 | 109 |
| 503 | 3300047445 | Ga0495677_0016610 | Ga0495677_0016610_1108_1437 | 109 |
| 504 | 3300047469 | Ga0495673_0000091 | Ga0495673_0000091_158374_158703 | 109 |
| 505 | 3300047469 | Ga0495673_0008898 | Ga0495673_0008898_3901_4230 | 109 |
| 506 | 3300047470 | Ga0495681_0092893 | Ga0495681_0092893_838_1167 | 109 |
| 507 | 3300047470 | Ga0495681_0277828 | Ga0495681_0277828_106_435 | 109 |
| 508 | 3300047472 | Ga0495686_0023057 | Ga0495686_0023057_2362_2694 | 109 |
| 509 | 3300047472 | Ga0495686_0175496 | Ga0495686_0175496_580_909 | 109 |
| 510 | 3300047472 | Ga0495686_0180678 | Ga0495686_0180678_353_682 | 109 |
| 511 | 3300047472 | Ga0495686_0363682 | Ga0495686_0363682_202_531 | 109 |
| 512 | 3300048091 | Ga0495626_0007371 | Ga0495626_0007371_4899_5228 | 109 |
| 513 | 3300048091 | Ga0495626_0049928 | Ga0495626_0049928_1171_1500 | 109 |
| 514 | 3300048905 | Ga0496102_0629566 | Ga0496102_0629566_56_385 | 109 |
| 515 | 3300048917 | Ga0496114_1155747 | Ga0496114_1155747_93_422 | 109 |
| 516 | 3300048918 | Ga0496115_0017368 | Ga0496115_0017368_4758_5087 | 109 |
| 517 | 3300048918 | Ga0496115_0037006 | Ga0496115_0037006_1296_1625 | 109 |
| 518 | 3300048923 | Ga0496120_0126705 | Ga0496120_0126705_433_762 | 109 |
| 519 | 3300048924 | Ga0496121_0111863 | Ga0496121_0111863_1018_1347 | 109 |
| 520 | 3300048928 | Ga0496125_0052011 | Ga0496125_0052011_43_372 | 109 |
| 521 | 3300048929 | Ga0496126_0222599 | Ga0496126_0222599_312_641 | 109 |
| 522 | 3300049571 | Ga0501034_1262481 | Ga0501034_1262481_203_547 | 109 |
| 523 | 3300049573 | Ga0501037_0586263 | Ga0501037_0586263_337_681 | 109 |
| 524 | 3300049581 | Ga0501047_0014401 | Ga0501047_0014401_1357_1701 | 109 |
| 525 | 3300049583 | Ga0501067_0307052 | Ga0501067_0307052_517_861 | 109 |
| 526 | 3300049585 | Ga0501069_0246570 | Ga0501069_0246570_499_843 | 109 |
| 527 | 3300049589 | Ga0501073_0070304 | Ga0501073_0070304_1022_1366 | 109 |
| 528 | 3300049703 | Ga0501219_008463 | Ga0501219_008463_273_602 | 109 |
| 529 | 3300049705 | Ga0501225_0099242 | Ga0501225_0099242_492_821 | 109 |
| 530 | 3300049742 | Ga0501080_0043020 | Ga0501080_0043020_1480_1824 | 109 |
| 531 | 3300049744 | Ga0501083_0029947 | Ga0501083_0029947_2045_2389 | 109 |
| 532 | 3300049823 | Ga0501044_0279489 | Ga0501044_0279489_61_405 | 109 |
| 533 | 3300050489 | nmdc:mga03683_178746_c1 | nmdc:mga03683_178746_c1_420_749 | 109 |
| 534 | 3300050489 | nmdc:mga03683_249769_c1 | nmdc:mga03683_249769_c1_349_678 | 109 |
| 535 | 3300050489 | nmdc:mga03683_354154_c1 | nmdc:mga03683_354154_c1_351_680 | 109 |
| 536 | 3300050490 | nmdc:mga03n38_243577_c1 | nmdc:mga03n38_243577_c1_44_373 | 109 |
| 537 | 3300050491 | nmdc:mga00v17_686255_c1 | nmdc:mga00v17_686255_c1_300_629 | 109 |
| 538 | 3300050492 | nmdc:mga0yw44_179788_c1 | nmdc:mga0yw44_179788_c1_606_935 | 109 |
| 539 | 3300050492 | nmdc:mga0yw44_273792_c1 | nmdc:mga0yw44_273792_c1_745_1083 | 109 |
| 540 | 3300050492 | nmdc:mga0yw44_98505_c1 | nmdc:mga0yw44_98505_c1_605_934 | 109 |
| 541 | 3300050493 | nmdc:mga0k408_160611_c1 | nmdc:mga0k408_160611_c1_136_465 | 109 |
| 542 | 3300050493 | nmdc:mga0k408_272633_c1 | nmdc:mga0k408_272633_c1_445_774 | 109 |
| 543 | 3300050493 | nmdc:mga0k408_276849_c1 | nmdc:mga0k408_276849_c1_337_666 | 109 |
| 544 | 3300050493 | nmdc:mga0k408_67114_c1 | nmdc:mga0k408_67114_c1_1564_1893 | 109 |
| 545 | 3300050493 | nmdc:mga0k408_91122_c1 | nmdc:mga0k408_91122_c1_394_723 | 109 |
| 546 | 3300050494 | nmdc:mga06z11_568770_c1 | nmdc:mga06z11_568770_c1_238_567 | 109 |
| 547 | 3300050496 | nmdc:mga07m45_301529_c1 | nmdc:mga07m45_301529_c1_299_628 | 109 |
| 548 | 3300050496 | nmdc:mga07m45_359509_c1 | nmdc:mga07m45_359509_c1_484_813 | 109 |
| 549 | 3300050496 | nmdc:mga07m45_45342_c1 | nmdc:mga07m45_45342_c1_1504_1833 | 109 |
| 550 | 3300050496 | nmdc:mga07m45_612147_c1 | nmdc:mga07m45_612147_c1_167_496 | 109 |
| 551 | 3300050507 | nmdc:mga05p37_1796307_c1 | nmdc:mga05p37_1796307_c1_49_378 | 109 |
| 552 | 3300050509 | nmdc:mga0qj67_622586_c1 | nmdc:mga0qj67_622586_c1_481_810 | 109 |
| 553 | 3300050510 | nmdc:mga06r32_588782_c1 | nmdc:mga06r32_588782_c1_708_1037 | 109 |
| 554 | 3300050511 | nmdc:mga08y16_62_c1 | nmdc:mga08y16_62_c1_32840_33169 | 109 |
| 555 | 3300050511 | nmdc:mga08y16_656325_c1 | nmdc:mga08y16_656325_c1_232_561 | 109 |
| 556 | 3300050511 | nmdc:mga08y16_922451_c1 | nmdc:mga08y16_922451_c1_460_789 | 109 |
| 557 | 3300050515 | nmdc:mga0a205_1187039_c1 | nmdc:mga0a205_1187039_c1_160_489 | 109 |
| 558 | 3300050516 | nmdc:mga0sz30_198887_c1 | nmdc:mga0sz30_198887_c1_122_451 | 109 |
| 559 | 3300053079 | Ga0500610_0002738 | Ga0500610_0002738_3453_3785 | 109 |
| 560 | 3300053083 | Ga0495655_0275306 | Ga0495655_0275306_175_504 | 109 |
| 561 | 3300053086 | Ga0500578_0771256 | Ga0500578_0771256_130_459 | 109 |
| 562 | 3300053087 | Ga0500643_019214 | Ga0500643_019214_264_593 | 109 |
| 563 | 3300053088 | Ga0500644_0282582 | Ga0500644_0282582_246_575 | 109 |
| 564 | 3300053090 | Ga0500646_0023676 | Ga0500646_0023676_944_1273 | 109 |
| 565 | 3300053090 | Ga0500646_0069364 | Ga0500646_0069364_315_644 | 109 |
| 566 | 3300053090 | Ga0500646_0161947 | Ga0500646_0161947_319_648 | 109 |
| 567 | 3300053094 | Ga0500566_0005190 | Ga0500566_0005190_321_650 | 109 |
| 568 | 3300053098 | Ga0500650_0192214 | Ga0500650_0192214_443_772 | 109 |
| 569 | 3300053098 | Ga0500650_0305895 | Ga0500650_0305895_46_375 | 109 |
| 570 | 3300053103 | Ga0500555_174956 | Ga0500555_174956_111_440 | 109 |
| 571 | 3300053104 | Ga0500556_0001096 | Ga0500556_0001096_4270_4602 | 109 |
| 572 | 3300053108 | Ga0500562_016324 | Ga0500562_016324_657_986 | 109 |
| 573 | 3300053108 | Ga0500562_034602 | Ga0500562_034602_51_380 | 109 |
| 574 | 3300053109 | Ga0500569_090839 | Ga0500569_090839_459_788 | 109 |
| 575 | 3300053118 | Ga0500594_0065146 | Ga0500594_0065146_670_999 | 109 |
| 576 | 3300053119 | Ga0500595_004320 | Ga0500595_004320_155_484 | 109 |
| 577 | 3300053123 | Ga0500614_095057 | Ga0500614_095057_192_521 | 109 |
| 578 | 3300053130 | Ga0500642_0030447 | Ga0500642_0030447_261_590 | 109 |
| 579 | 3300053133 | Ga0500655_121993 | Ga0500655_121993_190_519 | 109 |
| 580 | 3300053134 | Ga0500658_0000367 | Ga0500658_0000367_10701_11030 | 109 |
| 581 | 3300053134 | Ga0500658_0001583 | Ga0500658_0001583_7797_8126 | 109 |
| 582 | 3300053134 | Ga0500658_0035889 | Ga0500658_0035889_1583_1912 | 109 |
| 583 | 3300053134 | Ga0500658_0048739 | Ga0500658_0048739_1242_1571 | 109 |
| 584 | 3300053134 | Ga0500658_0053565 | Ga0500658_0053565_361_690 | 109 |
| 585 | 3300053139 | Ga0500568_0005567 | Ga0500568_0005567_2414_2743 | 109 |
| 586 | 3300053142 | Ga0500577_0013986 | Ga0500577_0013986_1648_1977 | 109 |
| 587 | 3300053142 | Ga0500577_0053937 | Ga0500577_0053937_701_1030 | 109 |
| 588 | 3300053146 | Ga0500588_0036503 | Ga0500588_0036503_970_1302 | 109 |
| 589 | 3300053148 | Ga0500590_000501 | Ga0500590_000501_7323_7652 | 109 |
| 590 | 3300053151 | Ga0500604_0003450 | Ga0500604_0003450_1451_1780 | 109 |
| 591 | 3300053151 | Ga0500604_0076081 | Ga0500604_0076081_726_1055 | 109 |
| 592 | 3300053151 | Ga0500604_0228427 | Ga0500604_0228427_233_562 | 109 |
| 593 | 3300053153 | Ga0500616_0008119 | Ga0500616_0008119_3683_4015 | 109 |
| 594 | 3300053153 | Ga0500616_0043193 | Ga0500616_0043193_328_657 | 109 |
| 595 | 3300053153 | Ga0500616_0055491 | Ga0500616_0055491_1306_1635 | 109 |
| 596 | 3300053153 | Ga0500616_0085793 | Ga0500616_0085793_940_1269 | 109 |
| 597 | 3300053156 | Ga0500622_0436837 | Ga0500622_0436837_71_400 | 109 |
| 598 | 3300053158 | Ga0500627_0014585 | Ga0500627_0014585_1720_2049 | 109 |
| 599 | 3300053158 | Ga0500627_0092263 | Ga0500627_0092263_873_1202 | 109 |
| 600 | 3300053161 | Ga0500634_0299346 | Ga0500634_0299346_155_484 | 109 |
| 601 | 3300053163 | Ga0500639_013853 | Ga0500639_013853_3397_3726 | 109 |
| 602 | 3300053727 | Ga0500611_006365 | Ga0500611_006365_346_675 | 109 |
| 603 | 3300053730 | Ga0500645_001569 | Ga0500645_001569_1714_2043 | 109 |
| 604 | 3300053730 | Ga0500645_038697 | Ga0500645_038697_735_1064 | 109 |
| 605 | 3300053730 | Ga0500645_103035 | Ga0500645_103035_229_558 | 109 |
| 606 | 3300053731 | Ga0500609_000896 | Ga0500609_000896_1692_2021 | 109 |
| 607 | 3300053739 | Ga0500587_000134 | Ga0500587_000134_5207_5536 | 109 |
| 608 | 3300059423 | Ga0590074_060023 | Ga0590074_060023_34_363 | 109 |
| 609 | 3300059424 | Ga0590075_034695 | Ga0590075_034695_511_840 | 109 |
| 610 | 3300059426 | Ga0590077_042502 | Ga0590077_042502_537_866 | 109 |
| 611 | 3300060353 | Ga0501082_0010091 | Ga0501082_0010091_7208_7552 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j05-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9312 | 3 | 87 |
| 3f6o-assembly1.cif.gz_B | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9239 | 6 | 94 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9196 | 4 | 91 |
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9178 | 19 | 75 |
| 3f6o-assembly1.cif.gz_A | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9064 | 1 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58793_245_317_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9343 | 12 | 74 | 1.10.10.10 |
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9285 | 4 | 86 | 1.10.10.10 |
| 3f6oB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9239 | 6 | 94 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9179 | 16 | 73 | 1.10.10.10 |
| 4awxB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9178 | 19 | 75 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G2IVA2-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9654 | 3 | 78 |
GO:0003700
|
| AF-A0A1B1NDG5-F1-model_v4 | Transcriptional regulator, ArsR family | 0.9629 | 10 | 89 |
GO:0003700
|
| AF-C1B651-F1-model_v4 | Putative ArsR family transcriptional regulator | 0.9623 | 3 | 89 |
GO:0003700
|
| AF-A0A3M1EE61-F1-model_v4 | Transcriptional regulator | 0.9619 | 4 | 79 |
GO:0003700
|
| AF-A0A1G2IGX9-F1-model_v4 | HTH arsR-type domain-containing protein | 0.9618 | 3 | 76 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar