F468896

General Info

Members Datasets Scaffolds Average Seq Length
609 270 1218 79

Family's Representative Sequence

Representative Sequence 3300042126|Ga0450888_044344|Ga0450888_044344_266_547
Length 93
Sequence MAQCEVCGNDYDKSFEVVAAGVRHTFDSFECAIHRLAPVCEHCGCKVIGHGVEVDGRFYCCAHCARESEHTDAIVDRVGPASAEGQASAGTAS

Samples

Sample ID Description Type Environment
1 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
93 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
220 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
221 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
246 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 3.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 1.15
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 15.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450888_044344 3300042126 Bacteria 625
2 rootL2_10065776 3300003322 Bacteria 1457
3 JGI25407J50210_10000502 3300003373 Bacteria 7853
4 JGI25407J50210_10000539 3300003373 Bacteria 7611
5 Ga0032354_1048817 3300003693 Unclassified 819
6 JGI25405J52794_10020209 3300003911 Bacteria 1340
7 Ga0065715_10123227 3300005293 Bacteria 2183
8 Ga0065715_10208362 3300005293 Bacteria 1326
9 Ga0065707_10457440 3300005295 Bacteria 794
10 Ga0065707_10492426 3300005295 Bacteria 764
11 Ga0070658_10623941 3300005327 Unclassified 935
12 Ga0070676_10089370 3300005328 Bacteria 1884
13 Ga0070676_10176393 3300005328 Bacteria 1386
14 Ga0070676_10270461 3300005328 Bacteria 1141
15 Ga0068869_100001302 3300005334 Bacteria 14765
16 Ga0068869_100264348 3300005334 Unclassified 1378
17 Ga0070666_10464267 3300005335 Unclassified 915
18 Ga0068868_100021222 3300005338 Bacteria 4890
19 Ga0068868_101169298 3300005338 Unclassified 710
20 Ga0070687_100142015 3300005343 Unclassified 1399
21 Ga0070692_10011761 3300005345 Bacteria 4029
22 Ga0070692_10740743 3300005345 Bacteria 665
23 Ga0070669_100113576 3300005353 Bacteria 2058
24 Ga0070674_100134591 3300005356 Bacteria 1847
25 Ga0070673_100019159 3300005364 Unclassified 4909
26 Ga0070673_100518273 3300005364 Bacteria 1080
27 Ga0070688_100001643 3300005365 Bacteria 11188
28 Ga0070688_100246131 3300005365 Bacteria 1271
29 Ga0070688_100720495 3300005365 Unclassified 774
30 Ga0070659_101057453 3300005366 Bacteria 714
31 Ga0070667_100251191 3300005367 Bacteria 1581
32 Ga0070667_100348483 3300005367 Bacteria 1340
33 Ga0070703_10226154 3300005406 Bacteria 747
34 Ga0070709_10000950 3300005434 Bacteria 16081
35 Ga0070713_100004720 3300005436 Bacteria 9210
36 Ga0070713_100639439 3300005436 Bacteria 1013
37 Ga0070710_10041249 3300005437 Bacteria 2547
38 Ga0070710_10091339 3300005437 Bacteria 1797
39 Ga0070710_10423432 3300005437 Bacteria 897
40 Ga0070711_100505785 3300005439 Bacteria 997
41 Ga0070705_100318430 3300005440 Bacteria 1122
42 Ga0070705_100871702 3300005440 Bacteria 722
43 Ga0070705_101668088 3300005440 Bacteria 538
44 Ga0070700_100524786 3300005441 Bacteria 915
45 Ga0070694_100173743 3300005444 Bacteria 1589
46 Ga0070694_101110578 3300005444 Bacteria 660
47 Ga0070708_100501792 3300005445 Bacteria 1145
48 Ga0070708_101956608 3300005445 Unclassified 543
49 Ga0070663_100124054 3300005455 Bacteria 1954
50 Ga0070663_100916641 3300005455 Unclassified 758
51 Ga0070662_100216744 3300005457 Bacteria 1525
52 Ga0070662_101150588 3300005457 Unclassified 666
53 Ga0068867_100437318 3300005459 Bacteria 1112
54 Ga0068867_101492399 3300005459 Bacteria 629
55 Ga0068867_101526078 3300005459 Bacteria 623
56 Ga0070685_10329948 3300005466 Bacteria 1037
57 Ga0070706_100021719 3300005467 Bacteria 5910
58 Ga0070706_100067968 3300005467 Bacteria 3295
59 Ga0070706_100608793 3300005467 Bacteria 1015
60 Ga0070706_102154131 3300005467 Unclassified 504
61 Ga0070707_100067591 3300005468 Bacteria 3438
62 Ga0070707_100316442 3300005468 Bacteria 1517
63 Ga0070707_100674157 3300005468 Bacteria 997
64 Ga0070707_101307164 3300005468 Bacteria 692
65 Ga0070698_100175188 3300005471 Bacteria 2084
66 Ga0070698_100268583 3300005471 Bacteria 1637
67 Ga0070698_100455805 3300005471 Unclassified 1215
68 Ga0070699_101395086 3300005518 Bacteria 643
69 Ga0068853_100932843 3300005539 Unclassified 834
70 Ga0070672_100168549 3300005543 Bacteria 1820
71 Ga0070672_100269985 3300005543 Unclassified 1436
72 Ga0070672_100754190 3300005543 Bacteria 854
73 Ga0070672_101122010 3300005543 Bacteria 699
74 Ga0070686_100019583 3300005544 Bacteria 3991
75 Ga0070686_100387639 3300005544 Unclassified 1059
76 Ga0070696_100002364 3300005546 Bacteria 12466
77 Ga0070696_100387880 3300005546 Bacteria 1090
78 Ga0070696_100690764 3300005546 Unclassified 831
79 Ga0070696_101884586 3300005546 Unclassified 518
80 Ga0070665_100494410 3300005548 Bacteria 1234
81 Ga0070704_100502200 3300005549 Bacteria 1052
82 Ga0070704_101018775 3300005549 Bacteria 749
83 Ga0070664_100235938 3300005564 Unclassified 1641
84 Ga0068857_100273696 3300005577 Bacteria 1552
85 Ga0068857_100467103 3300005577 Bacteria 1181
86 Ga0068857_100944647 3300005577 Bacteria 828
87 Ga0068857_101206545 3300005577 Unclassified 733
88 Ga0068854_101440476 3300005578 Unclassified 624
89 Ga0068856_100199372 3300005614 Bacteria 2016
90 Ga0070702_100650543 3300005615 Bacteria 797
91 Ga0070702_100825653 3300005615 Bacteria 719
92 Ga0068859_100054782 3300005617 Unclassified 4012
93 Ga0068864_100213421 3300005618 Unclassified 1778
94 Ga0068866_10598379 3300005718 Bacteria 744
95 Ga0068861_100022542 3300005719 Bacteria 4539
96 Ga0068861_100049923 3300005719 Bacteria 3170
97 Ga0068861_100064643 3300005719 Bacteria 2816
98 Ga0068861_100822977 3300005719 Unclassified 873
99 Ga0068870_10104192 3300005840 Unclassified 1609
100 Ga0068858_100365765 3300005842 Unclassified 1383
101 Ga0068860_102262187 3300005843 Unclassified 564
102 Ga0068862_100403391 3300005844 Unclassified 1279
103 Ga0081455_10004404 3300005937 Bacteria 15825
104 Ga0081455_10009266 3300005937 Bacteria 10140
105 Ga0081455_10014127 3300005937 Bacteria 7849
106 Ga0081455_10081355 3300005937 Bacteria 2652
107 Ga0081538_10000851 3300005981 Bacteria 32938
108 Ga0081538_10001047 3300005981 Bacteria 29464
109 Ga0081538_10002454 3300005981 Bacteria 18132
110 Ga0081538_10020651 3300005981 Bacteria 4837
111 Ga0081538_10025560 3300005981 Bacteria 4158
112 Ga0081538_10028346 3300005981 Bacteria 3853
113 Ga0081538_10122315 3300005981 Bacteria 1247
114 Ga0081538_10259672 3300005981 Bacteria 656
115 Ga0081538_10374069 3300005981 Bacteria 514
116 Ga0081539_10000577 3300005985 Bacteria 75437
117 Ga0081539_10330547 3300005985 Bacteria 646
118 Ga0070717_10504713 3300006028 Bacteria 1093
119 Ga0070717_10969322 3300006028 Bacteria 774
120 Ga0075365_10270568 3300006038 Bacteria 1195
121 Ga0070716_100004944 3300006173 Bacteria 6415
122 Ga0070712_100299407 3300006175 Bacteria 1301
123 Ga0070712_101046274 3300006175 Bacteria 707
124 Ga0070712_101730776 3300006175 Unclassified 547
125 Ga0097621_100665168 3300006237 Bacteria 957
126 Ga0068871_100502234 3300006358 Bacteria 1093
127 Ga0075428_100000074 3300006844 Bacteria 82188
128 Ga0075428_100071477 3300006844 Bacteria 3792
129 Ga0075428_100129597 3300006844 Bacteria 2744
130 Ga0075428_100314047 3300006844 Bacteria 1684
131 Ga0075428_100369997 3300006844 Bacteria 1537
132 Ga0075428_100463110 3300006844 Bacteria 1357
133 Ga0075428_101404156 3300006844 Unclassified 733
134 Ga0075430_100065230 3300006846 Bacteria 3059
135 Ga0075430_100108284 3300006846 Bacteria 2318
136 Ga0075430_100171404 3300006846 Bacteria 1806
137 Ga0075430_100628403 3300006846 Bacteria 886
138 Ga0075430_101207342 3300006846 Bacteria 622
139 Ga0075431_100005073 3300006847 Bacteria 12955
140 Ga0075431_100018635 3300006847 Bacteria 7072
141 Ga0075431_100036456 3300006847 Bacteria 5065
142 Ga0075431_100399741 3300006847 Bacteria 1375
143 Ga0075431_100492740 3300006847 Bacteria 1217
144 Ga0075431_101132645 3300006847 Bacteria 746
145 Ga0075431_101169617 3300006847 Bacteria 732
146 Ga0075433_10026274 3300006852 Bacteria 4928
147 Ga0075433_10098760 3300006852 Bacteria 2585
148 Ga0075433_10122303 3300006852 Bacteria 2312
149 Ga0075433_10199302 3300006852 Bacteria 1780
150 Ga0075433_10242928 3300006852 Unclassified 1598
151 Ga0075434_100043018 3300006871 Bacteria 4478
152 Ga0075434_100049764 3300006871 Bacteria 4162
153 Ga0075434_100093205 3300006871 Unclassified 3015
154 Ga0075434_100262282 3300006871 Bacteria 1747
155 Ga0075434_100318703 3300006871 Bacteria 1575
156 Ga0075429_100000048 3300006880 Bacteria 56393
157 Ga0075429_100027081 3300006880 Bacteria 4976
158 Ga0075429_100612752 3300006880 Unclassified 954
159 Ga0075429_100888005 3300006880 Bacteria 780
160 Ga0068865_100505664 3300006881 Bacteria 1008
161 Ga0075436_100041637 3300006914 Bacteria 3169
162 Ga0075436_100607222 3300006914 Unclassified 806
163 Ga0097620_100054786 3300006931 Unclassified 4012
164 Ga0075435_100023956 3300007076 Unclassified 4730
165 Ga0075435_100219525 3300007076 Bacteria 1614
166 Ga0099794_10492794 3300007265 Bacteria 645
167 Ga0105240_10423035 3300009093 Bacteria 1496
168 Ga0111539_10113950 3300009094 Bacteria 3171
169 Ga0111539_10296464 3300009094 Bacteria 1882
170 Ga0111539_10440736 3300009094 Unclassified 1517
171 Ga0111539_11756096 3300009094 Bacteria 719
172 Ga0114129_10002729 3300009147 Bacteria 24610
173 Ga0114129_10003209 3300009147 Bacteria 22944
174 Ga0114129_10012753 3300009147 Bacteria 11965
175 Ga0114129_10036764 3300009147 Bacteria 6914
176 Ga0114129_10126330 3300009147 Bacteria 3516
177 Ga0114129_10360268 3300009147 Bacteria 1924
178 Ga0114129_10675996 3300009147 Bacteria 1330
179 Ga0114129_11401197 3300009147 Bacteria 862
180 Ga0114129_12355728 3300009147 Bacteria 638
181 Ga0114129_12766700 3300009147 Bacteria 584
182 Ga0105248_10222582 3300009177 Unclassified 2124
183 Ga0105238_10622881 3300009551 Unclassified 1088
184 Ga0105028_144168 3300009993 Bacteria 503
185 Ga0157369_10108420 3300013105 Bacteria 2954
186 Ga0157369_10974507 3300013105 Bacteria 868
187 Ga0157372_10323385 3300013307 Unclassified 1796
188 Ga0157372_10581640 3300013307 Bacteria 1305
189 Ga0157372_11272339 3300013307 Bacteria 849
190 Ga0157375_10462141 3300013308 Bacteria 1435
191 Ga0157380_10327841 3300014326 Bacteria 1422
192 Ga0157380_12346060 3300014326 Bacteria 598
193 Ga0182008_10255893 3300014497 Unclassified 904
194 Ga0157377_10182243 3300014745 Bacteria 1321
195 Ga0197907_10181042 3300020069 Bacteria 2876
196 Ga0206356_10324674 3300020070 Bacteria 3402
197 Ga0206349_1779414 3300020075 Bacteria 3153
198 Ga0206355_1257662 3300020076 Bacteria 3109
199 Ga0206351_10057528 3300020077 Bacteria 3948
200 Ga0206351_10260176 3300020077 Bacteria 918
201 Ga0206352_10240047 3300020078 Bacteria 3347
202 Ga0206352_11037054 3300020078 Bacteria 534
203 Ga0206350_10043638 3300020080 Bacteria 593
204 Ga0206350_10060247 3300020080 Bacteria 4182
205 Ga0206354_10903893 3300020081 Bacteria 5471
206 Ga0206354_11312684 3300020081 Bacteria 547
207 Ga0206353_10884578 3300020082 Bacteria 3366
208 Ga0206353_12023038 3300020082 Bacteria 739
209 Ga0154015_1627718 3300020610 Bacteria 4023
210 Ga0213876_10073773 3300021384 Bacteria 1802
211 Ga0224712_10003826 3300022467 Bacteria 3973
212 Ga0224712_10656793 3300022467 Bacteria 514
213 Ga0207653_10183025 3300025885 Bacteria 784
214 Ga0207692_10077499 3300025898 Bacteria 1768
215 Ga0207692_10472451 3300025898 Unclassified 792
216 Ga0207688_10088292 3300025901 Bacteria 1778
217 Ga0207647_10731433 3300025904 Unclassified 537
218 Ga0207699_10007726 3300025906 Bacteria 5264
219 Ga0207699_10039948 3300025906 Bacteria 2700
220 Ga0207645_10163948 3300025907 Bacteria 1455
221 Ga0207645_10309695 3300025907 Bacteria 1052
222 Ga0207643_10082534 3300025908 Bacteria 1864
223 Ga0207684_10089163 3300025910 Bacteria 2628
224 Ga0207684_10189544 3300025910 Bacteria 1773
225 Ga0207684_11148013 3300025910 Bacteria 645
226 Ga0207684_11188704 3300025910 Unclassified 632
227 Ga0207707_10910544 3300025912 Bacteria 726
228 Ga0207695_10308985 3300025913 Unclassified 1471
229 Ga0207695_10659838 3300025913 Bacteria 927
230 Ga0207671_10127761 3300025914 Bacteria 1949
231 Ga0207693_10000160 3300025915 Bacteria 62687
232 Ga0207693_11286812 3300025915 Unclassified 548
233 Ga0207663_10094010 3300025916 Bacteria 1997
234 Ga0207663_10446156 3300025916 Bacteria 997
235 Ga0207662_10611481 3300025918 Unclassified 759
236 Ga0207652_10426197 3300025921 Bacteria 1196
237 Ga0207652_10807898 3300025921 Bacteria 832
238 Ga0207646_10180525 3300025922 Bacteria 1906
239 Ga0207646_11038818 3300025922 Unclassified 723
240 Ga0207646_11673368 3300025922 Bacteria 547
241 Ga0207681_10296193 3300025923 Bacteria 1279
242 Ga0207694_11745033 3300025924 Bacteria 523
243 Ga0207700_10013835 3300025928 Bacteria 5267
244 Ga0207664_10277286 3300025929 Bacteria 1470
245 Ga0207644_10439942 3300025931 Bacteria 1070
246 Ga0207690_10912084 3300025932 Bacteria 729
247 Ga0207706_10264998 3300025933 Unclassified 1500
248 Ga0207686_10091422 3300025934 Bacteria 2010
249 Ga0207670_10024241 3300025936 Bacteria 3790
250 Ga0207670_10465484 3300025936 Bacteria 1021
251 Ga0207670_10569427 3300025936 Bacteria 927
252 Ga0207670_10807295 3300025936 Bacteria 782
253 Ga0207669_10854360 3300025937 Bacteria 758
254 Ga0207704_10425253 3300025938 Bacteria 1054
255 Ga0207665_10006531 3300025939 Bacteria 7735
256 Ga0207665_10018977 3300025939 Bacteria 4517
257 Ga0207691_10203626 3300025940 Bacteria 1721
258 Ga0207691_10278816 3300025940 Unclassified 1438
259 Ga0207691_10596243 3300025940 Unclassified 935
260 Ga0207711_10221381 3300025941 Bacteria 1731
261 Ga0207711_10503365 3300025941 Bacteria 1129
262 Ga0207679_10157511 3300025945 Unclassified 1856
263 Ga0207651_10118526 3300025960 Unclassified 2002
264 Ga0207651_10543387 3300025960 Bacteria 1009
265 Ga0207651_10592361 3300025960 Unclassified 968
266 Ga0207712_11984347 3300025961 Bacteria 521
267 Ga0207668_12091021 3300025972 Unclassified 510
268 Ga0207640_10438204 3300025981 Bacteria 1074
269 Ga0207658_10229229 3300025986 Bacteria 1567
270 Ga0207658_11426763 3300025986 Unclassified 633
271 Ga0207677_10049797 3300026023 Bacteria 2829
272 Ga0207677_10082613 3300026023 Bacteria 2309
273 Ga0207677_10568779 3300026023 Bacteria 990
274 Ga0207677_11177841 3300026023 Unclassified 701
275 Ga0207703_10336215 3300026035 Unclassified 1387
276 Ga0207639_10855513 3300026041 Bacteria 849
277 Ga0207678_10115347 3300026067 Bacteria 2291
278 Ga0207678_10791812 3300026067 Archaea 837
279 Ga0207708_10579420 3300026075 Bacteria 949
280 Ga0207641_10542516 3300026088 Bacteria 1133
281 Ga0207641_12306087 3300026088 Unclassified 538
282 Ga0207648_10195879 3300026089 Bacteria 1791
283 Ga0207648_10198076 3300026089 Bacteria 1781
284 Ga0207648_10833182 3300026089 Bacteria 860
285 Ga0207648_12092139 3300026089 Bacteria 527
286 Ga0207676_10280413 3300026095 Bacteria 1513
287 Ga0207676_10450479 3300026095 Unclassified 1213
288 Ga0207676_11319511 3300026095 Bacteria 717
289 Ga0207674_10223013 3300026116 Bacteria 1833
290 Ga0207674_11482881 3300026116 Unclassified 647
291 Ga0207674_11709990 3300026116 Bacteria 597
292 Ga0207675_100026827 3300026118 Bacteria 5361
293 Ga0207675_100058718 3300026118 Bacteria 3590
294 Ga0207675_100064238 3300026118 Unclassified 3431
295 Ga0207698_11475114 3300026142 Unclassified 695
296 Ga0207428_10363322 3300027907 Bacteria 1064
297 Ga0207428_10699942 3300027907 Unclassified 725
298 Ga0268266_12364938 3300028379 Bacteria 502
299 Ga0268265_10460437 3300028380 Bacteria 1190
300 Ga0307513_10670928 3300031456 Bacteria 743
301 Ga0307408_100394475 3300031548 Bacteria 1187
302 Ga0307408_100471772 3300031548 Bacteria 1093
303 Ga0307408_100771113 3300031548 Bacteria 870
304 Ga0307408_101103354 3300031548 Bacteria 736
305 Ga0307405_10471525 3300031731 Bacteria 1000
306 Ga0307405_11776178 3300031731 Bacteria 548
307 Ga0307413_10277721 3300031824 Bacteria 1258
308 Ga0307410_10148888 3300031852 Bacteria 1740
309 Ga0307410_10325535 3300031852 Bacteria 1221
310 Ga0307406_11783622 3300031901 Bacteria 547
311 Ga0307407_10011159 3300031903 Bacteria 4265
312 Ga0307412_10074881 3300031911 Bacteria 2321
313 Ga0307409_100002443 3300031995 Bacteria 9714
314 Ga0307409_100136105 3300031995 Bacteria 2108
315 Ga0307409_100331181 3300031995 Bacteria 1429
316 Ga0307409_102181565 3300031995 Bacteria 583
317 Ga0307416_100234247 3300032002 Bacteria 1773
318 Ga0307416_100536576 3300032002 Bacteria 1241
319 Ga0307416_100930645 3300032002 Bacteria 970
320 Ga0307416_100978846 3300032002 Bacteria 948
321 Ga0307416_101821794 3300032002 Bacteria 712
322 Ga0307416_103224603 3300032002 Unclassified 546
323 Ga0307416_103468271 3300032002 Bacteria 528
324 Ga0307414_10400330 3300032004 Bacteria 1192
325 Ga0307414_12324846 3300032004 Bacteria 501
326 Ga0307411_11080341 3300032005 Bacteria 722
327 Ga0307411_12354661 3300032005 Bacteria 501
328 Ga0307415_100245415 3300032126 Bacteria 1451
329 Ga0307415_100819463 3300032126 Bacteria 851
330 Ga0307415_101604273 3300032126 Bacteria 625
331 Ga0373930_0068256 3300034816 Unclassified 804
332 Ga0373948_0096086 3300034817 Bacteria 693
333 Ga0373959_0003241 3300034820 Bacteria 2588
334 Ga0373934_0154959 3300035086 Unclassified 939
335 Ga0373940_0223895 3300035088 Unclassified 626
336 Ga0373939_0331369 3300035114 Unclassified 615
337 Ga0373941_0255535 3300035115 Unclassified 685
338 Ga0373956_0319455 3300035119 Unclassified 740
339 Ga0373960_0007367 3300035121 Bacteria 2605
340 Ga0373946_0759065 3300035171 Unclassified 509
341 Ga0373942_0037189 3300035207 Bacteria 1314
342 Ga0373961_0126647 3300035241 Bacteria 851
343 Ga0373962_0184622 3300035242 Bacteria 699
344 Ga0373935_0093914 3300035692 Bacteria 1968
345 Ga0373927_0142331 3300035695 Bacteria 1569
346 Ga0373927_0158455 3300035695 Unclassified 1483
347 Ga0373947_0149412 3300035725 Bacteria 1504
348 Ga0373947_0531793 3300035725 Bacteria 800
349 Ga0373947_0802223 3300035725 Unclassified 643
350 Ga0373937_0416095 3300036401 Bacteria 1276
351 Ga0373925_0054707 3300037068 Bacteria 2986
352 Ga0373925_0385959 3300037068 Unclassified 1141
353 Ga0395899_0051421 3300037312 Bacteria 3058
354 Ga0395899_0603674 3300037312 Bacteria 699
355 Ga0395899_0937538 3300037312 Bacteria 526
356 Ga0395900_0001945 3300037418 Bacteria 23361
357 Ga0395900_0141748 3300037418 Bacteria 2461
358 Ga0395900_0740518 3300037418 Bacteria 914
359 Ga0395898_0022379 3300037466 Bacteria 6401
360 Ga0395898_0978708 3300037466 Bacteria 782
361 Ga0395898_1186179 3300037466 Bacteria 695
362 Ga0395905_0009691 3300037471 Bacteria 9402
363 Ga0395905_0088107 3300037471 Bacteria 2910
364 Ga0395905_0295526 3300037471 Unclassified 1507
365 Ga0395901_0039986 3300038443 Bacteria 4854
366 Ga0395901_0328020 3300038443 Bacteria 1583
367 Ga0395901_0799750 3300038443 Bacteria 932
368 Ga0395901_1965662 3300038443 Bacteria 531
369 Ga0395901_1982879 3300038443 Bacteria 529
370 Ga0242420_013637 3300038996 Bacteria 1387
371 Ga0436365_1103046 3300039437 Bacteria 2714
372 Ga0451853_0873988 3300041512 Bacteria 866
373 Ga0439448_0053199 3300042005 Bacteria 1329
374 Ga0439450_014072 3300042008 Bacteria 1617
375 Ga0439451_112674 3300042009 Bacteria 552
376 Ga0439455_0018536 3300042012 Bacteria 1633
377 Ga0439463_001658 3300042016 Bacteria 5867
378 Ga0439435_0220162 3300042436 Bacteria 631
379 Ga0439464_0006224 3300042439 Bacteria 3106
380 Ga0439464_0007060 3300042439 Bacteria 2935
381 Ga0439460_0002450 3300042461 Bacteria 4475
382 Ga0439460_0229149 3300042461 Bacteria 638
383 Ga0450893_0064747 3300042532 Bacteria 703
384 Ga0439440_0219750 3300042993 Bacteria 569
385 Ga0453684_1344195 3300044712 Unclassified 743
386 Ga0451576_0223332 3300045051 Bacteria 1967
387 Ga0451576_1351254 3300045051 Unclassified 742
388 Ga0466967_0469262 3300045976 Bacteria 1232
389 Ga0466967_1341857 3300045976 Bacteria 712
390 Ga0495580_0142198 3300046472 Bacteria 1663
391 Ga0495605_0459173 3300046474 Unclassified 524
392 Ga0495584_0297495 3300046491 Bacteria 820
393 Ga0495618_0715821 3300046514 Bacteria 588
394 Ga0495586_0409752 3300046535 Bacteria 780
395 Ga0495587_0766626 3300046536 Bacteria 527
396 Ga0495658_0358781 3300046683 Bacteria 927
397 Ga0495669_0061830 3300046684 Unclassified 1695
398 Ga0496102_0671055 3300048905 Bacteria 960
399 Ga0496106_0836106 3300048909 Bacteria 729
400 Ga0496108_0488151 3300048911 Bacteria 1076
401 Ga0496109_0767555 3300048912 Bacteria 902
402 Ga0496112_0238531 3300048915 Bacteria 1771
403 Ga0496113_0072154 3300048916 Bacteria 2627
404 Ga0496114_0269541 3300048917 Bacteria 1500
405 Ga0496126_0513957 3300048929 Bacteria 955
406 Ga0501291_090982 3300049514 Bacteria 623
407 Ga0501295_151962 3300049518 Bacteria 572
408 Ga0501325_055157 3300049541 Unclassified 514
409 Ga0501031_0086583 3300049568 Bacteria 2043
410 Ga0501031_0156420 3300049568 Bacteria 1490
411 Ga0501031_0234481 3300049568 Bacteria 1194
412 Ga0501031_0248149 3300049568 Bacteria 1157
413 Ga0501032_0246111 3300049569 Bacteria 1161
414 Ga0501032_0269234 3300049569 Unclassified 1104
415 Ga0501032_0338348 3300049569 Bacteria 970
416 Ga0501032_0719989 3300049569 Bacteria 632
417 Ga0501033_0066708 3300049570 Bacteria 2646
418 Ga0501033_0131606 3300049570 Bacteria 1812
419 Ga0501033_0336824 3300049570 Bacteria 1058
420 Ga0501033_0441066 3300049570 Bacteria 905
421 Ga0501033_0500464 3300049570 Bacteria 841
422 Ga0501036_0027656 3300049572 Bacteria 4793
423 Ga0501036_0039448 3300049572 Bacteria 3996
424 Ga0501036_0251467 3300049572 Bacteria 1481
425 Ga0501036_0352803 3300049572 Bacteria 1228
426 Ga0501036_0398694 3300049572 Bacteria 1148
427 Ga0501036_1456389 3300049572 Bacteria 554
428 Ga0501037_0099978 3300049573 Bacteria 2095
429 Ga0501037_0212069 3300049573 Bacteria 1365
430 Ga0501037_0721315 3300049573 Bacteria 662
431 Ga0501037_0930769 3300049573 Bacteria 569
432 Ga0501038_0011615 3300049574 Bacteria 8034
433 Ga0501038_0101642 3300049574 Bacteria 2393
434 Ga0501038_0117861 3300049574 Bacteria 2193
435 Ga0501038_0129248 3300049574 Bacteria 2076
436 Ga0501039_0024103 3300049575 Bacteria 4672
437 Ga0501039_0108812 3300049575 Bacteria 2166
438 Ga0501039_0423827 3300049575 Bacteria 1045
439 Ga0501039_0807142 3300049575 Bacteria 732
440 Ga0501039_0871116 3300049575 Bacteria 701
441 Ga0501039_0985213 3300049575 Bacteria 655
442 Ga0501040_0007666 3300049576 Bacteria 6984
443 Ga0501040_0011604 3300049576 Bacteria 5767
444 Ga0501040_0041106 3300049576 Bacteria 3148
445 Ga0501040_0063257 3300049576 Bacteria 2546
446 Ga0501040_0211016 3300049576 Bacteria 1380
447 Ga0501040_0380794 3300049576 Bacteria 1012
448 Ga0501041_0002000 3300049577 Bacteria 11458
449 Ga0501041_0023660 3300049577 Bacteria 3683
450 Ga0501041_0069982 3300049577 Bacteria 2153
451 Ga0501041_0197276 3300049577 Bacteria 1261
452 Ga0501042_0039425 3300049578 Bacteria 3357
453 Ga0501042_0068701 3300049578 Bacteria 2534
454 Ga0501042_0131690 3300049578 Bacteria 1802
455 Ga0501042_0156345 3300049578 Bacteria 1644
456 Ga0501042_0246787 3300049578 Bacteria 1288
457 Ga0501042_0272545 3300049578 Bacteria 1222
458 Ga0501043_0129497 3300049579 Bacteria 1978
459 Ga0501043_0260539 3300049579 Bacteria 1334
460 Ga0501043_0278247 3300049579 Bacteria 1283
461 Ga0501043_0302372 3300049579 Bacteria 1222
462 Ga0501043_0449774 3300049579 Bacteria 968
463 Ga0501046_0003011 3300049580 Bacteria 15578
464 Ga0501046_0038306 3300049580 Bacteria 3849
465 Ga0501046_0263480 3300049580 Bacteria 1266
466 Ga0501047_1005545 3300049581 Bacteria 647
467 Ga0501048_0061025 3300049582 Bacteria 2671
468 Ga0501048_0081779 3300049582 Bacteria 2278
469 Ga0501048_0139939 3300049582 Bacteria 1711
470 Ga0501048_0173708 3300049582 Bacteria 1527
471 Ga0501048_0505602 3300049582 Bacteria 866
472 Ga0501048_0682720 3300049582 Bacteria 737
473 Ga0501068_0328281 3300049584 Bacteria 981
474 Ga0501070_1145978 3300049586 Unclassified 598
475 Ga0501071_0008821 3300049587 Bacteria 6683
476 Ga0501071_0023654 3300049587 Bacteria 4291
477 Ga0501071_0040256 3300049587 Bacteria 3344
478 Ga0501071_0066206 3300049587 Bacteria 2625
479 Ga0501071_0176715 3300049587 Bacteria 1599
480 Ga0501071_0299742 3300049587 Bacteria 1218
481 Ga0501071_0652316 3300049587 Unclassified 810
482 Ga0501071_1539444 3300049587 Bacteria 513
483 Ga0501072_0002649 3300049588 Bacteria 13413
484 Ga0501072_0022359 3300049588 Bacteria 4905
485 Ga0501072_0026752 3300049588 Bacteria 4500
486 Ga0501072_0036055 3300049588 Bacteria 3877
487 Ga0501072_0089484 3300049588 Bacteria 2443
488 Ga0501073_0430231 3300049589 Bacteria 912
489 Ga0501074_0059702 3300049590 Bacteria 2747
490 Ga0501074_0093844 3300049590 Bacteria 2149
491 Ga0501074_0292571 3300049590 Bacteria 1157
492 Ga0501074_0654029 3300049590 Bacteria 742
493 Ga0501075_0007782 3300049591 Bacteria 7439
494 Ga0501075_0067221 3300049591 Bacteria 2706
495 Ga0501075_0167301 3300049591 Bacteria 1677
496 Ga0501075_0191623 3300049591 Bacteria 1559
497 Ga0501075_0241683 3300049591 Bacteria 1376
498 Ga0501076_0018737 3300049592 Bacteria 5283
499 Ga0501076_0020634 3300049592 Bacteria 5044
500 Ga0501076_0367858 3300049592 Bacteria 1181
501 Ga0501076_0611061 3300049592 Bacteria 899
502 Ga0501077_0011150 3300049593 Bacteria 5608
503 Ga0501077_0091985 3300049593 Bacteria 1922
504 Ga0501077_0097972 3300049593 Bacteria 1858
505 Ga0501077_0102759 3300049593 Bacteria 1811
506 Ga0501077_0438346 3300049593 Bacteria 836
507 Ga0501259_052261 3300049688 Bacteria 833
508 Ga0501234_051114 3300049707 Bacteria 689
509 Ga0501079_0006224 3300049741 Bacteria 8960
510 Ga0501079_0007178 3300049741 Bacteria 8410
511 Ga0501079_0010849 3300049741 Bacteria 6939
512 Ga0501079_0031879 3300049741 Bacteria 4050
513 Ga0501079_0059296 3300049741 Bacteria 2952
514 Ga0501079_0161015 3300049741 Bacteria 1750
515 Ga0501079_0429012 3300049741 Bacteria 1038
516 Ga0501080_0020749 3300049742 Bacteria 6084
517 Ga0501080_0310221 3300049742 Bacteria 1430
518 Ga0501080_0339729 3300049742 Bacteria 1357
519 Ga0501081_0008238 3300049743 Bacteria 6767
520 Ga0501081_0016066 3300049743 Bacteria 4944
521 Ga0501081_0067267 3300049743 Bacteria 2493
522 Ga0501081_0277354 3300049743 Bacteria 1227
523 Ga0501081_0400897 3300049743 Bacteria 1015
524 Ga0501266_042682 3300049763 Bacteria 679
525 Ga0501035_0245893 3300049822 Bacteria 1520
526 Ga0501035_0253740 3300049822 Bacteria 1493
527 Ga0501035_1146482 3300049822 Bacteria 605
528 Ga0501044_0118320 3300049823 Bacteria 2653
529 Ga0501044_0721826 3300049823 Bacteria 881
530 Ga0501044_0752002 3300049823 Bacteria 857
531 Ga0501044_1066449 3300049823 Bacteria 678
532 Ga0501045_0029607 3300049824 Bacteria 3959
533 Ga0501045_0042390 3300049824 Bacteria 3312
534 Ga0501045_0077609 3300049824 Bacteria 2448
535 Ga0501045_0090210 3300049824 Bacteria 2264
536 Ga0501045_0106628 3300049824 Bacteria 2076
537 Ga0501045_0208551 3300049824 Bacteria 1455
538 nmdc:mga05p37_1198_c1 3300050507 Bacteria 29987
539 nmdc:mga05p37_214214_c1 3300050507 Bacteria 2327
540 nmdc:mga05p37_2157560_c1 3300050507 Unclassified 519
541 nmdc:mga05p37_455652_c1 3300050507 Bacteria 1479
542 nmdc:mga05p37_476048_c1 3300050507 Bacteria 1440
543 nmdc:mga05p37_48473_c1 3300050507 Bacteria 5224
544 nmdc:mga05p37_563983_c1 3300050507 Bacteria 1293
545 nmdc:mga05p37_71335_c1 3300050507 Bacteria 4273
546 nmdc:mga05p37_82569_c1 3300050507 Bacteria 761
547 nmdc:mga05p37_870645_c1 3300050507 Bacteria 976
548 nmdc:mga09592_30656_c1 3300050508 Bacteria 4475
549 nmdc:mga09592_45186_c1 3300050508 Bacteria 3709
550 nmdc:mga09592_507305_c1 3300050508 Bacteria 1038
551 nmdc:mga09592_565902_c1 3300050508 Bacteria 976
552 nmdc:mga09592_64682_c1 3300050508 Bacteria 3097
553 nmdc:mga09592_743534_c1 3300050508 Bacteria 833
554 nmdc:mga0qj67_60586_c1 3300050509 Bacteria 3004
555 nmdc:mga0qj67_66512_c1 3300050509 Bacteria 2871
556 nmdc:mga0qj67_81498_c1 3300050509 Bacteria 2594
557 nmdc:mga0qj67_87080_c1 3300050509 Bacteria 2506
558 nmdc:mga0qj67_888534_c1 3300050509 Bacteria 703
559 nmdc:mga06r32_101276_c1 3300050510 Bacteria 2827
560 nmdc:mga06r32_116036_c1 3300050510 Bacteria 2638
561 nmdc:mga06r32_1207125_c1 3300050510 Bacteria 703
562 nmdc:mga06r32_15915_c1 3300050510 Bacteria 6844
563 nmdc:mga06r32_17658_c1 3300050510 Bacteria 6517
564 nmdc:mga06r32_1788373_c1 3300050510 Unclassified 550
565 nmdc:mga06r32_2018986_c1 3300050510 Bacteria 510
566 nmdc:mga06r32_25744_c1 3300050510 Bacteria 5477
567 nmdc:mga06r32_385843_c1 3300050510 Bacteria 1383
568 nmdc:mga06r32_419697_c1 3300050510 Bacteria 1319
569 nmdc:mga08y16_228898_c1 3300050511 Bacteria 1923
570 nmdc:mga08y16_339034_c1 3300050511 Bacteria 1545
571 nmdc:mga08y16_484572_c1 3300050511 Unclassified 1258
572 nmdc:mga08y16_678366_c1 3300050511 Bacteria 1032
573 nmdc:mga0n895_1264608_c1 3300050512 Bacteria 710
574 nmdc:mga0n895_181339_c1 3300050512 Bacteria 2137
575 nmdc:mga0n895_25690_c1 3300050512 Bacteria 5569
576 nmdc:mga0n895_52495_c1 3300050512 Bacteria 4002
577 nmdc:mga0n895_88174_c1 3300050512 Unclassified 3102
578 nmdc:mga0rr50_203372_c1 3300050513 Bacteria 1628
579 nmdc:mga0rr50_52973_c1 3300050513 Unclassified 3017
580 nmdc:mga08x19_204959_c1 3300050514 Bacteria 1353
581 nmdc:mga08x19_333332_c1 3300050514 Bacteria 1057
582 nmdc:mga0a205_214175_c1 3300050515 Unclassified 1814
583 nmdc:mga0a205_292428_c1 3300050515 Bacteria 1503
584 nmdc:mga0a205_489752_c1 3300050515 Unclassified 1087
585 nmdc:mga0a205_61515_c1 3300050515 Bacteria 3627
586 nmdc:mga0a205_8360_c1 3300050515 Bacteria 9414
587 Ga0495601_0033720 3300053077 Bacteria 3191
588 Ga0495612_0564219 3300053078 Unclassified 525
589 Ga0495619_0334977 3300053085 Bacteria 1047
590 Ga0501084_0003483 3300054114 Bacteria 12785
591 Ga0501084_0007547 3300054114 Bacteria 8969
592 Ga0501084_0015371 3300054114 Bacteria 6345
593 Ga0501084_0029989 3300054114 Bacteria 4550
594 Ga0501084_0247892 3300054114 Bacteria 1504
595 Ga0590075_150548 3300059424 Bacteria 613
596 Ga0590077_125046 3300059426 Bacteria 609
597 Ga0501082_0019892 3300060353 Bacteria 5787
598 Ga0501082_0090971 3300060353 Bacteria 2635
599 Ga0501082_0104847 3300060353 Bacteria 2446
600 Ga0501082_0272712 3300060353 Bacteria 1472
601 Ga0501082_0275195 3300060353 Bacteria 1465
602 Ga0530510_0004189 3300061734 Bacteria 9965
603 Ga0530510_0013797 3300061734 Bacteria 5690
604 Ga0530510_0056863 3300061734 Bacteria 2827
605 Ga0530510_0060434 3300061734 Bacteria 2742
606 Ga0530510_0064930 3300061734 Bacteria 2644
607 Ga0530510_0158705 3300061734 Bacteria 1672
608 Ga0530510_0402293 3300061734 Bacteria 1032
609 Ga0530510_0425199 3300061734 Bacteria 1003
610 Ga0450888_044344
611 rootL2_10065776
612 JGI25407J50210_10000502
613 JGI25407J50210_10000539
614 Ga0032354_1048817
615 JGI25405J52794_10020209
616 Ga0065715_10123227
617 Ga0065715_10208362
618 Ga0065707_10457440
619 Ga0065707_10492426
620 Ga0070658_10623941
621 Ga0070676_10089370
622 Ga0070676_10176393
623 Ga0070676_10270461
624 Ga0068869_100001302
625 Ga0068869_100264348
626 Ga0070666_10464267
627 Ga0068868_100021222
628 Ga0068868_101169298
629 Ga0070687_100142015
630 Ga0070692_10011761
631 Ga0070692_10740743
632 Ga0070669_100113576
633 Ga0070674_100134591
634 Ga0070673_100019159
635 Ga0070673_100518273
636 Ga0070688_100001643
637 Ga0070688_100246131
638 Ga0070688_100720495
639 Ga0070659_101057453
640 Ga0070667_100251191
641 Ga0070667_100348483
642 Ga0070703_10226154
643 Ga0070709_10000950
644 Ga0070713_100004720
645 Ga0070713_100639439
646 Ga0070710_10041249
647 Ga0070710_10091339
648 Ga0070710_10423432
649 Ga0070711_100505785
650 Ga0070705_100318430
651 Ga0070705_100871702
652 Ga0070705_101668088
653 Ga0070700_100524786
654 Ga0070694_100173743
655 Ga0070694_101110578
656 Ga0070708_100501792
657 Ga0070708_101956608
658 Ga0070663_100124054
659 Ga0070663_100916641
660 Ga0070662_100216744
661 Ga0070662_101150588
662 Ga0068867_100437318
663 Ga0068867_101492399
664 Ga0068867_101526078
665 Ga0070685_10329948
666 Ga0070706_100021719
667 Ga0070706_100067968
668 Ga0070706_100608793
669 Ga0070706_102154131
670 Ga0070707_100067591
671 Ga0070707_100316442
672 Ga0070707_100674157
673 Ga0070707_101307164
674 Ga0070698_100175188
675 Ga0070698_100268583
676 Ga0070698_100455805
677 Ga0070699_101395086
678 Ga0068853_100932843
679 Ga0070672_100168549
680 Ga0070672_100269985
681 Ga0070672_100754190
682 Ga0070672_101122010
683 Ga0070686_100019583
684 Ga0070686_100387639
685 Ga0070696_100002364
686 Ga0070696_100387880
687 Ga0070696_100690764
688 Ga0070696_101884586
689 Ga0070665_100494410
690 Ga0070704_100502200
691 Ga0070704_101018775
692 Ga0070664_100235938
693 Ga0068857_100273696
694 Ga0068857_100467103
695 Ga0068857_100944647
696 Ga0068857_101206545
697 Ga0068854_101440476
698 Ga0068856_100199372
699 Ga0070702_100650543
700 Ga0070702_100825653
701 Ga0068859_100054782
702 Ga0068864_100213421
703 Ga0068866_10598379
704 Ga0068861_100022542
705 Ga0068861_100049923
706 Ga0068861_100064643
707 Ga0068861_100822977
708 Ga0068870_10104192
709 Ga0068858_100365765
710 Ga0068860_102262187
711 Ga0068862_100403391
712 Ga0081455_10004404
713 Ga0081455_10009266
714 Ga0081455_10014127
715 Ga0081455_10081355
716 Ga0081538_10000851
717 Ga0081538_10001047
718 Ga0081538_10002454
719 Ga0081538_10020651
720 Ga0081538_10025560
721 Ga0081538_10028346
722 Ga0081538_10122315
723 Ga0081538_10259672
724 Ga0081538_10374069
725 Ga0081539_10000577
726 Ga0081539_10330547
727 Ga0070717_10504713
728 Ga0070717_10969322
729 Ga0075365_10270568
730 Ga0070716_100004944
731 Ga0070712_100299407
732 Ga0070712_101046274
733 Ga0070712_101730776
734 Ga0097621_100665168
735 Ga0068871_100502234
736 Ga0075428_100000074
737 Ga0075428_100071477
738 Ga0075428_100129597
739 Ga0075428_100314047
740 Ga0075428_100369997
741 Ga0075428_100463110
742 Ga0075428_101404156
743 Ga0075430_100065230
744 Ga0075430_100108284
745 Ga0075430_100171404
746 Ga0075430_100628403
747 Ga0075430_101207342
748 Ga0075431_100005073
749 Ga0075431_100018635
750 Ga0075431_100036456
751 Ga0075431_100399741
752 Ga0075431_100492740
753 Ga0075431_101132645
754 Ga0075431_101169617
755 Ga0075433_10026274
756 Ga0075433_10098760
757 Ga0075433_10122303
758 Ga0075433_10199302
759 Ga0075433_10242928
760 Ga0075434_100043018
761 Ga0075434_100049764
762 Ga0075434_100093205
763 Ga0075434_100262282
764 Ga0075434_100318703
765 Ga0075429_100000048
766 Ga0075429_100027081
767 Ga0075429_100612752
768 Ga0075429_100888005
769 Ga0068865_100505664
770 Ga0075436_100041637
771 Ga0075436_100607222
772 Ga0097620_100054786
773 Ga0075435_100023956
774 Ga0075435_100219525
775 Ga0099794_10492794
776 Ga0105240_10423035
777 Ga0111539_10113950
778 Ga0111539_10296464
779 Ga0111539_10440736
780 Ga0111539_11756096
781 Ga0114129_10002729
782 Ga0114129_10003209
783 Ga0114129_10012753
784 Ga0114129_10036764
785 Ga0114129_10126330
786 Ga0114129_10360268
787 Ga0114129_10675996
788 Ga0114129_11401197
789 Ga0114129_12355728
790 Ga0114129_12766700
791 Ga0105248_10222582
792 Ga0105238_10622881
793 Ga0105028_144168
794 Ga0157369_10108420
795 Ga0157369_10974507
796 Ga0157372_10323385
797 Ga0157372_10581640
798 Ga0157372_11272339
799 Ga0157375_10462141
800 Ga0157380_10327841
801 Ga0157380_12346060
802 Ga0182008_10255893
803 Ga0157377_10182243
804 Ga0197907_10181042
805 Ga0206356_10324674
806 Ga0206349_1779414
807 Ga0206355_1257662
808 Ga0206351_10057528
809 Ga0206351_10260176
810 Ga0206352_10240047
811 Ga0206352_11037054
812 Ga0206350_10043638
813 Ga0206350_10060247
814 Ga0206354_10903893
815 Ga0206354_11312684
816 Ga0206353_10884578
817 Ga0206353_12023038
818 Ga0154015_1627718
819 Ga0213876_10073773
820 Ga0224712_10003826
821 Ga0224712_10656793
822 Ga0207653_10183025
823 Ga0207692_10077499
824 Ga0207692_10472451
825 Ga0207688_10088292
826 Ga0207647_10731433
827 Ga0207699_10007726
828 Ga0207699_10039948
829 Ga0207645_10163948
830 Ga0207645_10309695
831 Ga0207643_10082534
832 Ga0207684_10089163
833 Ga0207684_10189544
834 Ga0207684_11148013
835 Ga0207684_11188704
836 Ga0207707_10910544
837 Ga0207695_10308985
838 Ga0207695_10659838
839 Ga0207671_10127761
840 Ga0207693_10000160
841 Ga0207693_11286812
842 Ga0207663_10094010
843 Ga0207663_10446156
844 Ga0207662_10611481
845 Ga0207652_10426197
846 Ga0207652_10807898
847 Ga0207646_10180525
848 Ga0207646_11038818
849 Ga0207646_11673368
850 Ga0207681_10296193
851 Ga0207694_11745033
852 Ga0207700_10013835
853 Ga0207664_10277286
854 Ga0207644_10439942
855 Ga0207690_10912084
856 Ga0207706_10264998
857 Ga0207686_10091422
858 Ga0207670_10024241
859 Ga0207670_10465484
860 Ga0207670_10569427
861 Ga0207670_10807295
862 Ga0207669_10854360
863 Ga0207704_10425253
864 Ga0207665_10006531
865 Ga0207665_10018977
866 Ga0207691_10203626
867 Ga0207691_10278816
868 Ga0207691_10596243
869 Ga0207711_10221381
870 Ga0207711_10503365
871 Ga0207679_10157511
872 Ga0207651_10118526
873 Ga0207651_10543387
874 Ga0207651_10592361
875 Ga0207712_11984347
876 Ga0207668_12091021
877 Ga0207640_10438204
878 Ga0207658_10229229
879 Ga0207658_11426763
880 Ga0207677_10049797
881 Ga0207677_10082613
882 Ga0207677_10568779
883 Ga0207677_11177841
884 Ga0207703_10336215
885 Ga0207639_10855513
886 Ga0207678_10115347
887 Ga0207678_10791812
888 Ga0207708_10579420
889 Ga0207641_10542516
890 Ga0207641_12306087
891 Ga0207648_10195879
892 Ga0207648_10198076
893 Ga0207648_10833182
894 Ga0207648_12092139
895 Ga0207676_10280413
896 Ga0207676_10450479
897 Ga0207676_11319511
898 Ga0207674_10223013
899 Ga0207674_11482881
900 Ga0207674_11709990
901 Ga0207675_100026827
902 Ga0207675_100058718
903 Ga0207675_100064238
904 Ga0207698_11475114
905 Ga0207428_10363322
906 Ga0207428_10699942
907 Ga0268266_12364938
908 Ga0268265_10460437
909 Ga0307513_10670928
910 Ga0307408_100394475
911 Ga0307408_100471772
912 Ga0307408_100771113
913 Ga0307408_101103354
914 Ga0307405_10471525
915 Ga0307405_11776178
916 Ga0307413_10277721
917 Ga0307410_10148888
918 Ga0307410_10325535
919 Ga0307406_11783622
920 Ga0307407_10011159
921 Ga0307412_10074881
922 Ga0307409_100002443
923 Ga0307409_100136105
924 Ga0307409_100331181
925 Ga0307409_102181565
926 Ga0307416_100234247
927 Ga0307416_100536576
928 Ga0307416_100930645
929 Ga0307416_100978846
930 Ga0307416_101821794
931 Ga0307416_103224603
932 Ga0307416_103468271
933 Ga0307414_10400330
934 Ga0307414_12324846
935 Ga0307411_11080341
936 Ga0307411_12354661
937 Ga0307415_100245415
938 Ga0307415_100819463
939 Ga0307415_101604273
940 Ga0373930_0068256
941 Ga0373948_0096086
942 Ga0373959_0003241
943 Ga0373934_0154959
944 Ga0373940_0223895
945 Ga0373939_0331369
946 Ga0373941_0255535
947 Ga0373956_0319455
948 Ga0373960_0007367
949 Ga0373946_0759065
950 Ga0373942_0037189
951 Ga0373961_0126647
952 Ga0373962_0184622
953 Ga0373935_0093914
954 Ga0373927_0142331
955 Ga0373927_0158455
956 Ga0373947_0149412
957 Ga0373947_0531793
958 Ga0373947_0802223
959 Ga0373937_0416095
960 Ga0373925_0054707
961 Ga0373925_0385959
962 Ga0395899_0051421
963 Ga0395899_0603674
964 Ga0395899_0937538
965 Ga0395900_0001945
966 Ga0395900_0141748
967 Ga0395900_0740518
968 Ga0395898_0022379
969 Ga0395898_0978708
970 Ga0395898_1186179
971 Ga0395905_0009691
972 Ga0395905_0088107
973 Ga0395905_0295526
974 Ga0395901_0039986
975 Ga0395901_0328020
976 Ga0395901_0799750
977 Ga0395901_1965662
978 Ga0395901_1982879
979 Ga0242420_013637
980 Ga0436365_1103046
981 Ga0451853_0873988
982 Ga0439448_0053199
983 Ga0439450_014072
984 Ga0439451_112674
985 Ga0439455_0018536
986 Ga0439463_001658
987 Ga0439435_0220162
988 Ga0439464_0006224
989 Ga0439464_0007060
990 Ga0439460_0002450
991 Ga0439460_0229149
992 Ga0450893_0064747
993 Ga0439440_0219750
994 Ga0453684_1344195
995 Ga0451576_0223332
996 Ga0451576_1351254
997 Ga0466967_0469262
998 Ga0466967_1341857
999 Ga0495580_0142198
1000 Ga0495605_0459173
1001 Ga0495584_0297495
1002 Ga0495618_0715821
1003 Ga0495586_0409752
1004 Ga0495587_0766626
1005 Ga0495658_0358781
1006 Ga0495669_0061830
1007 Ga0496102_0671055
1008 Ga0496106_0836106
1009 Ga0496108_0488151
1010 Ga0496109_0767555
1011 Ga0496112_0238531
1012 Ga0496113_0072154
1013 Ga0496114_0269541
1014 Ga0496126_0513957
1015 Ga0501291_090982
1016 Ga0501295_151962
1017 Ga0501325_055157
1018 Ga0501031_0086583
1019 Ga0501031_0156420
1020 Ga0501031_0234481
1021 Ga0501031_0248149
1022 Ga0501032_0246111
1023 Ga0501032_0269234
1024 Ga0501032_0338348
1025 Ga0501032_0719989
1026 Ga0501033_0066708
1027 Ga0501033_0131606
1028 Ga0501033_0336824
1029 Ga0501033_0441066
1030 Ga0501033_0500464
1031 Ga0501036_0027656
1032 Ga0501036_0039448
1033 Ga0501036_0251467
1034 Ga0501036_0352803
1035 Ga0501036_0398694
1036 Ga0501036_1456389
1037 Ga0501037_0099978
1038 Ga0501037_0212069
1039 Ga0501037_0721315
1040 Ga0501037_0930769
1041 Ga0501038_0011615
1042 Ga0501038_0101642
1043 Ga0501038_0117861
1044 Ga0501038_0129248
1045 Ga0501039_0024103
1046 Ga0501039_0108812
1047 Ga0501039_0423827
1048 Ga0501039_0807142
1049 Ga0501039_0871116
1050 Ga0501039_0985213
1051 Ga0501040_0007666
1052 Ga0501040_0011604
1053 Ga0501040_0041106
1054 Ga0501040_0063257
1055 Ga0501040_0211016
1056 Ga0501040_0380794
1057 Ga0501041_0002000
1058 Ga0501041_0023660
1059 Ga0501041_0069982
1060 Ga0501041_0197276
1061 Ga0501042_0039425
1062 Ga0501042_0068701
1063 Ga0501042_0131690
1064 Ga0501042_0156345
1065 Ga0501042_0246787
1066 Ga0501042_0272545
1067 Ga0501043_0129497
1068 Ga0501043_0260539
1069 Ga0501043_0278247
1070 Ga0501043_0302372
1071 Ga0501043_0449774
1072 Ga0501046_0003011
1073 Ga0501046_0038306
1074 Ga0501046_0263480
1075 Ga0501047_1005545
1076 Ga0501048_0061025
1077 Ga0501048_0081779
1078 Ga0501048_0139939
1079 Ga0501048_0173708
1080 Ga0501048_0505602
1081 Ga0501048_0682720
1082 Ga0501068_0328281
1083 Ga0501070_1145978
1084 Ga0501071_0008821
1085 Ga0501071_0023654
1086 Ga0501071_0040256
1087 Ga0501071_0066206
1088 Ga0501071_0176715
1089 Ga0501071_0299742
1090 Ga0501071_0652316
1091 Ga0501071_1539444
1092 Ga0501072_0002649
1093 Ga0501072_0022359
1094 Ga0501072_0026752
1095 Ga0501072_0036055
1096 Ga0501072_0089484
1097 Ga0501073_0430231
1098 Ga0501074_0059702
1099 Ga0501074_0093844
1100 Ga0501074_0292571
1101 Ga0501074_0654029
1102 Ga0501075_0007782
1103 Ga0501075_0067221
1104 Ga0501075_0167301
1105 Ga0501075_0191623
1106 Ga0501075_0241683
1107 Ga0501076_0018737
1108 Ga0501076_0020634
1109 Ga0501076_0367858
1110 Ga0501076_0611061
1111 Ga0501077_0011150
1112 Ga0501077_0091985
1113 Ga0501077_0097972
1114 Ga0501077_0102759
1115 Ga0501077_0438346
1116 Ga0501259_052261
1117 Ga0501234_051114
1118 Ga0501079_0006224
1119 Ga0501079_0007178
1120 Ga0501079_0010849
1121 Ga0501079_0031879
1122 Ga0501079_0059296
1123 Ga0501079_0161015
1124 Ga0501079_0429012
1125 Ga0501080_0020749
1126 Ga0501080_0310221
1127 Ga0501080_0339729
1128 Ga0501081_0008238
1129 Ga0501081_0016066
1130 Ga0501081_0067267
1131 Ga0501081_0277354
1132 Ga0501081_0400897
1133 Ga0501266_042682
1134 Ga0501035_0245893
1135 Ga0501035_0253740
1136 Ga0501035_1146482
1137 Ga0501044_0118320
1138 Ga0501044_0721826
1139 Ga0501044_0752002
1140 Ga0501044_1066449
1141 Ga0501045_0029607
1142 Ga0501045_0042390
1143 Ga0501045_0077609
1144 Ga0501045_0090210
1145 Ga0501045_0106628
1146 Ga0501045_0208551
1147 nmdc:mga05p37_1198_c1
1148 nmdc:mga05p37_214214_c1
1149 nmdc:mga05p37_2157560_c1
1150 nmdc:mga05p37_455652_c1
1151 nmdc:mga05p37_476048_c1
1152 nmdc:mga05p37_48473_c1
1153 nmdc:mga05p37_563983_c1
1154 nmdc:mga05p37_71335_c1
1155 nmdc:mga05p37_82569_c1
1156 nmdc:mga05p37_870645_c1
1157 nmdc:mga09592_30656_c1
1158 nmdc:mga09592_45186_c1
1159 nmdc:mga09592_507305_c1
1160 nmdc:mga09592_565902_c1
1161 nmdc:mga09592_64682_c1
1162 nmdc:mga09592_743534_c1
1163 nmdc:mga0qj67_60586_c1
1164 nmdc:mga0qj67_66512_c1
1165 nmdc:mga0qj67_81498_c1
1166 nmdc:mga0qj67_87080_c1
1167 nmdc:mga0qj67_888534_c1
1168 nmdc:mga06r32_101276_c1
1169 nmdc:mga06r32_116036_c1
1170 nmdc:mga06r32_1207125_c1
1171 nmdc:mga06r32_15915_c1
1172 nmdc:mga06r32_17658_c1
1173 nmdc:mga06r32_1788373_c1
1174 nmdc:mga06r32_2018986_c1
1175 nmdc:mga06r32_25744_c1
1176 nmdc:mga06r32_385843_c1
1177 nmdc:mga06r32_419697_c1
1178 nmdc:mga08y16_228898_c1
1179 nmdc:mga08y16_339034_c1
1180 nmdc:mga08y16_484572_c1
1181 nmdc:mga08y16_678366_c1
1182 nmdc:mga0n895_1264608_c1
1183 nmdc:mga0n895_181339_c1
1184 nmdc:mga0n895_25690_c1
1185 nmdc:mga0n895_52495_c1
1186 nmdc:mga0n895_88174_c1
1187 nmdc:mga0rr50_203372_c1
1188 nmdc:mga0rr50_52973_c1
1189 nmdc:mga08x19_204959_c1
1190 nmdc:mga08x19_333332_c1
1191 nmdc:mga0a205_214175_c1
1192 nmdc:mga0a205_292428_c1
1193 nmdc:mga0a205_489752_c1
1194 nmdc:mga0a205_61515_c1
1195 nmdc:mga0a205_8360_c1
1196 Ga0495601_0033720
1197 Ga0495612_0564219
1198 Ga0495619_0334977
1199 Ga0501084_0003483
1200 Ga0501084_0007547
1201 Ga0501084_0015371
1202 Ga0501084_0029989
1203 Ga0501084_0247892
1204 Ga0590075_150548
1205 Ga0590077_125046
1206 Ga0501082_0019892
1207 Ga0501082_0090971
1208 Ga0501082_0104847
1209 Ga0501082_0272712
1210 Ga0501082_0275195
1211 Ga0530510_0004189
1212 Ga0530510_0013797
1213 Ga0530510_0056863
1214 Ga0530510_0060434
1215 Ga0530510_0064930
1216 Ga0530510_0158705
1217 Ga0530510_0402293
1218 Ga0530510_0425199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2das-assembly1.cif.gz_A solution structure of trash domain of zinc finger mym-type protein 5 0.7347 36 73
6u4n-assembly1.cif.gz_B solution structure of paxillin lim4 in complex with kindlin-2 f0 0.6871 37 63
6bgc-assembly1.cif.gz_A the crystal structure of the w145a variant of tpmglb-2 (tp0684) with bound glucose 0.6388 13 29
2n94-assembly1.cif.gz_A nmr structure of yeast bcd1 protein zinc finger 0.5777 35 76
1tbx-assembly1.cif.gz_B crystal structure of ssv1 f-93 0.5769 14 31
ID Description Score Start End Superfamily
af_A0A0P0WE20_22_65_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9244 39 70 3.30.40.10
af_C6T1D3_66_116_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8871 39 70 3.30.40.10
af_A1ZA47_2077_2135_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8645 36 59 2.10.110.10
af_O49619_515_698_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8541 13 26 1.25.40.10
af_Q7KVM8_153_275_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.808 14 26 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A2V6DQD6-F1-model_v4 Metallothionein 0.9906 1 68
AF-A0A1U7CZ89-F1-model_v4 Metallothionein 0.9867 1 70
AF-A0A538MQ35-F1-model_v4 Prokaryotic metallothionein 0.9742 1 65
AF-A0A3A4EZ97-F1-model_v4 Metallothionein 0.9729 1 64
AF-A0A7Z0J1R0-F1-model_v4 DNA-directed RNA polymerase subunit RPC12/RpoP 0.9723 1 65 GO:0000428

Map