F468890
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 609 | 414 | 512 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0038937|Ga0395899_0038937_343_1269 |
| Length | 308 |
| Sequence | LILFFSFLSDTVWSDAIPGNGPLSMTNIVQDIGTFSVDRIRQRSESGWSLPPVAILAGGLGSRLSEETTLRPKPLVEIGGKPIIWHVMKHYDAYGMNEFAIALGYKKEAVIRYFLDLHTSNRNLTVRTRDGSVSFHDGNTDLDWTVHLVDTGPETMTGGRIKRLRPYLGGGTFMLTWCDGISNVNLTDLLAFHRAHGKLATVTVVRAPSRFGLVDVAGDRSVRRFTEKPEHGDGWINGAFFVLEPGIFDYIAGDDTMWEREPLERLAADGELAAYQHNSFWQCMDTLKEKTLLEELWNKGSAPWKTWE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 6 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 7 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 10 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 11 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 12 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 13 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 14 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 15 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 16 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 17 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 18 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 19 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 20 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 21 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 22 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 23 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 24 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 25 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 26 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 27 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 28 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 29 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 30 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 31 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 32 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 33 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 34 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 35 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 36 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 37 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 38 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 39 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 40 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 41 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 42 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 43 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 44 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 45 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 46 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 47 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 48 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 49 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 50 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 51 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 52 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 53 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 54 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 55 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 56 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 57 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 58 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 59 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 60 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 61 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 62 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 63 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 64 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 65 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 66 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 67 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 68 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 69 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 70 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 71 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 72 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 73 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 74 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 75 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 76 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 77 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 78 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 79 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 80 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 81 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 82 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 83 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 84 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 85 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 86 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 87 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 88 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 89 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 90 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 91 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 92 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 93 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 95 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 96 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 97 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 98 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 104 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 105 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 106 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 108 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 110 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 112 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 126 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 127 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 133 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 134 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 136 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 140 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 143 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 144 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 145 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 146 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 147 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 148 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 149 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 150 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 151 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 153 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 154 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 156 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 158 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 159 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 160 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 162 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 163 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 164 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 177 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 196 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 197 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 198 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 199 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 200 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 201 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 202 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 253 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 255 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 256 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 261 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 262 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 263 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 264 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 265 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 267 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 268 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 269 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 270 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 271 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 272 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 273 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 274 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 275 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 276 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 277 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 278 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 279 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 280 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 281 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 286 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 287 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 289 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 292 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 293 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 294 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 295 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 296 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 297 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 298 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 299 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 302 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 303 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 304 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 305 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 306 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 307 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 308 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 309 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 310 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 311 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 312 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 313 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 314 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 315 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 316 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 353 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 354 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 392 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 395 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 396 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 397 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 398 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 401 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 402 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 404 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 410 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 411 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 412 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 413 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 414 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.8 |
| Metatranscriptomes | 4.27 |
| Isolates | 15.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.78 |
| Nodule | 12.81 |
| Rhizoplane | 0.82 |
| Rhizosphere | 74.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10035637 | 3300003203 | Bacteria | 1814 |
| 2 | JGI25153J46596_10004924 | 3300003215 | Bacteria | 7097 |
| 3 | rootH2_10008034 | 3300003320 | Bacteria | 73088 |
| 4 | rootH2_10067998 | 3300003320 | Bacteria | 3172 |
| 5 | rootL2_10000040 | 3300003322 | Bacteria | 12566 |
| 6 | rootH1_10008851 | 3300003323 | Bacteria | 21396 |
| 7 | Ga0055524_1000412 | 3300003775 | Bacteria | 36126 |
| 8 | Ga0058863_11804459 | 3300004799 | Bacteria | 1307 |
| 9 | Ga0058861_11441847 | 3300004800 | Bacteria | 1293 |
| 10 | Ga0058861_12075980 | 3300004800 | Bacteria | 1376 |
| 11 | Ga0058862_12726379 | 3300004803 | Bacteria | 2262 |
| 12 | Ga0065714_10068111 | 3300005288 | Bacteria | 4953 |
| 13 | Ga0065704_10075142 | 3300005289 | Bacteria | 5769 |
| 14 | Ga0065712_10103794 | 3300005290 | Bacteria | 1976 |
| 15 | Ga0065715_10222802 | 3300005293 | Bacteria | 1260 |
| 16 | Ga0070658_10010293 | 3300005327 | Bacteria | 7502 |
| 17 | Ga0070658_10043883 | 3300005327 | Bacteria | 3612 |
| 18 | Ga0070690_100031713 | 3300005330 | Unclassified | 3294 |
| 19 | Ga0070690_100036391 | 3300005330 | Bacteria | 3093 |
| 20 | Ga0070670_100003750 | 3300005331 | Bacteria | 12651 |
| 21 | Ga0070670_100159876 | 3300005331 | Bacteria | 1952 |
| 22 | Ga0068869_100053794 | 3300005334 | Unclassified | 2928 |
| 23 | Ga0070680_100007419 | 3300005336 | Bacteria | 8370 |
| 24 | Ga0070680_100019022 | 3300005336 | Bacteria | 5437 |
| 25 | Ga0070680_100097059 | 3300005336 | Bacteria | 2443 |
| 26 | Ga0070680_100288905 | 3300005336 | Bacteria | 1390 |
| 27 | Ga0070689_100193624 | 3300005340 | Unclassified | 1656 |
| 28 | Ga0070661_100024247 | 3300005344 | Bacteria | 4351 |
| 29 | Ga0070668_100366372 | 3300005347 | Bacteria | 1223 |
| 30 | Ga0070669_100023032 | 3300005353 | Bacteria | 4457 |
| 31 | Ga0070669_100396106 | 3300005353 | Bacteria | 1129 |
| 32 | Ga0070669_100639490 | 3300005353 | Unclassified | 894 |
| 33 | Ga0070671_100117833 | 3300005355 | Bacteria | 2233 |
| 34 | Ga0070659_100020751 | 3300005366 | Bacteria | 4996 |
| 35 | Ga0070659_100165743 | 3300005366 | Bacteria | 1808 |
| 36 | Ga0070659_100383333 | 3300005366 | Bacteria | 1184 |
| 37 | Ga0070659_100441739 | 3300005366 | Unclassified | 1102 |
| 38 | Ga0070713_100022820 | 3300005436 | Bacteria | 4843 |
| 39 | Ga0070713_100054174 | 3300005436 | Bacteria | 3327 |
| 40 | Ga0070713_100389447 | 3300005436 | Bacteria | 1300 |
| 41 | Ga0070710_10030913 | 3300005437 | Bacteria | 2885 |
| 42 | Ga0070710_10214402 | 3300005437 | Bacteria | 1222 |
| 43 | Ga0070711_100056035 | 3300005439 | Bacteria | 2724 |
| 44 | Ga0070700_100214121 | 3300005441 | Bacteria | 1361 |
| 45 | Ga0070694_100124788 | 3300005444 | Bacteria | 1852 |
| 46 | Ga0070663_100011657 | 3300005455 | Bacteria | 5527 |
| 47 | Ga0070678_100016026 | 3300005456 | Bacteria | 4780 |
| 48 | Ga0070678_100031710 | 3300005456 | Bacteria | 3650 |
| 49 | Ga0070662_100054577 | 3300005457 | Bacteria | 2896 |
| 50 | Ga0070662_100121276 | 3300005457 | Bacteria | 2004 |
| 51 | Ga0070681_10000391 | 3300005458 | Bacteria | 35476 |
| 52 | Ga0070681_10007242 | 3300005458 | Bacteria | 10825 |
| 53 | Ga0070681_10008929 | 3300005458 | Bacteria | 9852 |
| 54 | Ga0070681_10012085 | 3300005458 | Bacteria | 8561 |
| 55 | Ga0070681_10034142 | 3300005458 | Bacteria | 5109 |
| 56 | Ga0070681_10066183 | 3300005458 | Bacteria | 3582 |
| 57 | Ga0068867_100154765 | 3300005459 | Bacteria | 1803 |
| 58 | Ga0068867_100399708 | 3300005459 | Unclassified | 1158 |
| 59 | Ga0070685_10095167 | 3300005466 | Bacteria | 1810 |
| 60 | Ga0070706_100032224 | 3300005467 | Unclassified | 4834 |
| 61 | Ga0070706_100056635 | 3300005467 | Bacteria | 3617 |
| 62 | Ga0070706_100231754 | 3300005467 | Bacteria | 1724 |
| 63 | Ga0070707_100160425 | 3300005468 | Bacteria | 2191 |
| 64 | Ga0070698_100000229 | 3300005471 | Bacteria | 55211 |
| 65 | Ga0070698_100009796 | 3300005471 | Bacteria | 10243 |
| 66 | Ga0070698_100099966 | 3300005471 | Bacteria | 2874 |
| 67 | Ga0070698_100331444 | 3300005471 | Bacteria | 1453 |
| 68 | Ga0070698_100564484 | 3300005471 | Bacteria | 1078 |
| 69 | Ga0070699_100026893 | 3300005518 | Bacteria | 4963 |
| 70 | Ga0070699_100459014 | 3300005518 | Bacteria | 1155 |
| 71 | Ga0070679_100010196 | 3300005530 | Bacteria | 8908 |
| 72 | Ga0070679_100011032 | 3300005530 | Bacteria | 8592 |
| 73 | Ga0070679_100030534 | 3300005530 | Bacteria | 5320 |
| 74 | Ga0070679_100086879 | 3300005530 | Bacteria | 3114 |
| 75 | Ga0070679_100169517 | 3300005530 | Bacteria | 2156 |
| 76 | Ga0070679_100402247 | 3300005530 | Bacteria | 1315 |
| 77 | Ga0070684_100014502 | 3300005535 | Bacteria | 6387 |
| 78 | Ga0070697_100071601 | 3300005536 | Bacteria | 2844 |
| 79 | Ga0070697_100212008 | 3300005536 | Bacteria | 1649 |
| 80 | Ga0070686_100391816 | 3300005544 | Bacteria | 1054 |
| 81 | Ga0070696_100002003 | 3300005546 | Bacteria | 13360 |
| 82 | Ga0070665_100048548 | 3300005548 | Bacteria | 4261 |
| 83 | Ga0070704_100385297 | 3300005549 | Bacteria | 1192 |
| 84 | Ga0068855_100001147 | 3300005563 | Bacteria | 32801 |
| 85 | Ga0068855_100009153 | 3300005563 | Bacteria | 11960 |
| 86 | Ga0068855_100080587 | 3300005563 | Bacteria | 3774 |
| 87 | Ga0068855_100082797 | 3300005563 | Bacteria | 3718 |
| 88 | Ga0068857_100189448 | 3300005577 | Bacteria | 1873 |
| 89 | Ga0068857_100846168 | 3300005577 | Bacteria | 875 |
| 90 | Ga0068856_100016724 | 3300005614 | Bacteria | 7106 |
| 91 | Ga0068859_100115359 | 3300005617 | Bacteria | 2751 |
| 92 | Ga0068864_100557814 | 3300005618 | Unclassified | 1108 |
| 93 | Ga0068864_100927243 | 3300005618 | Unclassified | 861 |
| 94 | Ga0068861_100002243 | 3300005719 | Bacteria | 12547 |
| 95 | Ga0068861_100613892 | 3300005719 | Bacteria | 1000 |
| 96 | Ga0068870_10066078 | 3300005840 | Unclassified | 1958 |
| 97 | Ga0068870_10068334 | 3300005840 | Bacteria | 1930 |
| 98 | Ga0068858_100009568 | 3300005842 | Bacteria | 9246 |
| 99 | Ga0068860_100457721 | 3300005843 | Bacteria | 1269 |
| 100 | Ga0068862_100008309 | 3300005844 | Bacteria | 8590 |
| 101 | Ga0081455_10000679 | 3300005937 | Bacteria | 44123 |
| 102 | Ga0081455_10005986 | 3300005937 | Bacteria | 13190 |
| 103 | Ga0081455_10131541 | 3300005937 | Bacteria | 1956 |
| 104 | Ga0081540_1006514 | 3300005983 | Bacteria | 8484 |
| 105 | Ga0070717_10136601 | 3300006028 | Unclassified | 2112 |
| 106 | Ga0075365_10154328 | 3300006038 | Bacteria | 1598 |
| 107 | Ga0070716_100000001 | 3300006173 | Bacteria | 400668 |
| 108 | Ga0070712_100162695 | 3300006175 | Bacteria | 1725 |
| 109 | Ga0075369_10026822 | 3300006186 | Bacteria | 2404 |
| 110 | Ga0097621_100081995 | 3300006237 | Bacteria | 2685 |
| 111 | Ga0097621_100394194 | 3300006237 | Bacteria | 1238 |
| 112 | Ga0068871_100751633 | 3300006358 | Bacteria | 896 |
| 113 | Ga0075428_100848386 | 3300006844 | Bacteria | 970 |
| 114 | Ga0068865_100628562 | 3300006881 | Unclassified | 910 |
| 115 | Ga0097620_100115357 | 3300006931 | Bacteria | 2751 |
| 116 | Ga0075435_100200335 | 3300007076 | Bacteria | 1691 |
| 117 | Ga0099794_10005493 | 3300007265 | Bacteria | 5083 |
| 118 | Ga0099794_10064511 | 3300007265 | Bacteria | 1785 |
| 119 | Ga0099795_10001876 | 3300007788 | Bacteria | 4760 |
| 120 | Ga0099795_10117592 | 3300007788 | Bacteria | 1060 |
| 121 | Ga0105251_10001908 | 3300009011 | Bacteria | 17107 |
| 122 | Ga0105244_10000783 | 3300009036 | Bacteria | 27093 |
| 123 | Ga0105240_10019120 | 3300009093 | Bacteria | 9160 |
| 124 | Ga0105240_10035059 | 3300009093 | Bacteria | 6470 |
| 125 | Ga0105240_10038367 | 3300009093 | Bacteria | 6144 |
| 126 | Ga0105240_10112395 | 3300009093 | Bacteria | 3293 |
| 127 | Ga0105240_10131728 | 3300009093 | Bacteria | 2998 |
| 128 | Ga0105240_10441133 | 3300009093 | Bacteria | 1459 |
| 129 | Ga0105245_10604829 | 3300009098 | Bacteria | 1123 |
| 130 | Ga0105247_10133212 | 3300009101 | Bacteria | 1622 |
| 131 | Ga0114129_10096840 | 3300009147 | Bacteria | 4085 |
| 132 | Ga0105243_10005913 | 3300009148 | Bacteria | 9478 |
| 133 | Ga0105241_10468572 | 3300009174 | Bacteria | 1117 |
| 134 | Ga0105242_10066263 | 3300009176 | Bacteria | 2982 |
| 135 | Ga0105242_10710026 | 3300009176 | Bacteria | 985 |
| 136 | Ga0105248_10556375 | 3300009177 | Bacteria | 1294 |
| 137 | Ga0105248_10648508 | 3300009177 | Bacteria | 1191 |
| 138 | Ga0105237_10108814 | 3300009545 | Bacteria | 2763 |
| 139 | Ga0105237_10368543 | 3300009545 | Bacteria | 1441 |
| 140 | Ga0105237_10455149 | 3300009545 | Bacteria | 1286 |
| 141 | Ga0105238_10008139 | 3300009551 | Bacteria | 10486 |
| 142 | Ga0105238_10068035 | 3300009551 | Bacteria | 3562 |
| 143 | Ga0105238_10099470 | 3300009551 | Unclassified | 2891 |
| 144 | Ga0105238_10164968 | 3300009551 | Bacteria | 2190 |
| 145 | Ga0099796_10000295 | 3300010159 | Bacteria | 7864 |
| 146 | Ga0099796_10013632 | 3300010159 | Bacteria | 2326 |
| 147 | Ga0105239_10133686 | 3300010375 | Bacteria | 2761 |
| 148 | Ga0105246_10000490 | 3300011119 | Bacteria | 21442 |
| 149 | Ga0105246_10351534 | 3300011119 | Bacteria | 1208 |
| 150 | Ga0157371_10342053 | 3300013102 | Bacteria | 1088 |
| 151 | Ga0157370_10002664 | 3300013104 | Bacteria | 21422 |
| 152 | Ga0157370_10009088 | 3300013104 | Bacteria | 10658 |
| 153 | Ga0157370_10371367 | 3300013104 | Bacteria | 1318 |
| 154 | Ga0157369_10004921 | 3300013105 | Bacteria | 15660 |
| 155 | Ga0157369_10080767 | 3300013105 | Bacteria | 3481 |
| 156 | Ga0157369_10278894 | 3300013105 | Bacteria | 1741 |
| 157 | Ga0157369_10470432 | 3300013105 | Bacteria | 1301 |
| 158 | Ga0157374_10541760 | 3300013296 | Bacteria | 1171 |
| 159 | Ga0157378_10677494 | 3300013297 | Bacteria | 1049 |
| 160 | Ga0163162_10077042 | 3300013306 | Bacteria | 3398 |
| 161 | Ga0163162_10275686 | 3300013306 | Bacteria | 1814 |
| 162 | Ga0157372_10129704 | 3300013307 | Bacteria | 2900 |
| 163 | Ga0157372_10535770 | 3300013307 | Bacteria | 1365 |
| 164 | Ga0157372_10948970 | 3300013307 | Bacteria | 997 |
| 165 | Ga0157375_10000629 | 3300013308 | Bacteria | 31341 |
| 166 | Ga0157375_10391174 | 3300013308 | Bacteria | 1557 |
| 167 | Ga0157375_10424719 | 3300013308 | Bacteria | 1495 |
| 168 | Ga0157375_10735758 | 3300013308 | Bacteria | 1138 |
| 169 | Ga0163163_10001907 | 3300014325 | Bacteria | 17635 |
| 170 | Ga0163163_10003054 | 3300014325 | Bacteria | 14162 |
| 171 | Ga0163163_10288020 | 3300014325 | Bacteria | 1694 |
| 172 | Ga0157380_10118415 | 3300014326 | Bacteria | 2239 |
| 173 | Ga0182008_10002216 | 3300014497 | Bacteria | 12317 |
| 174 | Ga0157379_10002195 | 3300014968 | Bacteria | 16240 |
| 175 | Ga0157379_10198050 | 3300014968 | Bacteria | 1816 |
| 176 | Ga0157379_10204010 | 3300014968 | Bacteria | 1788 |
| 177 | Ga0163161_10082936 | 3300017792 | Bacteria | 2363 |
| 178 | Ga0163161_10199212 | 3300017792 | Bacteria | 1542 |
| 179 | Ga0197907_10300375 | 3300020069 | Bacteria | 886 |
| 180 | Ga0206356_10118893 | 3300020070 | Bacteria | 1233 |
| 181 | Ga0206356_11813778 | 3300020070 | Unclassified | 898 |
| 182 | Ga0206351_10004824 | 3300020077 | Bacteria | 3251 |
| 183 | Ga0206352_10208239 | 3300020078 | Bacteria | 1296 |
| 184 | Ga0206354_10552570 | 3300020081 | Bacteria | 955 |
| 185 | Ga0206353_10185489 | 3300020082 | Bacteria | 854 |
| 186 | Ga0214543_1000005 | 3300021327 | Bacteria | 454523 |
| 187 | Ga0213873_10042597 | 3300021358 | Bacteria | 1175 |
| 188 | Ga0213876_10017929 | 3300021384 | Bacteria | 3735 |
| 189 | Ga0224712_10001804 | 3300022467 | Bacteria | 5106 |
| 190 | Ga0224712_10002191 | 3300022467 | Bacteria | 4765 |
| 191 | Ga0224712_10020238 | 3300022467 | Bacteria | 2255 |
| 192 | Ga0224712_10088131 | 3300022467 | Bacteria | 1295 |
| 193 | Ga0224712_10096016 | 3300022467 | Bacteria | 1249 |
| 194 | Ga0224712_10122870 | 3300022467 | Bacteria | 1126 |
| 195 | Ga0224712_10145105 | 3300022467 | Bacteria | 1048 |
| 196 | Ga0209025_1009820 | 3300025294 | Bacteria | 6602 |
| 197 | Ga0209758_1000628 | 3300025297 | Bacteria | 54130 |
| 198 | Ga0209256_1000412 | 3300025299 | Bacteria | 67199 |
| 199 | Ga0207713_1001686 | 3300025735 | Bacteria | 17087 |
| 200 | Ga0207692_10015697 | 3300025898 | Bacteria | 3340 |
| 201 | Ga0207710_10161264 | 3300025900 | Bacteria | 1092 |
| 202 | Ga0207688_10089314 | 3300025901 | Bacteria | 1768 |
| 203 | Ga0207705_10039212 | 3300025909 | Bacteria | 3394 |
| 204 | Ga0207684_10016442 | 3300025910 | Bacteria | 6352 |
| 205 | Ga0207684_10026203 | 3300025910 | Bacteria | 4970 |
| 206 | Ga0207654_10270798 | 3300025911 | Bacteria | 1145 |
| 207 | Ga0207707_10003776 | 3300025912 | Bacteria | 13422 |
| 208 | Ga0207707_10014184 | 3300025912 | Bacteria | 6943 |
| 209 | Ga0207707_10016325 | 3300025912 | Bacteria | 6477 |
| 210 | Ga0207707_10028611 | 3300025912 | Bacteria | 4870 |
| 211 | Ga0207707_10045534 | 3300025912 | Bacteria | 3822 |
| 212 | Ga0207707_10113576 | 3300025912 | Bacteria | 2367 |
| 213 | Ga0207695_10006739 | 3300025913 | Bacteria | 14813 |
| 214 | Ga0207695_10042155 | 3300025913 | Bacteria | 4879 |
| 215 | Ga0207695_10060575 | 3300025913 | Bacteria | 3916 |
| 216 | Ga0207695_10105007 | 3300025913 | Bacteria | 2813 |
| 217 | Ga0207671_10041349 | 3300025914 | Bacteria | 3411 |
| 218 | Ga0207693_10025413 | 3300025915 | Bacteria | 4696 |
| 219 | Ga0207693_10274472 | 3300025915 | Unclassified | 1321 |
| 220 | Ga0207663_10076305 | 3300025916 | Bacteria | 2177 |
| 221 | Ga0207660_10009454 | 3300025917 | Bacteria | 6309 |
| 222 | Ga0207660_10011552 | 3300025917 | Bacteria | 5754 |
| 223 | Ga0207660_10033713 | 3300025917 | Bacteria | 3544 |
| 224 | Ga0207660_10073983 | 3300025917 | Bacteria | 2485 |
| 225 | Ga0207660_10292960 | 3300025917 | Bacteria | 1294 |
| 226 | Ga0207660_10464829 | 3300025917 | Unclassified | 1024 |
| 227 | Ga0207649_10012195 | 3300025920 | Bacteria | 4760 |
| 228 | Ga0207652_10006501 | 3300025921 | Bacteria | 9419 |
| 229 | Ga0207652_10020131 | 3300025921 | Bacteria | 5494 |
| 230 | Ga0207652_10045269 | 3300025921 | Bacteria | 3751 |
| 231 | Ga0207652_10101220 | 3300025921 | Bacteria | 2545 |
| 232 | Ga0207652_10156827 | 3300025921 | Bacteria | 2040 |
| 233 | Ga0207652_10472567 | 3300025921 | Bacteria | 1129 |
| 234 | Ga0207681_10469445 | 3300025923 | Unclassified | 1026 |
| 235 | Ga0207694_10008696 | 3300025924 | Bacteria | 7664 |
| 236 | Ga0207694_10239393 | 3300025924 | Unclassified | 1483 |
| 237 | Ga0207650_10095014 | 3300025925 | Bacteria | 2285 |
| 238 | Ga0207700_10026680 | 3300025928 | Bacteria | 4032 |
| 239 | Ga0207700_10151886 | 3300025928 | Bacteria | 1914 |
| 240 | Ga0207700_10201213 | 3300025928 | Bacteria | 1679 |
| 241 | Ga0207700_10324709 | 3300025928 | Bacteria | 1335 |
| 242 | Ga0207664_10038416 | 3300025929 | Bacteria | 3712 |
| 243 | Ga0207690_10116443 | 3300025932 | Bacteria | 1933 |
| 244 | Ga0207706_10068767 | 3300025933 | Bacteria | 3115 |
| 245 | Ga0207706_10180012 | 3300025933 | Bacteria | 1856 |
| 246 | Ga0207670_10429549 | 3300025936 | Unclassified | 1061 |
| 247 | Ga0207704_10609887 | 3300025938 | Unclassified | 894 |
| 248 | Ga0207665_10000002 | 3300025939 | Bacteria | 267895 |
| 249 | Ga0207711_10337008 | 3300025941 | Bacteria | 1395 |
| 250 | Ga0207689_10109936 | 3300025942 | Unclassified | 2265 |
| 251 | Ga0207661_10160996 | 3300025944 | Bacteria | 1947 |
| 252 | Ga0207679_10011547 | 3300025945 | Bacteria | 5727 |
| 253 | Ga0207679_10048003 | 3300025945 | Bacteria | 3106 |
| 254 | Ga0207667_10000927 | 3300025949 | Bacteria | 37446 |
| 255 | Ga0207667_10032914 | 3300025949 | Bacteria | 5579 |
| 256 | Ga0207667_10050878 | 3300025949 | Bacteria | 4370 |
| 257 | Ga0207667_10163664 | 3300025949 | Bacteria | 2287 |
| 258 | Ga0207668_10454178 | 3300025972 | Bacteria | 1094 |
| 259 | Ga0207677_10369714 | 3300026023 | Bacteria | 1207 |
| 260 | Ga0207703_10016711 | 3300026035 | Bacteria | 5723 |
| 261 | Ga0207703_10341848 | 3300026035 | Bacteria | 1376 |
| 262 | Ga0207678_10022160 | 3300026067 | Bacteria | 5567 |
| 263 | Ga0207702_10034771 | 3300026078 | Bacteria | 4215 |
| 264 | Ga0207702_10620199 | 3300026078 | Bacteria | 1062 |
| 265 | Ga0207648_10082153 | 3300026089 | Bacteria | 2810 |
| 266 | Ga0207648_10291027 | 3300026089 | Bacteria | 1462 |
| 267 | Ga0207648_10363845 | 3300026089 | Unclassified | 1305 |
| 268 | Ga0207676_10708763 | 3300026095 | Bacteria | 976 |
| 269 | Ga0207674_10000111 | 3300026116 | Bacteria | 94237 |
| 270 | Ga0207674_10171845 | 3300026116 | Bacteria | 2120 |
| 271 | Ga0207674_10707190 | 3300026116 | Bacteria | 973 |
| 272 | Ga0207674_10746600 | 3300026116 | Unclassified | 945 |
| 273 | Ga0207675_100074734 | 3300026118 | Bacteria | 3172 |
| 274 | Ga0207675_100443047 | 3300026118 | Bacteria | 1286 |
| 275 | Ga0207683_10061340 | 3300026121 | Bacteria | 3309 |
| 276 | Ga0207683_10075657 | 3300026121 | Bacteria | 2980 |
| 277 | Ga0207683_10669916 | 3300026121 | Bacteria | 961 |
| 278 | Ga0207698_10040440 | 3300026142 | Bacteria | 3465 |
| 279 | Ga0207698_10312661 | 3300026142 | Bacteria | 1468 |
| 280 | Ga0209281_1000547 | 3300027111 | Bacteria | 46811 |
| 281 | Ga0209179_1000201 | 3300027512 | Bacteria | 5636 |
| 282 | Ga0265356_1001416 | 3300028017 | Bacteria | 3578 |
| 283 | Ga0268266_10006924 | 3300028379 | Bacteria | 10315 |
| 284 | Ga0268265_10075892 | 3300028380 | Bacteria | 2635 |
| 285 | Ga0268264_10409607 | 3300028381 | Bacteria | 1305 |
| 286 | Ga0265337_1033854 | 3300028556 | Bacteria | 1506 |
| 287 | Ga0265334_10001556 | 3300028573 | Bacteria | 11047 |
| 288 | Ga0265334_10003091 | 3300028573 | Bacteria | 7601 |
| 289 | Ga0265334_10009303 | 3300028573 | Bacteria | 4157 |
| 290 | Ga0265318_10081539 | 3300028577 | Bacteria | 1195 |
| 291 | Ga0307515_10006229 | 3300028794 | Bacteria | 23956 |
| 292 | Ga0265338_10033340 | 3300028800 | Bacteria | 5000 |
| 293 | Ga0265773_1005943 | 3300031018 | Unclassified | 905 |
| 294 | Ga0265330_10024209 | 3300031235 | Bacteria | 2754 |
| 295 | Ga0265332_10005214 | 3300031238 | Bacteria | 6014 |
| 296 | Ga0265340_10009277 | 3300031247 | Bacteria | 5284 |
| 297 | Ga0265331_10003584 | 3300031250 | Bacteria | 9948 |
| 298 | Ga0265327_10005325 | 3300031251 | Bacteria | 10780 |
| 299 | Ga0265327_10034980 | 3300031251 | Bacteria | 2782 |
| 300 | Ga0307509_10309770 | 3300031507 | Bacteria | 1322 |
| 301 | Ga0307408_100004836 | 3300031548 | Bacteria | 9073 |
| 302 | Ga0307408_100023592 | 3300031548 | Bacteria | 4192 |
| 303 | Ga0265314_10002337 | 3300031711 | Bacteria | 19598 |
| 304 | Ga0265314_10014389 | 3300031711 | Bacteria | 6334 |
| 305 | Ga0316576_10162678 | 3300031727 | Bacteria | 1683 |
| 306 | Ga0316578_10076786 | 3300031728 | Unclassified | 1983 |
| 307 | Ga0316578_10093655 | 3300031728 | Bacteria | 1796 |
| 308 | Ga0316578_10260783 | 3300031728 | Bacteria | 1039 |
| 309 | Ga0307405_10139995 | 3300031731 | Bacteria | 1685 |
| 310 | Ga0316577_10010591 | 3300031733 | Bacteria | 4980 |
| 311 | Ga0307413_10071079 | 3300031824 | Bacteria | 2191 |
| 312 | Ga0307410_10152579 | 3300031852 | Bacteria | 1721 |
| 313 | Ga0307406_10088928 | 3300031901 | Bacteria | 2073 |
| 314 | Ga0307406_10117275 | 3300031901 | Bacteria | 1844 |
| 315 | Ga0307412_10024423 | 3300031911 | Bacteria | 3730 |
| 316 | Ga0307409_100057975 | 3300031995 | Bacteria | 3005 |
| 317 | Ga0307409_100105483 | 3300031995 | Bacteria | 2349 |
| 318 | Ga0307416_100111070 | 3300032002 | Bacteria | 2415 |
| 319 | Ga0307416_100947185 | 3300032002 | Bacteria | 963 |
| 320 | Ga0307414_10129784 | 3300032004 | Bacteria | 1954 |
| 321 | Ga0307411_10021817 | 3300032005 | Bacteria | 3757 |
| 322 | Ga0307411_10158042 | 3300032005 | Bacteria | 1693 |
| 323 | Ga0307415_100071567 | 3300032126 | Bacteria | 2439 |
| 324 | Ga0316585_10054310 | 3300032137 | Bacteria | 1288 |
| 325 | Ga0316580_10018799 | 3300032139 | Bacteria | 2127 |
| 326 | Ga0316593_10033471 | 3300032168 | Bacteria | 1682 |
| 327 | Ga0316592_1003348 | 3300033524 | Bacteria | 2880 |
| 328 | Ga0316596_1007122 | 3300033541 | Bacteria | 2632 |
| 329 | Ga0373936_0208261 | 3300035113 | Bacteria | 865 |
| 330 | Ga0373956_0253161 | 3300035119 | Bacteria | 837 |
| 331 | Ga0373955_0106974 | 3300035172 | Bacteria | 1613 |
| 332 | Ga0373937_0283492 | 3300036401 | Bacteria | 1565 |
| 333 | Ga0316582_0046478 | 3300036647 | Bacteria | 2737 |
| 334 | Ga0316584_0099710 | 3300036712 | Unclassified | 2175 |
| 335 | Ga0373925_0130487 | 3300037068 | Bacteria | 1959 |
| 336 | Ga0373925_0282994 | 3300037068 | Bacteria | 1336 |
| 337 | Ga0373925_0595679 | 3300037068 | Bacteria | 910 |
| 338 | Ga0395899_0023786 | 3300037312 | Bacteria | 4636 |
| 339 | Ga0395899_0038937 | 3300037312 | Bacteria | 3560 |
| 340 | Ga0395900_0017307 | 3300037418 | Bacteria | 7357 |
| 341 | Ga0395900_0023417 | 3300037418 | Bacteria | 6321 |
| 342 | Ga0395900_0182228 | 3300037418 | Bacteria | 2134 |
| 343 | Ga0395900_0294704 | 3300037418 | Bacteria | 1610 |
| 344 | Ga0395898_0046730 | 3300037466 | Bacteria | 4251 |
| 345 | Ga0395898_0077145 | 3300037466 | Bacteria | 3217 |
| 346 | Ga0395898_0274010 | 3300037466 | Bacteria | 1609 |
| 347 | Ga0395905_0353349 | 3300037471 | Bacteria | 1362 |
| 348 | Ga0395905_0421634 | 3300037471 | Bacteria | 1231 |
| 349 | Ga0436364_1254782 | 3300037853 | Bacteria | 3166 |
| 350 | Ga0395901_0014999 | 3300038443 | Bacteria | 7876 |
| 351 | Ga0395901_0024360 | 3300038443 | Bacteria | 6210 |
| 352 | Ga0395901_0468165 | 3300038443 | Bacteria | 1287 |
| 353 | Ga0400484_44773 | 3300038725 | Bacteria | 4079 |
| 354 | Ga0400490_10463 | 3300038726 | Bacteria | 6199 |
| 355 | Ga0400483_015883 | 3300039062 | Bacteria | 4444 |
| 356 | Ga0400483_150553 | 3300039062 | Bacteria | 1087 |
| 357 | Ga0400483_183966 | 3300039062 | Bacteria | 71423 |
| 358 | Ga0436365_0296501 | 3300039437 | Bacteria | 1244 |
| 359 | Ga0436365_0319120 | 3300039437 | Bacteria | 16865 |
| 360 | Ga0436360_0664306 | 3300039438 | Bacteria | 1583 |
| 361 | Ga0436360_0906789 | 3300039438 | Unclassified | 2083 |
| 362 | Ga0436360_1262558 | 3300039438 | Bacteria | 2478 |
| 363 | Ga0436361_0621164 | 3300039447 | Unclassified | 2275 |
| 364 | Ga0436362_0091673 | 3300039453 | Bacteria | 3376 |
| 365 | Ga0436362_0144001 | 3300039453 | Bacteria | 1346 |
| 366 | Ga0436362_1282354 | 3300039453 | Bacteria | 1830 |
| 367 | Ga0451853_2254729 | 3300041512 | Bacteria | 2188 |
| 368 | Ga0439452_000020 | 3300042010 | Bacteria | 309345 |
| 369 | Ga0450888_001864 | 3300042126 | Bacteria | 2041 |
| 370 | Ga0450898_015288 | 3300042134 | Bacteria | 1299 |
| 371 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 372 | Ga0466969_0043134 | 3300044656 | Bacteria | 2248 |
| 373 | Ga0466965_0004523 | 3300044683 | Bacteria | 6189 |
| 374 | Ga0466966_0159658 | 3300044684 | Bacteria | 1373 |
| 375 | Ga0466961_0270045 | 3300044693 | Bacteria | 1042 |
| 376 | Ga0466963_0099901 | 3300044694 | Bacteria | 1985 |
| 377 | Ga0466963_0551100 | 3300044694 | Bacteria | 814 |
| 378 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 379 | Ga0453684_0006299 | 3300044712 | Bacteria | 22682 |
| 380 | Ga0453684_0070320 | 3300044712 | Unclassified | 4433 |
| 381 | Ga0453684_0110387 | 3300044712 | Bacteria | 3343 |
| 382 | Ga0453684_0228695 | 3300044712 | Bacteria | 2149 |
| 383 | Ga0466960_0205438 | 3300044901 | Bacteria | 1078 |
| 384 | Ga0466959_0029349 | 3300045049 | Bacteria | 4075 |
| 385 | Ga0466959_0118067 | 3300045049 | Bacteria | 1888 |
| 386 | Ga0451576_0023858 | 3300045051 | Bacteria | 6617 |
| 387 | Ga0466958_0056212 | 3300045836 | Bacteria | 2390 |
| 388 | Ga0466967_0552490 | 3300045976 | Bacteria | 1133 |
| 389 | Ga0495638_0000602 | 3300046460 | Bacteria | 40434 |
| 390 | Ga0495650_0000454 | 3300046471 | Bacteria | 64731 |
| 391 | Ga0495580_0303097 | 3300046472 | Unclassified | 1088 |
| 392 | Ga0495605_0011627 | 3300046474 | Bacteria | 4899 |
| 393 | Ga0495607_0000962 | 3300046501 | Bacteria | 26634 |
| 394 | Ga0495583_0000553 | 3300046506 | Bacteria | 52333 |
| 395 | Ga0495616_0000178 | 3300046513 | Bacteria | 54382 |
| 396 | Ga0495631_0000838 | 3300046518 | Bacteria | 19541 |
| 397 | Ga0495632_0000110 | 3300046519 | Bacteria | 84473 |
| 398 | Ga0495637_0004155 | 3300046520 | Bacteria | 7533 |
| 399 | Ga0495643_0015981 | 3300046522 | Bacteria | 4419 |
| 400 | Ga0495643_0183825 | 3300046522 | Bacteria | 1014 |
| 401 | Ga0495642_0006402 | 3300046528 | Bacteria | 4516 |
| 402 | Ga0495654_0010562 | 3300046530 | Bacteria | 5023 |
| 403 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 404 | Ga0495625_0524774 | 3300046660 | Bacteria | 721 |
| 405 | Ga0495661_0000207 | 3300046665 | Bacteria | 67846 |
| 406 | Ga0495661_0000723 | 3300046665 | Bacteria | 32427 |
| 407 | Ga0495661_0004690 | 3300046665 | Bacteria | 9817 |
| 408 | Ga0495658_0321157 | 3300046683 | Bacteria | 981 |
| 409 | Ga0495613_0232896 | 3300046689 | Bacteria | 1290 |
| 410 | Ga0495671_0046698 | 3300046692 | Bacteria | 2165 |
| 411 | Ga0495649_0245336 | 3300046694 | Bacteria | 921 |
| 412 | Ga0495589_0000009 | 3300046794 | Bacteria | 256265 |
| 413 | Ga0495672_0035241 | 3300047320 | Bacteria | 3083 |
| 414 | Ga0495687_000013 | 3300047443 | Bacteria | 371058 |
| 415 | Ga0495687_000811 | 3300047443 | Bacteria | 33635 |
| 416 | Ga0495677_0000024 | 3300047445 | Bacteria | 99215 |
| 417 | Ga0495679_000373 | 3300047446 | Bacteria | 34281 |
| 418 | Ga0495686_0094149 | 3300047472 | Bacteria | 1816 |
| 419 | Ga0495626_0000151 | 3300048091 | Bacteria | 86296 |
| 420 | Ga0495626_0005839 | 3300048091 | Bacteria | 7100 |
| 421 | Ga0496101_0327181 | 3300048904 | Bacteria | 1203 |
| 422 | Ga0496101_0638075 | 3300048904 | Bacteria | 842 |
| 423 | Ga0496105_0379287 | 3300048908 | Bacteria | 1125 |
| 424 | Ga0496109_0084440 | 3300048912 | Bacteria | 2930 |
| 425 | Ga0496112_0190493 | 3300048915 | Bacteria | 2013 |
| 426 | Ga0496116_0000500 | 3300048919 | Bacteria | 53809 |
| 427 | Ga0496116_0061746 | 3300048919 | Bacteria | 2424 |
| 428 | Ga0496117_0002526 | 3300048920 | Bacteria | 22920 |
| 429 | Ga0496117_0026078 | 3300048920 | Bacteria | 4580 |
| 430 | Ga0496118_0002734 | 3300048921 | Bacteria | 23211 |
| 431 | Ga0496118_0006575 | 3300048921 | Bacteria | 12705 |
| 432 | Ga0496118_0023079 | 3300048921 | Bacteria | 5416 |
| 433 | Ga0496118_0068004 | 3300048921 | Bacteria | 2589 |
| 434 | Ga0496119_0001539 | 3300048922 | Bacteria | 27538 |
| 435 | Ga0496121_0002258 | 3300048924 | Bacteria | 30031 |
| 436 | Ga0496122_0029791 | 3300048925 | Bacteria | 4591 |
| 437 | Ga0496122_0362592 | 3300048925 | Bacteria | 751 |
| 438 | Ga0496124_0013995 | 3300048927 | Bacteria | 7786 |
| 439 | Ga0496124_0081936 | 3300048927 | Bacteria | 2650 |
| 440 | Ga0496124_0147571 | 3300048927 | Bacteria | 1849 |
| 441 | Ga0496125_0038497 | 3300048928 | Bacteria | 4137 |
| 442 | Ga0501299_016515 | 3300049522 | Bacteria | 1308 |
| 443 | Ga0501032_0122988 | 3300049569 | Bacteria | 1715 |
| 444 | Ga0501033_0043001 | 3300049570 | Bacteria | 3366 |
| 445 | Ga0501034_0009667 | 3300049571 | Bacteria | 10086 |
| 446 | Ga0501034_0076207 | 3300049571 | Bacteria | 3361 |
| 447 | Ga0501036_0003972 | 3300049572 | Bacteria | 11886 |
| 448 | Ga0501037_0007267 | 3300049573 | Bacteria | 8095 |
| 449 | Ga0501037_0056280 | 3300049573 | Bacteria | 2873 |
| 450 | Ga0501039_0015272 | 3300049575 | Bacteria | 5878 |
| 451 | Ga0501040_0031414 | 3300049576 | Bacteria | 3589 |
| 452 | Ga0501040_0418220 | 3300049576 | Bacteria | 963 |
| 453 | Ga0501041_0073283 | 3300049577 | Bacteria | 2104 |
| 454 | Ga0501042_0031694 | 3300049578 | Bacteria | 3740 |
| 455 | Ga0501043_0137738 | 3300049579 | Bacteria | 1912 |
| 456 | Ga0501043_0212519 | 3300049579 | Bacteria | 1499 |
| 457 | Ga0501043_0457693 | 3300049579 | Bacteria | 958 |
| 458 | Ga0501046_0103190 | 3300049580 | Bacteria | 2186 |
| 459 | Ga0501047_0036234 | 3300049581 | Bacteria | 4767 |
| 460 | Ga0501070_0046029 | 3300049586 | Bacteria | 3628 |
| 461 | Ga0501070_0084292 | 3300049586 | Bacteria | 2631 |
| 462 | Ga0501070_0291991 | 3300049586 | Bacteria | 1329 |
| 463 | Ga0501072_0002633 | 3300049588 | Bacteria | 13458 |
| 464 | Ga0501072_0007546 | 3300049588 | Bacteria | 8254 |
| 465 | Ga0501073_0106349 | 3300049589 | Bacteria | 1947 |
| 466 | Ga0501073_0429424 | 3300049589 | Bacteria | 913 |
| 467 | Ga0501074_0089544 | 3300049590 | Bacteria | 2204 |
| 468 | Ga0501075_0002089 | 3300049591 | Bacteria | 13202 |
| 469 | Ga0501075_0086520 | 3300049591 | Bacteria | 2375 |
| 470 | Ga0501075_0417637 | 3300049591 | Bacteria | 1023 |
| 471 | Ga0501076_0002054 | 3300049592 | Bacteria | 13793 |
| 472 | Ga0501077_0016257 | 3300049593 | Bacteria | 4687 |
| 473 | Ga0501077_0104031 | 3300049593 | Bacteria | 1799 |
| 474 | Ga0501079_0101119 | 3300049741 | Bacteria | 2235 |
| 475 | Ga0501080_0362672 | 3300049742 | Bacteria | 1307 |
| 476 | Ga0501081_0122483 | 3300049743 | Bacteria | 1853 |
| 477 | Ga0501035_0023170 | 3300049822 | Bacteria | 5696 |
| 478 | Ga0501035_0032015 | 3300049822 | Bacteria | 4788 |
| 479 | Ga0501044_0052019 | 3300049823 | Bacteria | 4223 |
| 480 | Ga0501044_0124526 | 3300049823 | Bacteria | 2576 |
| 481 | Ga0501045_0047245 | 3300049824 | Bacteria | 3135 |
| 482 | nmdc:mga0yw44_221884_c1 | 3300050492 | Bacteria | 1253 |
| 483 | nmdc:mga05p37_19510_c1 | 3300050507 | Bacteria | 8201 |
| 484 | nmdc:mga0n895_193051_c1 | 3300050512 | Bacteria | 2067 |
| 485 | nmdc:mga0a205_169116_c1 | 3300050515 | Bacteria | 2081 |
| 486 | nmdc:mga0sz30_45853_c1 | 3300050516 | Bacteria | 1844 |
| 487 | Ga0495619_0276360 | 3300053085 | Bacteria | 1164 |
| 488 | Ga0500647_0217439 | 3300053091 | Bacteria | 858 |
| 489 | Ga0500583_0129257 | 3300053092 | Bacteria | 1252 |
| 490 | Ga0500595_009012 | 3300053119 | Bacteria | 4053 |
| 491 | Ga0500617_092539 | 3300053124 | Bacteria | 1291 |
| 492 | Ga0500652_157144 | 3300053131 | Bacteria | 941 |
| 493 | Ga0500658_0013446 | 3300053134 | Bacteria | 3024 |
| 494 | Ga0500559_0005494 | 3300053136 | Bacteria | 5829 |
| 495 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 496 | Ga0500616_0002276 | 3300053153 | Bacteria | 16286 |
| 497 | Ga0500616_0096217 | 3300053153 | Bacteria | 1456 |
| 498 | Ga0500616_0184370 | 3300053153 | Bacteria | 937 |
| 499 | Ga0500627_0001581 | 3300053158 | Bacteria | 6414 |
| 500 | Ga0500634_0000104 | 3300053161 | Bacteria | 32418 |
| 501 | Ga0500645_018722 | 3300053730 | Bacteria | 2160 |
| 502 | Ga0501084_0654521 | 3300054114 | Unclassified | 887 |
| 503 | Ga0590071_011742 | 3300059421 | Bacteria | 2050 |
| 504 | Ga0587082_016198 | 3300059504 | Bacteria | 1161 |
| 505 | Ga0587088_013855 | 3300059508 | Bacteria | 1245 |
| 506 | Ga0587091_010222 | 3300059511 | Bacteria | 1432 |
| 507 | Ga0587072_034318 | 3300059643 | Bacteria | 961 |
| 508 | Ga0501082_0070695 | 3300060353 | Bacteria | 3005 |
| 509 | Ga0530510_0003659 | 3300061734 | Bacteria | 10586 |
| 510 | Ga0530510_0129888 | 3300061734 | Bacteria | 1853 |
| 511 | Ga0530510_0393242 | 3300061734 | Bacteria | 1044 |
| 512 | Ga0530510_0419788 | 3300061734 | Bacteria | 1010 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0621164 | Ga0436361_0621164_1624_2262 | 209 |
| 2 | iso_pu_bacteria | 2928125067 | 2928130580 | 213 |
| 3 | 3300046660 | Ga0495625_0524774 | Ga0495625_0524774_37_693 | 215 |
| 4 | 3300053131 | Ga0500652_157144 | Ga0500652_157144_21_680 | 216 |
| 5 | 3300048904 | Ga0496101_0327181 | Ga0496101_0327181_530_1189 | 217 |
| 6 | iso_pu_bacteria | 2916000859 | 2916003748 | 226 |
| 7 | iso_pu_bacteria | 2916014648 | 2916019158 | 226 |
| 8 | iso_pu_bacteria | 2916021584 | 2916026511 | 226 |
| 9 | iso_pu_bacteria | 2916041962 | 2916046379 | 226 |
| 10 | iso_pu_bacteria | 2916076590 | 2916078848 | 226 |
| 11 | iso_pu_bacteria | 2921201388 | 2921202318 | 226 |
| 12 | iso_pu_bacteria | 2921244191 | 2921248815 | 226 |
| 13 | iso_pu_bacteria | 2921282425 | 2921286527 | 226 |
| 14 | iso_pu_bacteria | 2924165586 | 2924169083 | 226 |
| 15 | iso_pu_bacteria | 2924179722 | 2924183159 | 226 |
| 16 | 3300048925 | Ga0496122_0362592 | Ga0496122_0362592_40_735 | 229 |
| 17 | 3300005842 | Ga0068858_100009568 | Ga0068858_1000095686 | 230 |
| 18 | 3300014326 | Ga0157380_10118415 | Ga0157380_101184153 | 230 |
| 19 | 3300031018 | Ga0265773_1005943 | Ga0265773_10059432 | 230 |
| 20 | 3300037853 | Ga0436364_1254782 | Ga0436364_1254782_2453_3154 | 230 |
| 21 | 3300038443 | Ga0395901_0468165 | Ga0395901_0468165_42_740 | 230 |
| 22 | 3300044694 | Ga0466963_0551100 | Ga0466963_0551100_23_724 | 230 |
| 23 | 3300025916 | Ga0207663_10076305 | Ga0207663_100763053 | 231 |
| 24 | 3300035113 | Ga0373936_0208261 | Ga0373936_0208261_46_750 | 231 |
| 25 | 3300035119 | Ga0373956_0253161 | Ga0373956_0253161_26_730 | 231 |
| 26 | 3300037068 | Ga0373925_0595679 | Ga0373925_0595679_148_852 | 231 |
| 27 | 3300026142 | Ga0207698_10040440 | Ga0207698_100404402 | 235 |
| 28 | 3300048904 | Ga0496101_0638075 | Ga0496101_0638075_18_752 | 240 |
| 29 | 3300009551 | Ga0105238_10099470 | Ga0105238_100994702 | 245 |
| 30 | 3300025924 | Ga0207694_10239393 | Ga0207694_102393932 | 245 |
| 31 | iso_pu_bacteria | 2829745981 | 2829748787 | 249 |
| 32 | iso_pu_bacteria | 2861691609 | 2861696301 | 249 |
| 33 | iso_pu_bacteria | 2503198000 | 2503201001 | 250 |
| 34 | iso_pu_bacteria | 2510065057 | 2510306796 | 250 |
| 35 | iso_pu_bacteria | 2511231007 | 2511273013 | 250 |
| 36 | iso_pu_bacteria | 2511231052 | 2511498284 | 250 |
| 37 | iso_pu_bacteria | 2513237305 | 2514422870 | 250 |
| 38 | iso_pu_bacteria | 2516653046 | 2516896078 | 250 |
| 39 | iso_pu_bacteria | 2551306086 | 2551696540 | 250 |
| 40 | iso_pu_bacteria | 2551306089 | 2551711524 | 250 |
| 41 | iso_pu_bacteria | 2551306091 | 2551726192 | 250 |
| 42 | iso_pu_bacteria | 2721755686 | 2723577655 | 250 |
| 43 | iso_pu_bacteria | 2818991461 | 2819686269 | 250 |
| 44 | iso_pu_bacteria | 2834028612 | 2834029598 | 250 |
| 45 | iso_pu_bacteria | 2842694124 | 2842695107 | 250 |
| 46 | iso_pu_bacteria | 2876392853 | 2876398836 | 250 |
| 47 | iso_pu_bacteria | 2881161766 | 2881163049 | 250 |
| 48 | iso_pu_bacteria | 2904659560 | 2904665368 | 250 |
| 49 | iso_pu_bacteria | 2937002841 | 2937007542 | 250 |
| 50 | iso_pu_bacteria | 2937009748 | 2937014052 | 250 |
| 51 | iso_pu_bacteria | 2937016420 | 2937020230 | 250 |
| 52 | iso_pu_bacteria | 2937091812 | 2937095014 | 250 |
| 53 | iso_pu_bacteria | 2937106411 | 2937106811 | 250 |
| 54 | iso_pu_bacteria | 2939679117 | 2939684650 | 250 |
| 55 | iso_pu_bacteria | 2957382221 | 2957386518 | 250 |
| 56 | iso_pu_bacteria | 2957402308 | 2957406814 | 250 |
| 57 | iso_pu_bacteria | 2957415311 | 2957421689 | 250 |
| 58 | iso_pu_bacteria | 2957457609 | 2957461495 | 250 |
| 59 | iso_pu_bacteria | 2957464669 | 2957469279 | 250 |
| 60 | iso_pu_bacteria | 2960584000 | 2960589721 | 250 |
| 61 | iso_pu_bacteria | 2960603979 | 2960609437 | 250 |
| 62 | iso_pu_bacteria | 2960610863 | 2960615634 | 250 |
| 63 | iso_pu_bacteria | 2960667422 | 2960667927 | 250 |
| 64 | iso_pu_bacteria | 2961114664 | 2961120368 | 250 |
| 65 | iso_pu_bacteria | 2964621998 | 2964626485 | 250 |
| 66 | iso_pu_bacteria | 2964643177 | 2964645363 | 250 |
| 67 | iso_pu_bacteria | 2964656573 | 2964660642 | 250 |
| 68 | iso_pu_bacteria | 2964670856 | 2964670971 | 250 |
| 69 | iso_pu_bacteria | 2964685014 | 2964689971 | 250 |
| 70 | iso_pu_bacteria | 2964691889 | 2964695562 | 250 |
| 71 | iso_pu_bacteria | 2967664464 | 2967670064 | 250 |
| 72 | iso_pu_bacteria | 2967671571 | 2967677389 | 250 |
| 73 | iso_pu_bacteria | 2967699805 | 2967700691 | 250 |
| 74 | iso_pu_bacteria | 2967714385 | 2967717236 | 250 |
| 75 | iso_pu_bacteria | 2967735183 | 2967739821 | 250 |
| 76 | iso_pu_bacteria | 2967742019 | 2967746273 | 250 |
| 77 | iso_pu_bacteria | 2968110612 | 2968116835 | 250 |
| 78 | iso_pu_bacteria | 2970088815 | 2970092920 | 250 |
| 79 | iso_pu_bacteria | 2970095765 | 2970098704 | 250 |
| 80 | iso_pu_bacteria | 2970177841 | 2970179098 | 250 |
| 81 | iso_pu_bacteria | 2970184632 | 2970190169 | 250 |
| 82 | iso_pu_bacteria | 2977516862 | 2977522429 | 250 |
| 83 | iso_pu_bacteria | 2977523885 | 2977527537 | 250 |
| 84 | iso_pu_bacteria | 648276728 | 648738381 | 250 |
| 85 | iso_pu_bacteria | 8019504834 | 8019505371 | 250 |
| 86 | 3300017792 | Ga0163161_10199212 | Ga0163161_101992122 | 251 |
| 87 | 3300045051 | Ga0451576_0023858 | Ga0451576_0023858_27_788 | 251 |
| 88 | iso_pu_bacteria | 2513237104 | 2513722810 | 251 |
| 89 | iso_pu_bacteria | 2935630451 | 2935638025 | 251 |
| 90 | iso_pu_bacteria | 2935883170 | 2935890683 | 251 |
| 91 | iso_pu_bacteria | 2941507105 | 2941514667 | 251 |
| 92 | iso_pu_bacteria | 2941515067 | 2941522589 | 251 |
| 93 | iso_pu_bacteria | 2941523033 | 2941530531 | 251 |
| 94 | iso_pu_bacteria | 8056681323 | 8056689021 | 251 |
| 95 | 3300005290 | Ga0065712_10103794 | Ga0065712_101037942 | 252 |
| 96 | 3300005331 | Ga0070670_100159876 | Ga0070670_1001598762 | 252 |
| 97 | 3300005983 | Ga0081540_1006514 | Ga0081540_10065147 | 252 |
| 98 | 3300006358 | Ga0068871_100751633 | Ga0068871_1007516331 | 252 |
| 99 | 3300007076 | Ga0075435_100200335 | Ga0075435_1002003351 | 252 |
| 100 | 3300009551 | Ga0105238_10164968 | Ga0105238_101649682 | 252 |
| 101 | 3300013306 | Ga0163162_10275686 | Ga0163162_102756862 | 252 |
| 102 | 3300025925 | Ga0207650_10095014 | Ga0207650_100950142 | 252 |
| 103 | 3300026121 | Ga0207683_10669916 | Ga0207683_106699161 | 252 |
| 104 | 3300028800 | Ga0265338_10033340 | Ga0265338_100333405 | 252 |
| 105 | 3300042876 | Ga0451577_0000001 | Ga0451577_0000001_1497429_1498193 | 252 |
| 106 | 3300049570 | Ga0501033_0043001 | Ga0501033_0043001_1193_1963 | 252 |
| 107 | 3300049573 | Ga0501037_0007267 | Ga0501037_0007267_5220_5990 | 252 |
| 108 | 3300049579 | Ga0501043_0457693 | Ga0501043_0457693_63_833 | 252 |
| 109 | 3300049823 | Ga0501044_0124526 | Ga0501044_0124526_145_915 | 252 |
| 110 | 3300053136 | Ga0500559_0005494 | Ga0500559_0005494_718_1482 | 252 |
| 111 | 3300003215 | JGI25153J46596_10004924 | JGI25153J46596_100049246 | 253 |
| 112 | 3300003320 | rootH2_10008034 | rootH2_1000803418 | 253 |
| 113 | 3300003322 | rootL2_10000040 | rootL2_100000408 | 253 |
| 114 | 3300003323 | rootH1_10008851 | rootH1_1000885114 | 253 |
| 115 | 3300005330 | Ga0070690_100031713 | Ga0070690_1000317133 | 253 |
| 116 | 3300005336 | Ga0070680_100288905 | Ga0070680_1002889051 | 253 |
| 117 | 3300005353 | Ga0070669_100639490 | Ga0070669_1006394901 | 253 |
| 118 | 3300005366 | Ga0070659_100165743 | Ga0070659_1001657432 | 253 |
| 119 | 3300005436 | Ga0070713_100054174 | Ga0070713_1000541742 | 253 |
| 120 | 3300005441 | Ga0070700_100214121 | Ga0070700_1002141212 | 253 |
| 121 | 3300005444 | Ga0070694_100124788 | Ga0070694_1001247881 | 253 |
| 122 | 3300005455 | Ga0070663_100011657 | Ga0070663_1000116573 | 253 |
| 123 | 3300005457 | Ga0070662_100121276 | Ga0070662_1001212762 | 253 |
| 124 | 3300005458 | Ga0070681_10012085 | Ga0070681_100120852 | 253 |
| 125 | 3300005459 | Ga0068867_100399708 | Ga0068867_1003997082 | 253 |
| 126 | 3300005466 | Ga0070685_10095167 | Ga0070685_100951672 | 253 |
| 127 | 3300005471 | Ga0070698_100331444 | Ga0070698_1003314442 | 253 |
| 128 | 3300005530 | Ga0070679_100402247 | Ga0070679_1004022472 | 253 |
| 129 | 3300005544 | Ga0070686_100391816 | Ga0070686_1003918161 | 253 |
| 130 | 3300005563 | Ga0068855_100080587 | Ga0068855_1000805871 | 253 |
| 131 | 3300005577 | Ga0068857_100846168 | Ga0068857_1008461681 | 253 |
| 132 | 3300005618 | Ga0068864_100557814 | Ga0068864_1005578141 | 253 |
| 133 | 3300005843 | Ga0068860_100457721 | Ga0068860_1004577212 | 253 |
| 134 | 3300005844 | Ga0068862_100008309 | Ga0068862_1000083096 | 253 |
| 135 | 3300006186 | Ga0075369_10026822 | Ga0075369_100268222 | 253 |
| 136 | 3300006881 | Ga0068865_100628562 | Ga0068865_1006285621 | 253 |
| 137 | 3300009093 | Ga0105240_10019120 | Ga0105240_100191204 | 253 |
| 138 | 3300009093 | Ga0105240_10131728 | Ga0105240_101317283 | 253 |
| 139 | 3300009177 | Ga0105248_10648508 | Ga0105248_106485081 | 253 |
| 140 | 3300009545 | Ga0105237_10455149 | Ga0105237_104551492 | 253 |
| 141 | 3300013102 | Ga0157371_10342053 | Ga0157371_103420532 | 253 |
| 142 | 3300013104 | Ga0157370_10371367 | Ga0157370_103713672 | 253 |
| 143 | 3300013105 | Ga0157369_10470432 | Ga0157369_104704322 | 253 |
| 144 | 3300013307 | Ga0157372_10129704 | Ga0157372_101297043 | 253 |
| 145 | 3300013308 | Ga0157375_10391174 | Ga0157375_103911742 | 253 |
| 146 | 3300020078 | Ga0206352_10208239 | Ga0206352_102082392 | 253 |
| 147 | 3300022467 | Ga0224712_10096016 | Ga0224712_100960161 | 253 |
| 148 | 3300025297 | Ga0209758_1000628 | Ga0209758_100062848 | 253 |
| 149 | 3300025912 | Ga0207707_10028611 | Ga0207707_100286112 | 253 |
| 150 | 3300025913 | Ga0207695_10105007 | Ga0207695_101050073 | 253 |
| 151 | 3300025917 | Ga0207660_10464829 | Ga0207660_104648292 | 253 |
| 152 | 3300025921 | Ga0207652_10472567 | Ga0207652_104725672 | 253 |
| 153 | 3300025923 | Ga0207681_10469445 | Ga0207681_104694451 | 253 |
| 154 | 3300025928 | Ga0207700_10201213 | Ga0207700_102012132 | 253 |
| 155 | 3300025938 | Ga0207704_10609887 | Ga0207704_106098871 | 253 |
| 156 | 3300025944 | Ga0207661_10160996 | Ga0207661_101609962 | 253 |
| 157 | 3300025945 | Ga0207679_10011547 | Ga0207679_100115473 | 253 |
| 158 | 3300025949 | Ga0207667_10050878 | Ga0207667_100508783 | 253 |
| 159 | 3300026023 | Ga0207677_10369714 | Ga0207677_103697142 | 253 |
| 160 | 3300026067 | Ga0207678_10022160 | Ga0207678_100221604 | 253 |
| 161 | 3300026089 | Ga0207648_10291027 | Ga0207648_102910271 | 253 |
| 162 | 3300026116 | Ga0207674_10707190 | Ga0207674_107071902 | 253 |
| 163 | 3300028380 | Ga0268265_10075892 | Ga0268265_100758922 | 253 |
| 164 | 3300028381 | Ga0268264_10409607 | Ga0268264_104096072 | 253 |
| 165 | 3300028556 | Ga0265337_1033854 | Ga0265337_10338541 | 253 |
| 166 | 3300031238 | Ga0265332_10005214 | Ga0265332_100052142 | 253 |
| 167 | 3300031251 | Ga0265327_10005325 | Ga0265327_100053258 | 253 |
| 168 | 3300031548 | Ga0307408_100023592 | Ga0307408_1000235922 | 253 |
| 169 | 3300031711 | Ga0265314_10002337 | Ga0265314_100023378 | 253 |
| 170 | 3300031711 | Ga0265314_10014389 | Ga0265314_100143894 | 253 |
| 171 | 3300031731 | Ga0307405_10139995 | Ga0307405_101399952 | 253 |
| 172 | 3300031824 | Ga0307413_10071079 | Ga0307413_100710791 | 253 |
| 173 | 3300031852 | Ga0307410_10152579 | Ga0307410_101525792 | 253 |
| 174 | 3300031901 | Ga0307406_10088928 | Ga0307406_100889282 | 253 |
| 175 | 3300031901 | Ga0307406_10117275 | Ga0307406_101172752 | 253 |
| 176 | 3300031911 | Ga0307412_10024423 | Ga0307412_100244232 | 253 |
| 177 | 3300031995 | Ga0307409_100057975 | Ga0307409_1000579753 | 253 |
| 178 | 3300031995 | Ga0307409_100105483 | Ga0307409_1001054832 | 253 |
| 179 | 3300032002 | Ga0307416_100111070 | Ga0307416_1001110702 | 253 |
| 180 | 3300032004 | Ga0307414_10129784 | Ga0307414_101297842 | 253 |
| 181 | 3300032005 | Ga0307411_10158042 | Ga0307411_101580421 | 253 |
| 182 | 3300032126 | Ga0307415_100071567 | Ga0307415_1000715672 | 253 |
| 183 | 3300035172 | Ga0373955_0106974 | Ga0373955_0106974_560_1360 | 253 |
| 184 | 3300037068 | Ga0373925_0282994 | Ga0373925_0282994_388_1188 | 253 |
| 185 | 3300037466 | Ga0395898_0274010 | Ga0395898_0274010_37_822 | 253 |
| 186 | 3300038726 | Ga0400490_10463 | Ga0400490_10463_3681_4451 | 253 |
| 187 | 3300039062 | Ga0400483_183966 | Ga0400483_183966_20919_21692 | 253 |
| 188 | 3300041512 | Ga0451853_2254729 | Ga0451853_2254729_413_1186 | 253 |
| 189 | 3300042134 | Ga0450898_015288 | Ga0450898_015288_252_1025 | 253 |
| 190 | 3300044684 | Ga0466966_0159658 | Ga0466966_0159658_21_797 | 253 |
| 191 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_846415_847188 | 253 |
| 192 | 3300044712 | Ga0453684_0110387 | Ga0453684_0110387_1469_2236 | 253 |
| 193 | 3300044712 | Ga0453684_0228695 | Ga0453684_0228695_1064_1831 | 253 |
| 194 | 3300046689 | Ga0495613_0232896 | Ga0495613_0232896_245_1018 | 253 |
| 195 | 3300048908 | Ga0496105_0379287 | Ga0496105_0379287_147_920 | 253 |
| 196 | 3300048921 | Ga0496118_0006575 | Ga0496118_0006575_3108_3881 | 253 |
| 197 | 3300048921 | Ga0496118_0023079 | Ga0496118_0023079_2801_3574 | 253 |
| 198 | 3300049571 | Ga0501034_0076207 | Ga0501034_0076207_2115_2882 | 253 |
| 199 | 3300049572 | Ga0501036_0003972 | Ga0501036_0003972_1295_2068 | 253 |
| 200 | 3300049575 | Ga0501039_0015272 | Ga0501039_0015272_411_1184 | 253 |
| 201 | 3300049576 | Ga0501040_0031414 | Ga0501040_0031414_71_844 | 253 |
| 202 | 3300049576 | Ga0501040_0418220 | Ga0501040_0418220_111_881 | 253 |
| 203 | 3300049577 | Ga0501041_0073283 | Ga0501041_0073283_456_1229 | 253 |
| 204 | 3300049578 | Ga0501042_0031694 | Ga0501042_0031694_1677_2450 | 253 |
| 205 | 3300049579 | Ga0501043_0212519 | Ga0501043_0212519_703_1476 | 253 |
| 206 | 3300049586 | Ga0501070_0046029 | Ga0501070_0046029_2681_3457 | 253 |
| 207 | 3300049586 | Ga0501070_0291991 | Ga0501070_0291991_165_938 | 253 |
| 208 | 3300049588 | Ga0501072_0002633 | Ga0501072_0002633_3566_4339 | 253 |
| 209 | 3300049590 | Ga0501074_0089544 | Ga0501074_0089544_24_797 | 253 |
| 210 | 3300049591 | Ga0501075_0002089 | Ga0501075_0002089_5202_5975 | 253 |
| 211 | 3300049591 | Ga0501075_0086520 | Ga0501075_0086520_1190_1960 | 253 |
| 212 | 3300049592 | Ga0501076_0002054 | Ga0501076_0002054_9977_10750 | 253 |
| 213 | 3300049593 | Ga0501077_0016257 | Ga0501077_0016257_3120_3893 | 253 |
| 214 | 3300049593 | Ga0501077_0104031 | Ga0501077_0104031_464_1237 | 253 |
| 215 | 3300049741 | Ga0501079_0101119 | Ga0501079_0101119_222_995 | 253 |
| 216 | 3300049742 | Ga0501080_0362672 | Ga0501080_0362672_158_925 | 253 |
| 217 | 3300049743 | Ga0501081_0122483 | Ga0501081_0122483_623_1396 | 253 |
| 218 | 3300049822 | Ga0501035_0032015 | Ga0501035_0032015_71_844 | 253 |
| 219 | 3300049824 | Ga0501045_0047245 | Ga0501045_0047245_1182_1955 | 253 |
| 220 | 3300050516 | nmdc:mga0sz30_45853_c1 | nmdc:mga0sz30_45853_c1_785_1558 | 253 |
| 221 | 3300053153 | Ga0500616_0002276 | Ga0500616_0002276_5160_5927 | 253 |
| 222 | 3300053153 | Ga0500616_0184370 | Ga0500616_0184370_85_855 | 253 |
| 223 | 3300053158 | Ga0500627_0001581 | Ga0500627_0001581_2986_3759 | 253 |
| 224 | 3300053730 | Ga0500645_018722 | Ga0500645_018722_214_987 | 253 |
| 225 | 3300054114 | Ga0501084_0654521 | Ga0501084_0654521_88_861 | 253 |
| 226 | 3300060353 | Ga0501082_0070695 | Ga0501082_0070695_1363_2136 | 253 |
| 227 | 3300061734 | Ga0530510_0003659 | Ga0530510_0003659_6443_7216 | 253 |
| 228 | 3300061734 | Ga0530510_0393242 | Ga0530510_0393242_131_901 | 253 |
| 229 | iso_pu_bacteria | 8016630954 | 8016632918 | 253 |
| 230 | 3300004800 | Ga0058861_12075980 | Ga0058861_120759801 | 254 |
| 231 | 3300005288 | Ga0065714_10068111 | Ga0065714_100681114 | 254 |
| 232 | 3300005289 | Ga0065704_10075142 | Ga0065704_100751425 | 254 |
| 233 | 3300005293 | Ga0065715_10222802 | Ga0065715_102228021 | 254 |
| 234 | 3300005327 | Ga0070658_10010293 | Ga0070658_100102932 | 254 |
| 235 | 3300005327 | Ga0070658_10043883 | Ga0070658_100438832 | 254 |
| 236 | 3300005330 | Ga0070690_100036391 | Ga0070690_1000363912 | 254 |
| 237 | 3300005334 | Ga0068869_100053794 | Ga0068869_1000537942 | 254 |
| 238 | 3300005336 | Ga0070680_100007419 | Ga0070680_1000074194 | 254 |
| 239 | 3300005336 | Ga0070680_100097059 | Ga0070680_1000970593 | 254 |
| 240 | 3300005340 | Ga0070689_100193624 | Ga0070689_1001936242 | 254 |
| 241 | 3300005353 | Ga0070669_100023032 | Ga0070669_1000230324 | 254 |
| 242 | 3300005366 | Ga0070659_100441739 | Ga0070659_1004417392 | 254 |
| 243 | 3300005436 | Ga0070713_100022820 | Ga0070713_1000228204 | 254 |
| 244 | 3300005436 | Ga0070713_100389447 | Ga0070713_1003894472 | 254 |
| 245 | 3300005437 | Ga0070710_10030913 | Ga0070710_100309132 | 254 |
| 246 | 3300005437 | Ga0070710_10214402 | Ga0070710_102144021 | 254 |
| 247 | 3300005439 | Ga0070711_100056035 | Ga0070711_1000560352 | 254 |
| 248 | 3300005456 | Ga0070678_100016026 | Ga0070678_1000160265 | 254 |
| 249 | 3300005456 | Ga0070678_100031710 | Ga0070678_1000317103 | 254 |
| 250 | 3300005458 | Ga0070681_10007242 | Ga0070681_100072429 | 254 |
| 251 | 3300005458 | Ga0070681_10008929 | Ga0070681_100089293 | 254 |
| 252 | 3300005458 | Ga0070681_10034142 | Ga0070681_100341425 | 254 |
| 253 | 3300005458 | Ga0070681_10066183 | Ga0070681_100661833 | 254 |
| 254 | 3300005459 | Ga0068867_100154765 | Ga0068867_1001547652 | 254 |
| 255 | 3300005467 | Ga0070706_100032224 | Ga0070706_1000322244 | 254 |
| 256 | 3300005467 | Ga0070706_100056635 | Ga0070706_1000566353 | 254 |
| 257 | 3300005467 | Ga0070706_100231754 | Ga0070706_1002317542 | 254 |
| 258 | 3300005468 | Ga0070707_100160425 | Ga0070707_1001604253 | 254 |
| 259 | 3300005471 | Ga0070698_100000229 | Ga0070698_10000022917 | 254 |
| 260 | 3300005471 | Ga0070698_100009796 | Ga0070698_1000097962 | 254 |
| 261 | 3300005471 | Ga0070698_100099966 | Ga0070698_1000999663 | 254 |
| 262 | 3300005471 | Ga0070698_100564484 | Ga0070698_1005644841 | 254 |
| 263 | 3300005518 | Ga0070699_100026893 | Ga0070699_1000268933 | 254 |
| 264 | 3300005518 | Ga0070699_100459014 | Ga0070699_1004590141 | 254 |
| 265 | 3300005530 | Ga0070679_100011032 | Ga0070679_1000110323 | 254 |
| 266 | 3300005530 | Ga0070679_100030534 | Ga0070679_1000305343 | 254 |
| 267 | 3300005530 | Ga0070679_100086879 | Ga0070679_1000868792 | 254 |
| 268 | 3300005530 | Ga0070679_100169517 | Ga0070679_1001695172 | 254 |
| 269 | 3300005535 | Ga0070684_100014502 | Ga0070684_1000145025 | 254 |
| 270 | 3300005536 | Ga0070697_100071601 | Ga0070697_1000716013 | 254 |
| 271 | 3300005546 | Ga0070696_100002003 | Ga0070696_1000020037 | 254 |
| 272 | 3300005548 | Ga0070665_100048548 | Ga0070665_1000485482 | 254 |
| 273 | 3300005563 | Ga0068855_100001147 | Ga0068855_10000114721 | 254 |
| 274 | 3300005563 | Ga0068855_100009153 | Ga0068855_1000091533 | 254 |
| 275 | 3300005563 | Ga0068855_100082797 | Ga0068855_1000827972 | 254 |
| 276 | 3300005577 | Ga0068857_100189448 | Ga0068857_1001894482 | 254 |
| 277 | 3300005614 | Ga0068856_100016724 | Ga0068856_1000167246 | 254 |
| 278 | 3300005617 | Ga0068859_100115359 | Ga0068859_1001153591 | 254 |
| 279 | 3300005618 | Ga0068864_100927243 | Ga0068864_1009272431 | 254 |
| 280 | 3300005719 | Ga0068861_100613892 | Ga0068861_1006138922 | 254 |
| 281 | 3300005840 | Ga0068870_10066078 | Ga0068870_100660782 | 254 |
| 282 | 3300005937 | Ga0081455_10000679 | Ga0081455_100006795 | 254 |
| 283 | 3300005937 | Ga0081455_10005986 | Ga0081455_100059866 | 254 |
| 284 | 3300005937 | Ga0081455_10131541 | Ga0081455_101315411 | 254 |
| 285 | 3300006028 | Ga0070717_10136601 | Ga0070717_101366012 | 254 |
| 286 | 3300006038 | Ga0075365_10154328 | Ga0075365_101543282 | 254 |
| 287 | 3300006173 | Ga0070716_100000001 | Ga0070716_100000001351 | 254 |
| 288 | 3300006175 | Ga0070712_100162695 | Ga0070712_1001626952 | 254 |
| 289 | 3300006237 | Ga0097621_100081995 | Ga0097621_1000819953 | 254 |
| 290 | 3300006237 | Ga0097621_100394194 | Ga0097621_1003941942 | 254 |
| 291 | 3300006931 | Ga0097620_100115357 | Ga0097620_1001153573 | 254 |
| 292 | 3300007265 | Ga0099794_10005493 | Ga0099794_100054932 | 254 |
| 293 | 3300007788 | Ga0099795_10117592 | Ga0099795_101175921 | 254 |
| 294 | 3300009011 | Ga0105251_10001908 | Ga0105251_100019083 | 254 |
| 295 | 3300009036 | Ga0105244_10000783 | Ga0105244_1000078323 | 254 |
| 296 | 3300009093 | Ga0105240_10035059 | Ga0105240_100350592 | 254 |
| 297 | 3300009093 | Ga0105240_10038367 | Ga0105240_100383676 | 254 |
| 298 | 3300009093 | Ga0105240_10112395 | Ga0105240_101123952 | 254 |
| 299 | 3300009093 | Ga0105240_10441133 | Ga0105240_104411332 | 254 |
| 300 | 3300009098 | Ga0105245_10604829 | Ga0105245_106048292 | 254 |
| 301 | 3300009101 | Ga0105247_10133212 | Ga0105247_101332122 | 254 |
| 302 | 3300009147 | Ga0114129_10096840 | Ga0114129_100968403 | 254 |
| 303 | 3300009174 | Ga0105241_10468572 | Ga0105241_104685721 | 254 |
| 304 | 3300009176 | Ga0105242_10066263 | Ga0105242_100662634 | 254 |
| 305 | 3300009177 | Ga0105248_10556375 | Ga0105248_105563752 | 254 |
| 306 | 3300009545 | Ga0105237_10108814 | Ga0105237_101088142 | 254 |
| 307 | 3300009545 | Ga0105237_10368543 | Ga0105237_103685432 | 254 |
| 308 | 3300009551 | Ga0105238_10008139 | Ga0105238_100081394 | 254 |
| 309 | 3300009551 | Ga0105238_10068035 | Ga0105238_100680352 | 254 |
| 310 | 3300010159 | Ga0099796_10013632 | Ga0099796_100136322 | 254 |
| 311 | 3300010375 | Ga0105239_10133686 | Ga0105239_101336863 | 254 |
| 312 | 3300011119 | Ga0105246_10000490 | Ga0105246_100004902 | 254 |
| 313 | 3300011119 | Ga0105246_10351534 | Ga0105246_103515342 | 254 |
| 314 | 3300013104 | Ga0157370_10002664 | Ga0157370_100026642 | 254 |
| 315 | 3300013104 | Ga0157370_10009088 | Ga0157370_100090885 | 254 |
| 316 | 3300013105 | Ga0157369_10004921 | Ga0157369_100049213 | 254 |
| 317 | 3300013105 | Ga0157369_10080767 | Ga0157369_100807673 | 254 |
| 318 | 3300013296 | Ga0157374_10541760 | Ga0157374_105417602 | 254 |
| 319 | 3300013307 | Ga0157372_10535770 | Ga0157372_105357702 | 254 |
| 320 | 3300013307 | Ga0157372_10948970 | Ga0157372_109489702 | 254 |
| 321 | 3300013308 | Ga0157375_10000629 | Ga0157375_100006298 | 254 |
| 322 | 3300013308 | Ga0157375_10424719 | Ga0157375_104247192 | 254 |
| 323 | 3300014325 | Ga0163163_10003054 | Ga0163163_1000305411 | 254 |
| 324 | 3300014325 | Ga0163163_10288020 | Ga0163163_102880202 | 254 |
| 325 | 3300014497 | Ga0182008_10002216 | Ga0182008_1000221611 | 254 |
| 326 | 3300014968 | Ga0157379_10002195 | Ga0157379_100021953 | 254 |
| 327 | 3300014968 | Ga0157379_10198050 | Ga0157379_101980502 | 254 |
| 328 | 3300014968 | Ga0157379_10204010 | Ga0157379_102040102 | 254 |
| 329 | 3300017792 | Ga0163161_10082936 | Ga0163161_100829362 | 254 |
| 330 | 3300020069 | Ga0197907_10300375 | Ga0197907_103003751 | 254 |
| 331 | 3300020070 | Ga0206356_10118893 | Ga0206356_101188932 | 254 |
| 332 | 3300020070 | Ga0206356_11813778 | Ga0206356_118137781 | 254 |
| 333 | 3300020077 | Ga0206351_10004824 | Ga0206351_100048241 | 254 |
| 334 | 3300020081 | Ga0206354_10552570 | Ga0206354_105525701 | 254 |
| 335 | 3300020082 | Ga0206353_10185489 | Ga0206353_101854891 | 254 |
| 336 | 3300021358 | Ga0213873_10042597 | Ga0213873_100425972 | 254 |
| 337 | 3300021384 | Ga0213876_10017929 | Ga0213876_100179292 | 254 |
| 338 | 3300022467 | Ga0224712_10001804 | Ga0224712_100018045 | 254 |
| 339 | 3300022467 | Ga0224712_10002191 | Ga0224712_100021911 | 254 |
| 340 | 3300022467 | Ga0224712_10020238 | Ga0224712_100202381 | 254 |
| 341 | 3300022467 | Ga0224712_10088131 | Ga0224712_100881312 | 254 |
| 342 | 3300022467 | Ga0224712_10122870 | Ga0224712_101228701 | 254 |
| 343 | 3300022467 | Ga0224712_10145105 | Ga0224712_101451052 | 254 |
| 344 | 3300025735 | Ga0207713_1001686 | Ga0207713_100168617 | 254 |
| 345 | 3300025898 | Ga0207692_10015697 | Ga0207692_100156972 | 254 |
| 346 | 3300025900 | Ga0207710_10161264 | Ga0207710_101612641 | 254 |
| 347 | 3300025901 | Ga0207688_10089314 | Ga0207688_100893142 | 254 |
| 348 | 3300025909 | Ga0207705_10039212 | Ga0207705_100392122 | 254 |
| 349 | 3300025910 | Ga0207684_10016442 | Ga0207684_100164423 | 254 |
| 350 | 3300025910 | Ga0207684_10026203 | Ga0207684_100262033 | 254 |
| 351 | 3300025911 | Ga0207654_10270798 | Ga0207654_102707982 | 254 |
| 352 | 3300025912 | Ga0207707_10003776 | Ga0207707_1000377610 | 254 |
| 353 | 3300025912 | Ga0207707_10014184 | Ga0207707_100141842 | 254 |
| 354 | 3300025912 | Ga0207707_10045534 | Ga0207707_100455343 | 254 |
| 355 | 3300025912 | Ga0207707_10113576 | Ga0207707_101135762 | 254 |
| 356 | 3300025913 | Ga0207695_10006739 | Ga0207695_1000673911 | 254 |
| 357 | 3300025913 | Ga0207695_10042155 | Ga0207695_100421552 | 254 |
| 358 | 3300025913 | Ga0207695_10060575 | Ga0207695_100605753 | 254 |
| 359 | 3300025914 | Ga0207671_10041349 | Ga0207671_100413493 | 254 |
| 360 | 3300025915 | Ga0207693_10025413 | Ga0207693_100254134 | 254 |
| 361 | 3300025915 | Ga0207693_10274472 | Ga0207693_102744722 | 254 |
| 362 | 3300025917 | Ga0207660_10009454 | Ga0207660_100094543 | 254 |
| 363 | 3300025917 | Ga0207660_10011552 | Ga0207660_100115522 | 254 |
| 364 | 3300025917 | Ga0207660_10073983 | Ga0207660_100739832 | 254 |
| 365 | 3300025917 | Ga0207660_10292960 | Ga0207660_102929602 | 254 |
| 366 | 3300025921 | Ga0207652_10006501 | Ga0207652_100065018 | 254 |
| 367 | 3300025921 | Ga0207652_10020131 | Ga0207652_100201313 | 254 |
| 368 | 3300025921 | Ga0207652_10045269 | Ga0207652_100452692 | 254 |
| 369 | 3300025921 | Ga0207652_10101220 | Ga0207652_101012203 | 254 |
| 370 | 3300025924 | Ga0207694_10008696 | Ga0207694_100086966 | 254 |
| 371 | 3300025928 | Ga0207700_10026680 | Ga0207700_100266804 | 254 |
| 372 | 3300025928 | Ga0207700_10151886 | Ga0207700_101518862 | 254 |
| 373 | 3300025928 | Ga0207700_10324709 | Ga0207700_103247091 | 254 |
| 374 | 3300025929 | Ga0207664_10038416 | Ga0207664_100384163 | 254 |
| 375 | 3300025933 | Ga0207706_10180012 | Ga0207706_101800122 | 254 |
| 376 | 3300025936 | Ga0207670_10429549 | Ga0207670_104295491 | 254 |
| 377 | 3300025939 | Ga0207665_10000002 | Ga0207665_10000002223 | 254 |
| 378 | 3300025941 | Ga0207711_10337008 | Ga0207711_103370082 | 254 |
| 379 | 3300025942 | Ga0207689_10109936 | Ga0207689_101099361 | 254 |
| 380 | 3300025949 | Ga0207667_10000927 | Ga0207667_1000092730 | 254 |
| 381 | 3300025949 | Ga0207667_10032914 | Ga0207667_100329142 | 254 |
| 382 | 3300025949 | Ga0207667_10163664 | Ga0207667_101636642 | 254 |
| 383 | 3300026035 | Ga0207703_10016711 | Ga0207703_100167112 | 254 |
| 384 | 3300026078 | Ga0207702_10034771 | Ga0207702_100347715 | 254 |
| 385 | 3300026089 | Ga0207648_10082153 | Ga0207648_100821532 | 254 |
| 386 | 3300026089 | Ga0207648_10363845 | Ga0207648_103638452 | 254 |
| 387 | 3300026095 | Ga0207676_10708763 | Ga0207676_107087631 | 254 |
| 388 | 3300026116 | Ga0207674_10171845 | Ga0207674_101718452 | 254 |
| 389 | 3300026116 | Ga0207674_10746600 | Ga0207674_107466002 | 254 |
| 390 | 3300026118 | Ga0207675_100443047 | Ga0207675_1004430472 | 254 |
| 391 | 3300026121 | Ga0207683_10061340 | Ga0207683_100613404 | 254 |
| 392 | 3300026121 | Ga0207683_10075657 | Ga0207683_100756572 | 254 |
| 393 | 3300026142 | Ga0207698_10312661 | Ga0207698_103126612 | 254 |
| 394 | 3300027111 | Ga0209281_1000547 | Ga0209281_100054725 | 254 |
| 395 | 3300028379 | Ga0268266_10006924 | Ga0268266_100069245 | 254 |
| 396 | 3300028573 | Ga0265334_10003091 | Ga0265334_100030915 | 254 |
| 397 | 3300028573 | Ga0265334_10009303 | Ga0265334_100093033 | 254 |
| 398 | 3300028577 | Ga0265318_10081539 | Ga0265318_100815391 | 254 |
| 399 | 3300028794 | Ga0307515_10006229 | Ga0307515_1000622910 | 254 |
| 400 | 3300031250 | Ga0265331_10003584 | Ga0265331_100035846 | 254 |
| 401 | 3300031251 | Ga0265327_10034980 | Ga0265327_100349802 | 254 |
| 402 | 3300031507 | Ga0307509_10309770 | Ga0307509_103097701 | 254 |
| 403 | 3300031548 | Ga0307408_100004836 | Ga0307408_1000048363 | 254 |
| 404 | 3300031727 | Ga0316576_10162678 | Ga0316576_101626782 | 254 |
| 405 | 3300031728 | Ga0316578_10076786 | Ga0316578_100767863 | 254 |
| 406 | 3300031728 | Ga0316578_10093655 | Ga0316578_100936552 | 254 |
| 407 | 3300031728 | Ga0316578_10260783 | Ga0316578_102607832 | 254 |
| 408 | 3300031733 | Ga0316577_10010591 | Ga0316577_100105916 | 254 |
| 409 | 3300032005 | Ga0307411_10021817 | Ga0307411_100218174 | 254 |
| 410 | 3300032137 | Ga0316585_10054310 | Ga0316585_100543102 | 254 |
| 411 | 3300032139 | Ga0316580_10018799 | Ga0316580_100187992 | 254 |
| 412 | 3300032168 | Ga0316593_10033471 | Ga0316593_100334712 | 254 |
| 413 | 3300033524 | Ga0316592_1003348 | Ga0316592_10033483 | 254 |
| 414 | 3300033541 | Ga0316596_1007122 | Ga0316596_10071222 | 254 |
| 415 | 3300036401 | Ga0373937_0283492 | Ga0373937_0283492_328_1098 | 254 |
| 416 | 3300036647 | Ga0316582_0046478 | Ga0316582_0046478_1435_2205 | 254 |
| 417 | 3300036712 | Ga0316584_0099710 | Ga0316584_0099710_344_1114 | 254 |
| 418 | 3300037068 | Ga0373925_0130487 | Ga0373925_0130487_32_910 | 254 |
| 419 | 3300037312 | Ga0395899_0023786 | Ga0395899_0023786_2723_3577 | 254 |
| 420 | 3300037312 | Ga0395899_0038937 | Ga0395899_0038937_343_1269 | 254 |
| 421 | 3300037418 | Ga0395900_0017307 | Ga0395900_0017307_2046_2900 | 254 |
| 422 | 3300037418 | Ga0395900_0023417 | Ga0395900_0023417_64_990 | 254 |
| 423 | 3300037418 | Ga0395900_0182228 | Ga0395900_0182228_49_834 | 254 |
| 424 | 3300037418 | Ga0395900_0294704 | Ga0395900_0294704_194_967 | 254 |
| 425 | 3300037466 | Ga0395898_0046730 | Ga0395898_0046730_2810_3736 | 254 |
| 426 | 3300037466 | Ga0395898_0077145 | Ga0395898_0077145_1657_2442 | 254 |
| 427 | 3300037471 | Ga0395905_0353349 | Ga0395905_0353349_414_1187 | 254 |
| 428 | 3300037471 | Ga0395905_0421634 | Ga0395905_0421634_357_1130 | 254 |
| 429 | 3300038443 | Ga0395901_0014999 | Ga0395901_0014999_6997_7851 | 254 |
| 430 | 3300038443 | Ga0395901_0024360 | Ga0395901_0024360_2603_3529 | 254 |
| 431 | 3300038725 | Ga0400484_44773 | Ga0400484_44773_1387_2160 | 254 |
| 432 | 3300039062 | Ga0400483_015883 | Ga0400483_015883_2192_2962 | 254 |
| 433 | 3300039062 | Ga0400483_150553 | Ga0400483_150553_61_831 | 254 |
| 434 | 3300039437 | Ga0436365_0296501 | Ga0436365_0296501_162_935 | 254 |
| 435 | 3300039437 | Ga0436365_0319120 | Ga0436365_0319120_10843_11616 | 254 |
| 436 | 3300039438 | Ga0436360_0906789 | Ga0436360_0906789_456_1238 | 254 |
| 437 | 3300039438 | Ga0436360_1262558 | Ga0436360_1262558_471_1244 | 254 |
| 438 | 3300039453 | Ga0436362_0091673 | Ga0436362_0091673_2417_3190 | 254 |
| 439 | 3300039453 | Ga0436362_0144001 | Ga0436362_0144001_22_795 | 254 |
| 440 | 3300039453 | Ga0436362_1282354 | Ga0436362_1282354_1003_1773 | 254 |
| 441 | 3300042010 | Ga0439452_000020 | Ga0439452_000020_256803_257672 | 254 |
| 442 | 3300042126 | Ga0450888_001864 | Ga0450888_001864_858_1631 | 254 |
| 443 | 3300044656 | Ga0466969_0043134 | Ga0466969_0043134_1163_1948 | 254 |
| 444 | 3300044683 | Ga0466965_0004523 | Ga0466965_0004523_2283_3056 | 254 |
| 445 | 3300044693 | Ga0466961_0270045 | Ga0466961_0270045_127_900 | 254 |
| 446 | 3300044694 | Ga0466963_0099901 | Ga0466963_0099901_214_987 | 254 |
| 447 | 3300044712 | Ga0453684_0006299 | Ga0453684_0006299_5179_5949 | 254 |
| 448 | 3300044712 | Ga0453684_0070320 | Ga0453684_0070320_337_1107 | 254 |
| 449 | 3300044901 | Ga0466960_0205438 | Ga0466960_0205438_195_968 | 254 |
| 450 | 3300045049 | Ga0466959_0029349 | Ga0466959_0029349_1919_2707 | 254 |
| 451 | 3300045049 | Ga0466959_0118067 | Ga0466959_0118067_209_991 | 254 |
| 452 | 3300045836 | Ga0466958_0056212 | Ga0466958_0056212_98_883 | 254 |
| 453 | 3300045976 | Ga0466967_0552490 | Ga0466967_0552490_210_1040 | 254 |
| 454 | 3300046460 | Ga0495638_0000602 | Ga0495638_0000602_27456_28229 | 254 |
| 455 | 3300046471 | Ga0495650_0000454 | Ga0495650_0000454_59096_59869 | 254 |
| 456 | 3300046472 | Ga0495580_0303097 | Ga0495580_0303097_204_977 | 254 |
| 457 | 3300046474 | Ga0495605_0011627 | Ga0495605_0011627_3848_4621 | 254 |
| 458 | 3300046501 | Ga0495607_0000962 | Ga0495607_0000962_14214_14987 | 254 |
| 459 | 3300046506 | Ga0495583_0000553 | Ga0495583_0000553_7549_8322 | 254 |
| 460 | 3300046513 | Ga0495616_0000178 | Ga0495616_0000178_30894_31667 | 254 |
| 461 | 3300046518 | Ga0495631_0000838 | Ga0495631_0000838_13544_14317 | 254 |
| 462 | 3300046519 | Ga0495632_0000110 | Ga0495632_0000110_21407_22180 | 254 |
| 463 | 3300046520 | Ga0495637_0004155 | Ga0495637_0004155_1227_2000 | 254 |
| 464 | 3300046522 | Ga0495643_0015981 | Ga0495643_0015981_185_958 | 254 |
| 465 | 3300046528 | Ga0495642_0006402 | Ga0495642_0006402_1632_2405 | 254 |
| 466 | 3300046530 | Ga0495654_0010562 | Ga0495654_0010562_2247_3020 | 254 |
| 467 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_520610_521383 | 254 |
| 468 | 3300046665 | Ga0495661_0000207 | Ga0495661_0000207_44223_44996 | 254 |
| 469 | 3300046665 | Ga0495661_0000723 | Ga0495661_0000723_6641_7414 | 254 |
| 470 | 3300046665 | Ga0495661_0004690 | Ga0495661_0004690_5181_5954 | 254 |
| 471 | 3300046683 | Ga0495658_0321157 | Ga0495658_0321157_115_885 | 254 |
| 472 | 3300046692 | Ga0495671_0046698 | Ga0495671_0046698_1306_2079 | 254 |
| 473 | 3300046694 | Ga0495649_0245336 | Ga0495649_0245336_101_874 | 254 |
| 474 | 3300046794 | Ga0495589_0000009 | Ga0495589_0000009_215473_216246 | 254 |
| 475 | 3300047320 | Ga0495672_0035241 | Ga0495672_0035241_639_1412 | 254 |
| 476 | 3300047443 | Ga0495687_000013 | Ga0495687_000013_215473_216246 | 254 |
| 477 | 3300047443 | Ga0495687_000811 | Ga0495687_000811_12097_12870 | 254 |
| 478 | 3300047445 | Ga0495677_0000024 | Ga0495677_0000024_38027_38800 | 254 |
| 479 | 3300047446 | Ga0495679_000373 | Ga0495679_000373_26033_26806 | 254 |
| 480 | 3300047472 | Ga0495686_0094149 | Ga0495686_0094149_113_886 | 254 |
| 481 | 3300048091 | Ga0495626_0000151 | Ga0495626_0000151_33613_34386 | 254 |
| 482 | 3300048091 | Ga0495626_0005839 | Ga0495626_0005839_3063_3836 | 254 |
| 483 | 3300048912 | Ga0496109_0084440 | Ga0496109_0084440_289_1059 | 254 |
| 484 | 3300048919 | Ga0496116_0000500 | Ga0496116_0000500_1298_2068 | 254 |
| 485 | 3300048919 | Ga0496116_0061746 | Ga0496116_0061746_914_1684 | 254 |
| 486 | 3300048920 | Ga0496117_0002526 | Ga0496117_0002526_3080_3853 | 254 |
| 487 | 3300048920 | Ga0496117_0026078 | Ga0496117_0026078_893_1663 | 254 |
| 488 | 3300048921 | Ga0496118_0002734 | Ga0496118_0002734_3354_4127 | 254 |
| 489 | 3300048921 | Ga0496118_0068004 | Ga0496118_0068004_757_1527 | 254 |
| 490 | 3300048922 | Ga0496119_0001539 | Ga0496119_0001539_1296_2066 | 254 |
| 491 | 3300048924 | Ga0496121_0002258 | Ga0496121_0002258_24660_25433 | 254 |
| 492 | 3300048925 | Ga0496122_0029791 | Ga0496122_0029791_1373_2143 | 254 |
| 493 | 3300048927 | Ga0496124_0013995 | Ga0496124_0013995_4825_5598 | 254 |
| 494 | 3300048927 | Ga0496124_0081936 | Ga0496124_0081936_61_831 | 254 |
| 495 | 3300048927 | Ga0496124_0147571 | Ga0496124_0147571_534_1304 | 254 |
| 496 | 3300048928 | Ga0496125_0038497 | Ga0496125_0038497_2337_3107 | 254 |
| 497 | 3300049522 | Ga0501299_016515 | Ga0501299_016515_405_1178 | 254 |
| 498 | 3300049588 | Ga0501072_0007546 | Ga0501072_0007546_5555_6325 | 254 |
| 499 | 3300049591 | Ga0501075_0417637 | Ga0501075_0417637_118_894 | 254 |
| 500 | 3300050492 | nmdc:mga0yw44_221884_c1 | nmdc:mga0yw44_221884_c1_235_1005 | 254 |
| 501 | 3300050507 | nmdc:mga05p37_19510_c1 | nmdc:mga05p37_19510_c1_4081_4854 | 254 |
| 502 | 3300050512 | nmdc:mga0n895_193051_c1 | nmdc:mga0n895_193051_c1_949_1722 | 254 |
| 503 | 3300050515 | nmdc:mga0a205_169116_c1 | nmdc:mga0a205_169116_c1_46_819 | 254 |
| 504 | 3300053085 | Ga0495619_0276360 | Ga0495619_0276360_136_906 | 254 |
| 505 | 3300053091 | Ga0500647_0217439 | Ga0500647_0217439_14_799 | 254 |
| 506 | 3300053092 | Ga0500583_0129257 | Ga0500583_0129257_303_1088 | 254 |
| 507 | 3300053119 | Ga0500595_009012 | Ga0500595_009012_2763_3533 | 254 |
| 508 | 3300053124 | Ga0500617_092539 | Ga0500617_092539_495_1268 | 254 |
| 509 | 3300053134 | Ga0500658_0013446 | Ga0500658_0013446_1487_2260 | 254 |
| 510 | 3300053153 | Ga0500616_0000018 | Ga0500616_0000018_568400_569185 | 254 |
| 511 | 3300053153 | Ga0500616_0096217 | Ga0500616_0096217_405_1199 | 254 |
| 512 | 3300053161 | Ga0500634_0000104 | Ga0500634_0000104_6670_7443 | 254 |
| 513 | 3300059421 | Ga0590071_011742 | Ga0590071_011742_988_1761 | 254 |
| 514 | 3300059504 | Ga0587082_016198 | Ga0587082_016198_230_1015 | 254 |
| 515 | 3300059508 | Ga0587088_013855 | Ga0587088_013855_388_1161 | 254 |
| 516 | 3300059511 | Ga0587091_010222 | Ga0587091_010222_532_1317 | 254 |
| 517 | 3300059643 | Ga0587072_034318 | Ga0587072_034318_111_884 | 254 |
| 518 | 3300061734 | Ga0530510_0129888 | Ga0530510_0129888_790_1560 | 254 |
| 519 | 3300005347 | Ga0070668_100366372 | Ga0070668_1003663721 | 255 |
| 520 | 3300005719 | Ga0068861_100002243 | Ga0068861_1000022437 | 255 |
| 521 | 3300007265 | Ga0099794_10064511 | Ga0099794_100645111 | 255 |
| 522 | 3300007788 | Ga0099795_10001876 | Ga0099795_100018763 | 255 |
| 523 | 3300010159 | Ga0099796_10000295 | Ga0099796_100002955 | 255 |
| 524 | 3300025972 | Ga0207668_10454178 | Ga0207668_104541782 | 255 |
| 525 | 3300026118 | Ga0207675_100074734 | Ga0207675_1000747341 | 255 |
| 526 | 3300027512 | Ga0209179_1000201 | Ga0209179_10002015 | 255 |
| 527 | 3300028017 | Ga0265356_1001416 | Ga0265356_10014164 | 255 |
| 528 | 3300028573 | Ga0265334_10001556 | Ga0265334_100015563 | 255 |
| 529 | 3300061734 | Ga0530510_0419788 | Ga0530510_0419788_154_927 | 255 |
| 530 | 3300013306 | Ga0163162_10077042 | Ga0163162_100770422 | 256 |
| 531 | 3300005353 | Ga0070669_100396106 | Ga0070669_1003961062 | 257 |
| 532 | 3300005366 | Ga0070659_100383333 | Ga0070659_1003833331 | 257 |
| 533 | 3300005549 | Ga0070704_100385297 | Ga0070704_1003852971 | 257 |
| 534 | 3300009176 | Ga0105242_10710026 | Ga0105242_107100261 | 257 |
| 535 | 3300031235 | Ga0265330_10024209 | Ga0265330_100242092 | 257 |
| 536 | 3300031247 | Ga0265340_10009277 | Ga0265340_100092772 | 257 |
| 537 | 3300013308 | Ga0157375_10735758 | Ga0157375_107357582 | 258 |
| 538 | 3300026035 | Ga0207703_10341848 | Ga0207703_103418482 | 258 |
| 539 | 3300005331 | Ga0070670_100003750 | Ga0070670_1000037505 | 259 |
| 540 | 3300005336 | Ga0070680_100019022 | Ga0070680_1000190223 | 259 |
| 541 | 3300005344 | Ga0070661_100024247 | Ga0070661_1000242471 | 259 |
| 542 | 3300005355 | Ga0070671_100117833 | Ga0070671_1001178331 | 259 |
| 543 | 3300005366 | Ga0070659_100020751 | Ga0070659_1000207514 | 259 |
| 544 | 3300005457 | Ga0070662_100054577 | Ga0070662_1000545772 | 259 |
| 545 | 3300005458 | Ga0070681_10000391 | Ga0070681_1000039132 | 259 |
| 546 | 3300005530 | Ga0070679_100010196 | Ga0070679_1000101961 | 259 |
| 547 | 3300005840 | Ga0068870_10068334 | Ga0068870_100683342 | 259 |
| 548 | 3300006844 | Ga0075428_100848386 | Ga0075428_1008483862 | 259 |
| 549 | 3300013105 | Ga0157369_10278894 | Ga0157369_102788942 | 259 |
| 550 | 3300013297 | Ga0157378_10677494 | Ga0157378_106774941 | 259 |
| 551 | 3300014325 | Ga0163163_10001907 | Ga0163163_100019078 | 259 |
| 552 | 3300025912 | Ga0207707_10016325 | Ga0207707_100163252 | 259 |
| 553 | 3300025917 | Ga0207660_10033713 | Ga0207660_100337132 | 259 |
| 554 | 3300025920 | Ga0207649_10012195 | Ga0207649_100121952 | 259 |
| 555 | 3300025921 | Ga0207652_10156827 | Ga0207652_101568272 | 259 |
| 556 | 3300025932 | Ga0207690_10116443 | Ga0207690_101164432 | 259 |
| 557 | 3300025933 | Ga0207706_10068767 | Ga0207706_100687673 | 259 |
| 558 | 3300025945 | Ga0207679_10048003 | Ga0207679_100480034 | 259 |
| 559 | 3300026078 | Ga0207702_10620199 | Ga0207702_106201991 | 259 |
| 560 | 3300026116 | Ga0207674_10000111 | Ga0207674_1000011145 | 259 |
| 561 | 3300048915 | Ga0496112_0190493 | Ga0496112_0190493_448_1236 | 259 |
| 562 | 3300046522 | Ga0495643_0183825 | Ga0495643_0183825_201_989 | 260 |
| 563 | 3300049589 | Ga0501073_0429424 | Ga0501073_0429424_79_879 | 260 |
| 564 | 3300005536 | Ga0070697_100212008 | Ga0070697_1002120081 | 263 |
| 565 | iso_pu_bacteria | 3003930520 | 3003934179 | 267 |
| 566 | iso_pu_bacteria | 2643221557 | 2643805502 | 268 |
| 567 | iso_pu_bacteria | 2643221610 | 2644068256 | 268 |
| 568 | iso_pu_bacteria | 2643221668 | 2644376088 | 268 |
| 569 | iso_pu_bacteria | 2643221675 | 2644419182 | 268 |
| 570 | iso_pu_bacteria | 2643221680 | 2644452539 | 268 |
| 571 | iso_pu_bacteria | 2643221726 | 2644691313 | 268 |
| 572 | iso_pu_bacteria | 2838074704 | 2838077687 | 268 |
| 573 | iso_pu_bacteria | 2896384573 | 2896389628 | 268 |
| 574 | iso_pu_bacteria | 2920760137 | 2920765066 | 268 |
| 575 | iso_pu_bacteria | 2977565890 | 2977565891 | 268 |
| 576 | iso_pu_bacteria | 2508501127 | 2509143031 | 270 |
| 577 | iso_pu_bacteria | 2869162929 | 2869168591 | 270 |
| 578 | iso_pu_bacteria | 2882632389 | 2882637786 | 270 |
| 579 | iso_pu_bacteria | 2885312484 | 2885316058 | 270 |
| 580 | iso_pu_bacteria | 8055617313 | 8055622917 | 270 |
| 581 | 3300003775 | Ga0055524_1000412 | Ga0055524_100041221 | 272 |
| 582 | 3300025294 | Ga0209025_1009820 | Ga0209025_10098201 | 272 |
| 583 | 3300025299 | Ga0209256_1000412 | Ga0209256_100041227 | 272 |
| 584 | iso_pu_bacteria | 2509276019 | 2509377122 | 272 |
| 585 | iso_pu_bacteria | 2558860100 | 2558862355 | 272 |
| 586 | iso_pu_bacteria | 2850079185 | 2850085261 | 272 |
| 587 | 3300032002 | Ga0307416_100947185 | Ga0307416_1009471852 | 274 |
| 588 | iso_pu_bacteria | 2508501122 | 2509109944 | 274 |
| 589 | iso_pu_bacteria | 2855872281 | 2855872568 | 274 |
| 590 | 3300003320 | rootH2_10067998 | rootH2_100679983 | 275 |
| 591 | 3300004799 | Ga0058863_11804459 | Ga0058863_118044592 | 275 |
| 592 | 3300004800 | Ga0058861_11441847 | Ga0058861_114418472 | 275 |
| 593 | 3300004803 | Ga0058862_12726379 | Ga0058862_127263792 | 275 |
| 594 | 3300009148 | Ga0105243_10005913 | Ga0105243_100059134 | 275 |
| 595 | 3300049569 | Ga0501032_0122988 | Ga0501032_0122988_32_901 | 275 |
| 596 | 3300049571 | Ga0501034_0009667 | Ga0501034_0009667_8963_9832 | 275 |
| 597 | 3300049573 | Ga0501037_0056280 | Ga0501037_0056280_266_1135 | 275 |
| 598 | 3300049579 | Ga0501043_0137738 | Ga0501043_0137738_934_1803 | 275 |
| 599 | 3300049580 | Ga0501046_0103190 | Ga0501046_0103190_920_1789 | 275 |
| 600 | 3300049581 | Ga0501047_0036234 | Ga0501047_0036234_3083_3952 | 275 |
| 601 | 3300049586 | Ga0501070_0084292 | Ga0501070_0084292_557_1426 | 275 |
| 602 | 3300049589 | Ga0501073_0106349 | Ga0501073_0106349_622_1491 | 275 |
| 603 | 3300049822 | Ga0501035_0023170 | Ga0501035_0023170_4293_5162 | 275 |
| 604 | 3300049823 | Ga0501044_0052019 | Ga0501044_0052019_1131_2000 | 275 |
| 605 | iso_pu_bacteria | 2874123672 | 2874130870 | 275 |
| 606 | iso_pu_bacteria | 2889790730 | 2889796208 | 275 |
| 607 | 3300021327 | Ga0214543_1000005 | Ga0214543_1000005360 | 276 |
| 608 | 3300039438 | Ga0436360_0664306 | Ga0436360_0664306_334_1203 | 276 |
| 609 | 3300003203 | JGI25406J46586_10035637 | JGI25406J46586_100356371 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tzf-assembly1.cif.gz_A | x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi | 0.9064 | 2 | 256 |
| 1wvc-assembly1.cif.gz_A | alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp | 0.9052 | 2 | 256 |
| 1wvc-assembly1.cif.gz_A | alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp | 0.8951 | 2 | 256 |
| 1tzf-assembly1.cif.gz_A | x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi | 0.8927 | 2 | 256 |
| 4y7t-assembly1.cif.gz_A | structural analysis of muru | 0.8099 | 1 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tzfA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9064 | 2 | 256 | 3.90.550.10 |
| 1tzfA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8927 | 2 | 256 | 3.90.550.10 |
| af_L7N6A5_2_240_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7955 | 2 | 249 | 3.90.550.10 |
| af_Q8ILP1_1_241_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7856 | 1 | 248 | 3.90.550.10 |
| af_L7N6A5_2_240_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7767 | 2 | 249 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383BKH4-F1-model_v4 | Nucleotidyl transferase domain-containing protein | 0.9686 | 1 | 148 |
GO:0009058
GO:0047343 |
| AF-A0A529I2Z1-F1-model_v4 | deleted | 0.9681 | 1 | 148 |
|
| AF-A0A382IIP5-F1-model_v4 | Nucleotidyl transferase domain-containing protein | 0.9611 | 1 | 163 |
GO:0009058
GO:0047343 |
| AF-A0A258KUJ6-F1-model_v4 | Nucleotidyl transferase domain-containing protein | 0.961 | 1 | 144 |
GO:0009058
GO:0047343 |
| AF-A0A257GWQ9-F1-model_v4 | Glucose-1-phosphate cytidylyltransferase | 0.9609 | 1 | 135 |
GO:0009058
GO:0047343 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar