F468890

General Info

Members Datasets Scaffolds Average Seq Length
609 414 512 259

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0038937|Ga0395899_0038937_343_1269
Length 308
Sequence LILFFSFLSDTVWSDAIPGNGPLSMTNIVQDIGTFSVDRIRQRSESGWSLPPVAILAGGLGSRLSEETTLRPKPLVEIGGKPIIWHVMKHYDAYGMNEFAIALGYKKEAVIRYFLDLHTSNRNLTVRTRDGSVSFHDGNTDLDWTVHLVDTGPETMTGGRIKRLRPYLGGGTFMLTWCDGISNVNLTDLLAFHRAHGKLATVTVVRAPSRFGLVDVAGDRSVRRFTEKPEHGDGWINGAFFVLEPGIFDYIAGDDTMWEREPLERLAADGELAAYQHNSFWQCMDTLKEKTLLEELWNKGSAPWKTWE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
10 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
11 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
12 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
13 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
14 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
15 2643221557 Ensifer sp. Root558 Isolate Unclassified
16 2643221610 Ensifer sp. Root74 Isolate Unclassified
17 2643221668 Ensifer sp. Root423 Isolate Unclassified
18 2643221675 Ensifer sp. Root1298 Isolate Unclassified
19 2643221680 Ensifer sp. Root1312 Isolate Unclassified
20 2643221726 Ensifer sp. Root954 Isolate Unclassified
21 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
23 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
24 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
25 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
26 2842694124 Methylopila sp. R-72369 Isolate Unclassified
27 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
28 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
29 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
30 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
31 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
32 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
33 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
34 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
35 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
36 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
37 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
38 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
39 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
40 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
41 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
42 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
43 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
44 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
45 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
46 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
47 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
48 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
49 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
50 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
51 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
52 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
53 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
54 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
55 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
56 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
57 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
58 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
59 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
60 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
61 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
62 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
63 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
64 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
65 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
66 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
67 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
68 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
69 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
70 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
71 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
72 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
73 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
74 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
75 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
76 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
77 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
78 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
79 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
80 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
81 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
82 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
83 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
84 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
85 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
86 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
87 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
88 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
89 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
90 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
91 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
92 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
93 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
95 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
96 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
97 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
98 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
99 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
103 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
104 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
105 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
106 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
107 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
108 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
109 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
110 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
111 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
112 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
113 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
118 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
119 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
120 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
121 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
122 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
123 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
124 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
125 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
126 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
127 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
128 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
129 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
130 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
131 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
132 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
133 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
134 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
135 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
136 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
144 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
145 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
148 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
149 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
150 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
151 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
152 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
153 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
154 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
155 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
156 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
157 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
158 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
159 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
162 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
163 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
164 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
165 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
166 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
167 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
168 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
169 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
176 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
177 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
199 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
200 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
201 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
247 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
253 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
254 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
255 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
256 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
257 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
259 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
260 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
261 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
262 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
263 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
264 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
265 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
266 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
267 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
270 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
271 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
272 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
273 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
274 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
275 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
276 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
277 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
278 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
279 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
280 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
281 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
294 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
295 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
298 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
299 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
306 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
307 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
308 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
309 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
310 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
313 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
314 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
324 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
325 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
326 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
327 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
328 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
329 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
330 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
331 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
332 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
333 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
344 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
345 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
346 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
347 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
380 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
381 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
389 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
392 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
395 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
396 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
399 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
400 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
401 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
402 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
403 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
404 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
410 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
411 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
412 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
413 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
414 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.8
Metatranscriptomes 4.27
Isolates 15.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.78
Nodule 12.81
Rhizoplane 0.82
Rhizosphere 74.71
Stem 0
Stem Tuber 0
Unclassified 7.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10035637 3300003203 Bacteria 1814
2 JGI25153J46596_10004924 3300003215 Bacteria 7097
3 rootH2_10008034 3300003320 Bacteria 73088
4 rootH2_10067998 3300003320 Bacteria 3172
5 rootL2_10000040 3300003322 Bacteria 12566
6 rootH1_10008851 3300003323 Bacteria 21396
7 Ga0055524_1000412 3300003775 Bacteria 36126
8 Ga0058863_11804459 3300004799 Bacteria 1307
9 Ga0058861_11441847 3300004800 Bacteria 1293
10 Ga0058861_12075980 3300004800 Bacteria 1376
11 Ga0058862_12726379 3300004803 Bacteria 2262
12 Ga0065714_10068111 3300005288 Bacteria 4953
13 Ga0065704_10075142 3300005289 Bacteria 5769
14 Ga0065712_10103794 3300005290 Bacteria 1976
15 Ga0065715_10222802 3300005293 Bacteria 1260
16 Ga0070658_10010293 3300005327 Bacteria 7502
17 Ga0070658_10043883 3300005327 Bacteria 3612
18 Ga0070690_100031713 3300005330 Unclassified 3294
19 Ga0070690_100036391 3300005330 Bacteria 3093
20 Ga0070670_100003750 3300005331 Bacteria 12651
21 Ga0070670_100159876 3300005331 Bacteria 1952
22 Ga0068869_100053794 3300005334 Unclassified 2928
23 Ga0070680_100007419 3300005336 Bacteria 8370
24 Ga0070680_100019022 3300005336 Bacteria 5437
25 Ga0070680_100097059 3300005336 Bacteria 2443
26 Ga0070680_100288905 3300005336 Bacteria 1390
27 Ga0070689_100193624 3300005340 Unclassified 1656
28 Ga0070661_100024247 3300005344 Bacteria 4351
29 Ga0070668_100366372 3300005347 Bacteria 1223
30 Ga0070669_100023032 3300005353 Bacteria 4457
31 Ga0070669_100396106 3300005353 Bacteria 1129
32 Ga0070669_100639490 3300005353 Unclassified 894
33 Ga0070671_100117833 3300005355 Bacteria 2233
34 Ga0070659_100020751 3300005366 Bacteria 4996
35 Ga0070659_100165743 3300005366 Bacteria 1808
36 Ga0070659_100383333 3300005366 Bacteria 1184
37 Ga0070659_100441739 3300005366 Unclassified 1102
38 Ga0070713_100022820 3300005436 Bacteria 4843
39 Ga0070713_100054174 3300005436 Bacteria 3327
40 Ga0070713_100389447 3300005436 Bacteria 1300
41 Ga0070710_10030913 3300005437 Bacteria 2885
42 Ga0070710_10214402 3300005437 Bacteria 1222
43 Ga0070711_100056035 3300005439 Bacteria 2724
44 Ga0070700_100214121 3300005441 Bacteria 1361
45 Ga0070694_100124788 3300005444 Bacteria 1852
46 Ga0070663_100011657 3300005455 Bacteria 5527
47 Ga0070678_100016026 3300005456 Bacteria 4780
48 Ga0070678_100031710 3300005456 Bacteria 3650
49 Ga0070662_100054577 3300005457 Bacteria 2896
50 Ga0070662_100121276 3300005457 Bacteria 2004
51 Ga0070681_10000391 3300005458 Bacteria 35476
52 Ga0070681_10007242 3300005458 Bacteria 10825
53 Ga0070681_10008929 3300005458 Bacteria 9852
54 Ga0070681_10012085 3300005458 Bacteria 8561
55 Ga0070681_10034142 3300005458 Bacteria 5109
56 Ga0070681_10066183 3300005458 Bacteria 3582
57 Ga0068867_100154765 3300005459 Bacteria 1803
58 Ga0068867_100399708 3300005459 Unclassified 1158
59 Ga0070685_10095167 3300005466 Bacteria 1810
60 Ga0070706_100032224 3300005467 Unclassified 4834
61 Ga0070706_100056635 3300005467 Bacteria 3617
62 Ga0070706_100231754 3300005467 Bacteria 1724
63 Ga0070707_100160425 3300005468 Bacteria 2191
64 Ga0070698_100000229 3300005471 Bacteria 55211
65 Ga0070698_100009796 3300005471 Bacteria 10243
66 Ga0070698_100099966 3300005471 Bacteria 2874
67 Ga0070698_100331444 3300005471 Bacteria 1453
68 Ga0070698_100564484 3300005471 Bacteria 1078
69 Ga0070699_100026893 3300005518 Bacteria 4963
70 Ga0070699_100459014 3300005518 Bacteria 1155
71 Ga0070679_100010196 3300005530 Bacteria 8908
72 Ga0070679_100011032 3300005530 Bacteria 8592
73 Ga0070679_100030534 3300005530 Bacteria 5320
74 Ga0070679_100086879 3300005530 Bacteria 3114
75 Ga0070679_100169517 3300005530 Bacteria 2156
76 Ga0070679_100402247 3300005530 Bacteria 1315
77 Ga0070684_100014502 3300005535 Bacteria 6387
78 Ga0070697_100071601 3300005536 Bacteria 2844
79 Ga0070697_100212008 3300005536 Bacteria 1649
80 Ga0070686_100391816 3300005544 Bacteria 1054
81 Ga0070696_100002003 3300005546 Bacteria 13360
82 Ga0070665_100048548 3300005548 Bacteria 4261
83 Ga0070704_100385297 3300005549 Bacteria 1192
84 Ga0068855_100001147 3300005563 Bacteria 32801
85 Ga0068855_100009153 3300005563 Bacteria 11960
86 Ga0068855_100080587 3300005563 Bacteria 3774
87 Ga0068855_100082797 3300005563 Bacteria 3718
88 Ga0068857_100189448 3300005577 Bacteria 1873
89 Ga0068857_100846168 3300005577 Bacteria 875
90 Ga0068856_100016724 3300005614 Bacteria 7106
91 Ga0068859_100115359 3300005617 Bacteria 2751
92 Ga0068864_100557814 3300005618 Unclassified 1108
93 Ga0068864_100927243 3300005618 Unclassified 861
94 Ga0068861_100002243 3300005719 Bacteria 12547
95 Ga0068861_100613892 3300005719 Bacteria 1000
96 Ga0068870_10066078 3300005840 Unclassified 1958
97 Ga0068870_10068334 3300005840 Bacteria 1930
98 Ga0068858_100009568 3300005842 Bacteria 9246
99 Ga0068860_100457721 3300005843 Bacteria 1269
100 Ga0068862_100008309 3300005844 Bacteria 8590
101 Ga0081455_10000679 3300005937 Bacteria 44123
102 Ga0081455_10005986 3300005937 Bacteria 13190
103 Ga0081455_10131541 3300005937 Bacteria 1956
104 Ga0081540_1006514 3300005983 Bacteria 8484
105 Ga0070717_10136601 3300006028 Unclassified 2112
106 Ga0075365_10154328 3300006038 Bacteria 1598
107 Ga0070716_100000001 3300006173 Bacteria 400668
108 Ga0070712_100162695 3300006175 Bacteria 1725
109 Ga0075369_10026822 3300006186 Bacteria 2404
110 Ga0097621_100081995 3300006237 Bacteria 2685
111 Ga0097621_100394194 3300006237 Bacteria 1238
112 Ga0068871_100751633 3300006358 Bacteria 896
113 Ga0075428_100848386 3300006844 Bacteria 970
114 Ga0068865_100628562 3300006881 Unclassified 910
115 Ga0097620_100115357 3300006931 Bacteria 2751
116 Ga0075435_100200335 3300007076 Bacteria 1691
117 Ga0099794_10005493 3300007265 Bacteria 5083
118 Ga0099794_10064511 3300007265 Bacteria 1785
119 Ga0099795_10001876 3300007788 Bacteria 4760
120 Ga0099795_10117592 3300007788 Bacteria 1060
121 Ga0105251_10001908 3300009011 Bacteria 17107
122 Ga0105244_10000783 3300009036 Bacteria 27093
123 Ga0105240_10019120 3300009093 Bacteria 9160
124 Ga0105240_10035059 3300009093 Bacteria 6470
125 Ga0105240_10038367 3300009093 Bacteria 6144
126 Ga0105240_10112395 3300009093 Bacteria 3293
127 Ga0105240_10131728 3300009093 Bacteria 2998
128 Ga0105240_10441133 3300009093 Bacteria 1459
129 Ga0105245_10604829 3300009098 Bacteria 1123
130 Ga0105247_10133212 3300009101 Bacteria 1622
131 Ga0114129_10096840 3300009147 Bacteria 4085
132 Ga0105243_10005913 3300009148 Bacteria 9478
133 Ga0105241_10468572 3300009174 Bacteria 1117
134 Ga0105242_10066263 3300009176 Bacteria 2982
135 Ga0105242_10710026 3300009176 Bacteria 985
136 Ga0105248_10556375 3300009177 Bacteria 1294
137 Ga0105248_10648508 3300009177 Bacteria 1191
138 Ga0105237_10108814 3300009545 Bacteria 2763
139 Ga0105237_10368543 3300009545 Bacteria 1441
140 Ga0105237_10455149 3300009545 Bacteria 1286
141 Ga0105238_10008139 3300009551 Bacteria 10486
142 Ga0105238_10068035 3300009551 Bacteria 3562
143 Ga0105238_10099470 3300009551 Unclassified 2891
144 Ga0105238_10164968 3300009551 Bacteria 2190
145 Ga0099796_10000295 3300010159 Bacteria 7864
146 Ga0099796_10013632 3300010159 Bacteria 2326
147 Ga0105239_10133686 3300010375 Bacteria 2761
148 Ga0105246_10000490 3300011119 Bacteria 21442
149 Ga0105246_10351534 3300011119 Bacteria 1208
150 Ga0157371_10342053 3300013102 Bacteria 1088
151 Ga0157370_10002664 3300013104 Bacteria 21422
152 Ga0157370_10009088 3300013104 Bacteria 10658
153 Ga0157370_10371367 3300013104 Bacteria 1318
154 Ga0157369_10004921 3300013105 Bacteria 15660
155 Ga0157369_10080767 3300013105 Bacteria 3481
156 Ga0157369_10278894 3300013105 Bacteria 1741
157 Ga0157369_10470432 3300013105 Bacteria 1301
158 Ga0157374_10541760 3300013296 Bacteria 1171
159 Ga0157378_10677494 3300013297 Bacteria 1049
160 Ga0163162_10077042 3300013306 Bacteria 3398
161 Ga0163162_10275686 3300013306 Bacteria 1814
162 Ga0157372_10129704 3300013307 Bacteria 2900
163 Ga0157372_10535770 3300013307 Bacteria 1365
164 Ga0157372_10948970 3300013307 Bacteria 997
165 Ga0157375_10000629 3300013308 Bacteria 31341
166 Ga0157375_10391174 3300013308 Bacteria 1557
167 Ga0157375_10424719 3300013308 Bacteria 1495
168 Ga0157375_10735758 3300013308 Bacteria 1138
169 Ga0163163_10001907 3300014325 Bacteria 17635
170 Ga0163163_10003054 3300014325 Bacteria 14162
171 Ga0163163_10288020 3300014325 Bacteria 1694
172 Ga0157380_10118415 3300014326 Bacteria 2239
173 Ga0182008_10002216 3300014497 Bacteria 12317
174 Ga0157379_10002195 3300014968 Bacteria 16240
175 Ga0157379_10198050 3300014968 Bacteria 1816
176 Ga0157379_10204010 3300014968 Bacteria 1788
177 Ga0163161_10082936 3300017792 Bacteria 2363
178 Ga0163161_10199212 3300017792 Bacteria 1542
179 Ga0197907_10300375 3300020069 Bacteria 886
180 Ga0206356_10118893 3300020070 Bacteria 1233
181 Ga0206356_11813778 3300020070 Unclassified 898
182 Ga0206351_10004824 3300020077 Bacteria 3251
183 Ga0206352_10208239 3300020078 Bacteria 1296
184 Ga0206354_10552570 3300020081 Bacteria 955
185 Ga0206353_10185489 3300020082 Bacteria 854
186 Ga0214543_1000005 3300021327 Bacteria 454523
187 Ga0213873_10042597 3300021358 Bacteria 1175
188 Ga0213876_10017929 3300021384 Bacteria 3735
189 Ga0224712_10001804 3300022467 Bacteria 5106
190 Ga0224712_10002191 3300022467 Bacteria 4765
191 Ga0224712_10020238 3300022467 Bacteria 2255
192 Ga0224712_10088131 3300022467 Bacteria 1295
193 Ga0224712_10096016 3300022467 Bacteria 1249
194 Ga0224712_10122870 3300022467 Bacteria 1126
195 Ga0224712_10145105 3300022467 Bacteria 1048
196 Ga0209025_1009820 3300025294 Bacteria 6602
197 Ga0209758_1000628 3300025297 Bacteria 54130
198 Ga0209256_1000412 3300025299 Bacteria 67199
199 Ga0207713_1001686 3300025735 Bacteria 17087
200 Ga0207692_10015697 3300025898 Bacteria 3340
201 Ga0207710_10161264 3300025900 Bacteria 1092
202 Ga0207688_10089314 3300025901 Bacteria 1768
203 Ga0207705_10039212 3300025909 Bacteria 3394
204 Ga0207684_10016442 3300025910 Bacteria 6352
205 Ga0207684_10026203 3300025910 Bacteria 4970
206 Ga0207654_10270798 3300025911 Bacteria 1145
207 Ga0207707_10003776 3300025912 Bacteria 13422
208 Ga0207707_10014184 3300025912 Bacteria 6943
209 Ga0207707_10016325 3300025912 Bacteria 6477
210 Ga0207707_10028611 3300025912 Bacteria 4870
211 Ga0207707_10045534 3300025912 Bacteria 3822
212 Ga0207707_10113576 3300025912 Bacteria 2367
213 Ga0207695_10006739 3300025913 Bacteria 14813
214 Ga0207695_10042155 3300025913 Bacteria 4879
215 Ga0207695_10060575 3300025913 Bacteria 3916
216 Ga0207695_10105007 3300025913 Bacteria 2813
217 Ga0207671_10041349 3300025914 Bacteria 3411
218 Ga0207693_10025413 3300025915 Bacteria 4696
219 Ga0207693_10274472 3300025915 Unclassified 1321
220 Ga0207663_10076305 3300025916 Bacteria 2177
221 Ga0207660_10009454 3300025917 Bacteria 6309
222 Ga0207660_10011552 3300025917 Bacteria 5754
223 Ga0207660_10033713 3300025917 Bacteria 3544
224 Ga0207660_10073983 3300025917 Bacteria 2485
225 Ga0207660_10292960 3300025917 Bacteria 1294
226 Ga0207660_10464829 3300025917 Unclassified 1024
227 Ga0207649_10012195 3300025920 Bacteria 4760
228 Ga0207652_10006501 3300025921 Bacteria 9419
229 Ga0207652_10020131 3300025921 Bacteria 5494
230 Ga0207652_10045269 3300025921 Bacteria 3751
231 Ga0207652_10101220 3300025921 Bacteria 2545
232 Ga0207652_10156827 3300025921 Bacteria 2040
233 Ga0207652_10472567 3300025921 Bacteria 1129
234 Ga0207681_10469445 3300025923 Unclassified 1026
235 Ga0207694_10008696 3300025924 Bacteria 7664
236 Ga0207694_10239393 3300025924 Unclassified 1483
237 Ga0207650_10095014 3300025925 Bacteria 2285
238 Ga0207700_10026680 3300025928 Bacteria 4032
239 Ga0207700_10151886 3300025928 Bacteria 1914
240 Ga0207700_10201213 3300025928 Bacteria 1679
241 Ga0207700_10324709 3300025928 Bacteria 1335
242 Ga0207664_10038416 3300025929 Bacteria 3712
243 Ga0207690_10116443 3300025932 Bacteria 1933
244 Ga0207706_10068767 3300025933 Bacteria 3115
245 Ga0207706_10180012 3300025933 Bacteria 1856
246 Ga0207670_10429549 3300025936 Unclassified 1061
247 Ga0207704_10609887 3300025938 Unclassified 894
248 Ga0207665_10000002 3300025939 Bacteria 267895
249 Ga0207711_10337008 3300025941 Bacteria 1395
250 Ga0207689_10109936 3300025942 Unclassified 2265
251 Ga0207661_10160996 3300025944 Bacteria 1947
252 Ga0207679_10011547 3300025945 Bacteria 5727
253 Ga0207679_10048003 3300025945 Bacteria 3106
254 Ga0207667_10000927 3300025949 Bacteria 37446
255 Ga0207667_10032914 3300025949 Bacteria 5579
256 Ga0207667_10050878 3300025949 Bacteria 4370
257 Ga0207667_10163664 3300025949 Bacteria 2287
258 Ga0207668_10454178 3300025972 Bacteria 1094
259 Ga0207677_10369714 3300026023 Bacteria 1207
260 Ga0207703_10016711 3300026035 Bacteria 5723
261 Ga0207703_10341848 3300026035 Bacteria 1376
262 Ga0207678_10022160 3300026067 Bacteria 5567
263 Ga0207702_10034771 3300026078 Bacteria 4215
264 Ga0207702_10620199 3300026078 Bacteria 1062
265 Ga0207648_10082153 3300026089 Bacteria 2810
266 Ga0207648_10291027 3300026089 Bacteria 1462
267 Ga0207648_10363845 3300026089 Unclassified 1305
268 Ga0207676_10708763 3300026095 Bacteria 976
269 Ga0207674_10000111 3300026116 Bacteria 94237
270 Ga0207674_10171845 3300026116 Bacteria 2120
271 Ga0207674_10707190 3300026116 Bacteria 973
272 Ga0207674_10746600 3300026116 Unclassified 945
273 Ga0207675_100074734 3300026118 Bacteria 3172
274 Ga0207675_100443047 3300026118 Bacteria 1286
275 Ga0207683_10061340 3300026121 Bacteria 3309
276 Ga0207683_10075657 3300026121 Bacteria 2980
277 Ga0207683_10669916 3300026121 Bacteria 961
278 Ga0207698_10040440 3300026142 Bacteria 3465
279 Ga0207698_10312661 3300026142 Bacteria 1468
280 Ga0209281_1000547 3300027111 Bacteria 46811
281 Ga0209179_1000201 3300027512 Bacteria 5636
282 Ga0265356_1001416 3300028017 Bacteria 3578
283 Ga0268266_10006924 3300028379 Bacteria 10315
284 Ga0268265_10075892 3300028380 Bacteria 2635
285 Ga0268264_10409607 3300028381 Bacteria 1305
286 Ga0265337_1033854 3300028556 Bacteria 1506
287 Ga0265334_10001556 3300028573 Bacteria 11047
288 Ga0265334_10003091 3300028573 Bacteria 7601
289 Ga0265334_10009303 3300028573 Bacteria 4157
290 Ga0265318_10081539 3300028577 Bacteria 1195
291 Ga0307515_10006229 3300028794 Bacteria 23956
292 Ga0265338_10033340 3300028800 Bacteria 5000
293 Ga0265773_1005943 3300031018 Unclassified 905
294 Ga0265330_10024209 3300031235 Bacteria 2754
295 Ga0265332_10005214 3300031238 Bacteria 6014
296 Ga0265340_10009277 3300031247 Bacteria 5284
297 Ga0265331_10003584 3300031250 Bacteria 9948
298 Ga0265327_10005325 3300031251 Bacteria 10780
299 Ga0265327_10034980 3300031251 Bacteria 2782
300 Ga0307509_10309770 3300031507 Bacteria 1322
301 Ga0307408_100004836 3300031548 Bacteria 9073
302 Ga0307408_100023592 3300031548 Bacteria 4192
303 Ga0265314_10002337 3300031711 Bacteria 19598
304 Ga0265314_10014389 3300031711 Bacteria 6334
305 Ga0316576_10162678 3300031727 Bacteria 1683
306 Ga0316578_10076786 3300031728 Unclassified 1983
307 Ga0316578_10093655 3300031728 Bacteria 1796
308 Ga0316578_10260783 3300031728 Bacteria 1039
309 Ga0307405_10139995 3300031731 Bacteria 1685
310 Ga0316577_10010591 3300031733 Bacteria 4980
311 Ga0307413_10071079 3300031824 Bacteria 2191
312 Ga0307410_10152579 3300031852 Bacteria 1721
313 Ga0307406_10088928 3300031901 Bacteria 2073
314 Ga0307406_10117275 3300031901 Bacteria 1844
315 Ga0307412_10024423 3300031911 Bacteria 3730
316 Ga0307409_100057975 3300031995 Bacteria 3005
317 Ga0307409_100105483 3300031995 Bacteria 2349
318 Ga0307416_100111070 3300032002 Bacteria 2415
319 Ga0307416_100947185 3300032002 Bacteria 963
320 Ga0307414_10129784 3300032004 Bacteria 1954
321 Ga0307411_10021817 3300032005 Bacteria 3757
322 Ga0307411_10158042 3300032005 Bacteria 1693
323 Ga0307415_100071567 3300032126 Bacteria 2439
324 Ga0316585_10054310 3300032137 Bacteria 1288
325 Ga0316580_10018799 3300032139 Bacteria 2127
326 Ga0316593_10033471 3300032168 Bacteria 1682
327 Ga0316592_1003348 3300033524 Bacteria 2880
328 Ga0316596_1007122 3300033541 Bacteria 2632
329 Ga0373936_0208261 3300035113 Bacteria 865
330 Ga0373956_0253161 3300035119 Bacteria 837
331 Ga0373955_0106974 3300035172 Bacteria 1613
332 Ga0373937_0283492 3300036401 Bacteria 1565
333 Ga0316582_0046478 3300036647 Bacteria 2737
334 Ga0316584_0099710 3300036712 Unclassified 2175
335 Ga0373925_0130487 3300037068 Bacteria 1959
336 Ga0373925_0282994 3300037068 Bacteria 1336
337 Ga0373925_0595679 3300037068 Bacteria 910
338 Ga0395899_0023786 3300037312 Bacteria 4636
339 Ga0395899_0038937 3300037312 Bacteria 3560
340 Ga0395900_0017307 3300037418 Bacteria 7357
341 Ga0395900_0023417 3300037418 Bacteria 6321
342 Ga0395900_0182228 3300037418 Bacteria 2134
343 Ga0395900_0294704 3300037418 Bacteria 1610
344 Ga0395898_0046730 3300037466 Bacteria 4251
345 Ga0395898_0077145 3300037466 Bacteria 3217
346 Ga0395898_0274010 3300037466 Bacteria 1609
347 Ga0395905_0353349 3300037471 Bacteria 1362
348 Ga0395905_0421634 3300037471 Bacteria 1231
349 Ga0436364_1254782 3300037853 Bacteria 3166
350 Ga0395901_0014999 3300038443 Bacteria 7876
351 Ga0395901_0024360 3300038443 Bacteria 6210
352 Ga0395901_0468165 3300038443 Bacteria 1287
353 Ga0400484_44773 3300038725 Bacteria 4079
354 Ga0400490_10463 3300038726 Bacteria 6199
355 Ga0400483_015883 3300039062 Bacteria 4444
356 Ga0400483_150553 3300039062 Bacteria 1087
357 Ga0400483_183966 3300039062 Bacteria 71423
358 Ga0436365_0296501 3300039437 Bacteria 1244
359 Ga0436365_0319120 3300039437 Bacteria 16865
360 Ga0436360_0664306 3300039438 Bacteria 1583
361 Ga0436360_0906789 3300039438 Unclassified 2083
362 Ga0436360_1262558 3300039438 Bacteria 2478
363 Ga0436361_0621164 3300039447 Unclassified 2275
364 Ga0436362_0091673 3300039453 Bacteria 3376
365 Ga0436362_0144001 3300039453 Bacteria 1346
366 Ga0436362_1282354 3300039453 Bacteria 1830
367 Ga0451853_2254729 3300041512 Bacteria 2188
368 Ga0439452_000020 3300042010 Bacteria 309345
369 Ga0450888_001864 3300042126 Bacteria 2041
370 Ga0450898_015288 3300042134 Bacteria 1299
371 Ga0451577_0000001 3300042876 Bacteria 2461803
372 Ga0466969_0043134 3300044656 Bacteria 2248
373 Ga0466965_0004523 3300044683 Bacteria 6189
374 Ga0466966_0159658 3300044684 Bacteria 1373
375 Ga0466961_0270045 3300044693 Bacteria 1042
376 Ga0466963_0099901 3300044694 Bacteria 1985
377 Ga0466963_0551100 3300044694 Bacteria 814
378 Ga0453684_0000020 3300044712 Bacteria 879938
379 Ga0453684_0006299 3300044712 Bacteria 22682
380 Ga0453684_0070320 3300044712 Unclassified 4433
381 Ga0453684_0110387 3300044712 Bacteria 3343
382 Ga0453684_0228695 3300044712 Bacteria 2149
383 Ga0466960_0205438 3300044901 Bacteria 1078
384 Ga0466959_0029349 3300045049 Bacteria 4075
385 Ga0466959_0118067 3300045049 Bacteria 1888
386 Ga0451576_0023858 3300045051 Bacteria 6617
387 Ga0466958_0056212 3300045836 Bacteria 2390
388 Ga0466967_0552490 3300045976 Bacteria 1133
389 Ga0495638_0000602 3300046460 Bacteria 40434
390 Ga0495650_0000454 3300046471 Bacteria 64731
391 Ga0495580_0303097 3300046472 Unclassified 1088
392 Ga0495605_0011627 3300046474 Bacteria 4899
393 Ga0495607_0000962 3300046501 Bacteria 26634
394 Ga0495583_0000553 3300046506 Bacteria 52333
395 Ga0495616_0000178 3300046513 Bacteria 54382
396 Ga0495631_0000838 3300046518 Bacteria 19541
397 Ga0495632_0000110 3300046519 Bacteria 84473
398 Ga0495637_0004155 3300046520 Bacteria 7533
399 Ga0495643_0015981 3300046522 Bacteria 4419
400 Ga0495643_0183825 3300046522 Bacteria 1014
401 Ga0495642_0006402 3300046528 Bacteria 4516
402 Ga0495654_0010562 3300046530 Bacteria 5023
403 Ga0495609_0000002 3300046538 Bacteria 739816
404 Ga0495625_0524774 3300046660 Bacteria 721
405 Ga0495661_0000207 3300046665 Bacteria 67846
406 Ga0495661_0000723 3300046665 Bacteria 32427
407 Ga0495661_0004690 3300046665 Bacteria 9817
408 Ga0495658_0321157 3300046683 Bacteria 981
409 Ga0495613_0232896 3300046689 Bacteria 1290
410 Ga0495671_0046698 3300046692 Bacteria 2165
411 Ga0495649_0245336 3300046694 Bacteria 921
412 Ga0495589_0000009 3300046794 Bacteria 256265
413 Ga0495672_0035241 3300047320 Bacteria 3083
414 Ga0495687_000013 3300047443 Bacteria 371058
415 Ga0495687_000811 3300047443 Bacteria 33635
416 Ga0495677_0000024 3300047445 Bacteria 99215
417 Ga0495679_000373 3300047446 Bacteria 34281
418 Ga0495686_0094149 3300047472 Bacteria 1816
419 Ga0495626_0000151 3300048091 Bacteria 86296
420 Ga0495626_0005839 3300048091 Bacteria 7100
421 Ga0496101_0327181 3300048904 Bacteria 1203
422 Ga0496101_0638075 3300048904 Bacteria 842
423 Ga0496105_0379287 3300048908 Bacteria 1125
424 Ga0496109_0084440 3300048912 Bacteria 2930
425 Ga0496112_0190493 3300048915 Bacteria 2013
426 Ga0496116_0000500 3300048919 Bacteria 53809
427 Ga0496116_0061746 3300048919 Bacteria 2424
428 Ga0496117_0002526 3300048920 Bacteria 22920
429 Ga0496117_0026078 3300048920 Bacteria 4580
430 Ga0496118_0002734 3300048921 Bacteria 23211
431 Ga0496118_0006575 3300048921 Bacteria 12705
432 Ga0496118_0023079 3300048921 Bacteria 5416
433 Ga0496118_0068004 3300048921 Bacteria 2589
434 Ga0496119_0001539 3300048922 Bacteria 27538
435 Ga0496121_0002258 3300048924 Bacteria 30031
436 Ga0496122_0029791 3300048925 Bacteria 4591
437 Ga0496122_0362592 3300048925 Bacteria 751
438 Ga0496124_0013995 3300048927 Bacteria 7786
439 Ga0496124_0081936 3300048927 Bacteria 2650
440 Ga0496124_0147571 3300048927 Bacteria 1849
441 Ga0496125_0038497 3300048928 Bacteria 4137
442 Ga0501299_016515 3300049522 Bacteria 1308
443 Ga0501032_0122988 3300049569 Bacteria 1715
444 Ga0501033_0043001 3300049570 Bacteria 3366
445 Ga0501034_0009667 3300049571 Bacteria 10086
446 Ga0501034_0076207 3300049571 Bacteria 3361
447 Ga0501036_0003972 3300049572 Bacteria 11886
448 Ga0501037_0007267 3300049573 Bacteria 8095
449 Ga0501037_0056280 3300049573 Bacteria 2873
450 Ga0501039_0015272 3300049575 Bacteria 5878
451 Ga0501040_0031414 3300049576 Bacteria 3589
452 Ga0501040_0418220 3300049576 Bacteria 963
453 Ga0501041_0073283 3300049577 Bacteria 2104
454 Ga0501042_0031694 3300049578 Bacteria 3740
455 Ga0501043_0137738 3300049579 Bacteria 1912
456 Ga0501043_0212519 3300049579 Bacteria 1499
457 Ga0501043_0457693 3300049579 Bacteria 958
458 Ga0501046_0103190 3300049580 Bacteria 2186
459 Ga0501047_0036234 3300049581 Bacteria 4767
460 Ga0501070_0046029 3300049586 Bacteria 3628
461 Ga0501070_0084292 3300049586 Bacteria 2631
462 Ga0501070_0291991 3300049586 Bacteria 1329
463 Ga0501072_0002633 3300049588 Bacteria 13458
464 Ga0501072_0007546 3300049588 Bacteria 8254
465 Ga0501073_0106349 3300049589 Bacteria 1947
466 Ga0501073_0429424 3300049589 Bacteria 913
467 Ga0501074_0089544 3300049590 Bacteria 2204
468 Ga0501075_0002089 3300049591 Bacteria 13202
469 Ga0501075_0086520 3300049591 Bacteria 2375
470 Ga0501075_0417637 3300049591 Bacteria 1023
471 Ga0501076_0002054 3300049592 Bacteria 13793
472 Ga0501077_0016257 3300049593 Bacteria 4687
473 Ga0501077_0104031 3300049593 Bacteria 1799
474 Ga0501079_0101119 3300049741 Bacteria 2235
475 Ga0501080_0362672 3300049742 Bacteria 1307
476 Ga0501081_0122483 3300049743 Bacteria 1853
477 Ga0501035_0023170 3300049822 Bacteria 5696
478 Ga0501035_0032015 3300049822 Bacteria 4788
479 Ga0501044_0052019 3300049823 Bacteria 4223
480 Ga0501044_0124526 3300049823 Bacteria 2576
481 Ga0501045_0047245 3300049824 Bacteria 3135
482 nmdc:mga0yw44_221884_c1 3300050492 Bacteria 1253
483 nmdc:mga05p37_19510_c1 3300050507 Bacteria 8201
484 nmdc:mga0n895_193051_c1 3300050512 Bacteria 2067
485 nmdc:mga0a205_169116_c1 3300050515 Bacteria 2081
486 nmdc:mga0sz30_45853_c1 3300050516 Bacteria 1844
487 Ga0495619_0276360 3300053085 Bacteria 1164
488 Ga0500647_0217439 3300053091 Bacteria 858
489 Ga0500583_0129257 3300053092 Bacteria 1252
490 Ga0500595_009012 3300053119 Bacteria 4053
491 Ga0500617_092539 3300053124 Bacteria 1291
492 Ga0500652_157144 3300053131 Bacteria 941
493 Ga0500658_0013446 3300053134 Bacteria 3024
494 Ga0500559_0005494 3300053136 Bacteria 5829
495 Ga0500616_0000018 3300053153 Bacteria 610976
496 Ga0500616_0002276 3300053153 Bacteria 16286
497 Ga0500616_0096217 3300053153 Bacteria 1456
498 Ga0500616_0184370 3300053153 Bacteria 937
499 Ga0500627_0001581 3300053158 Bacteria 6414
500 Ga0500634_0000104 3300053161 Bacteria 32418
501 Ga0500645_018722 3300053730 Bacteria 2160
502 Ga0501084_0654521 3300054114 Unclassified 887
503 Ga0590071_011742 3300059421 Bacteria 2050
504 Ga0587082_016198 3300059504 Bacteria 1161
505 Ga0587088_013855 3300059508 Bacteria 1245
506 Ga0587091_010222 3300059511 Bacteria 1432
507 Ga0587072_034318 3300059643 Bacteria 961
508 Ga0501082_0070695 3300060353 Bacteria 3005
509 Ga0530510_0003659 3300061734 Bacteria 10586
510 Ga0530510_0129888 3300061734 Bacteria 1853
511 Ga0530510_0393242 3300061734 Bacteria 1044
512 Ga0530510_0419788 3300061734 Bacteria 1010

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0621164 Ga0436361_0621164_1624_2262 209
2 iso_pu_bacteria 2928125067 2928130580 213
3 3300046660 Ga0495625_0524774 Ga0495625_0524774_37_693 215
4 3300053131 Ga0500652_157144 Ga0500652_157144_21_680 216
5 3300048904 Ga0496101_0327181 Ga0496101_0327181_530_1189 217
6 iso_pu_bacteria 2916000859 2916003748 226
7 iso_pu_bacteria 2916014648 2916019158 226
8 iso_pu_bacteria 2916021584 2916026511 226
9 iso_pu_bacteria 2916041962 2916046379 226
10 iso_pu_bacteria 2916076590 2916078848 226
11 iso_pu_bacteria 2921201388 2921202318 226
12 iso_pu_bacteria 2921244191 2921248815 226
13 iso_pu_bacteria 2921282425 2921286527 226
14 iso_pu_bacteria 2924165586 2924169083 226
15 iso_pu_bacteria 2924179722 2924183159 226
16 3300048925 Ga0496122_0362592 Ga0496122_0362592_40_735 229
17 3300005842 Ga0068858_100009568 Ga0068858_1000095686 230
18 3300014326 Ga0157380_10118415 Ga0157380_101184153 230
19 3300031018 Ga0265773_1005943 Ga0265773_10059432 230
20 3300037853 Ga0436364_1254782 Ga0436364_1254782_2453_3154 230
21 3300038443 Ga0395901_0468165 Ga0395901_0468165_42_740 230
22 3300044694 Ga0466963_0551100 Ga0466963_0551100_23_724 230
23 3300025916 Ga0207663_10076305 Ga0207663_100763053 231
24 3300035113 Ga0373936_0208261 Ga0373936_0208261_46_750 231
25 3300035119 Ga0373956_0253161 Ga0373956_0253161_26_730 231
26 3300037068 Ga0373925_0595679 Ga0373925_0595679_148_852 231
27 3300026142 Ga0207698_10040440 Ga0207698_100404402 235
28 3300048904 Ga0496101_0638075 Ga0496101_0638075_18_752 240
29 3300009551 Ga0105238_10099470 Ga0105238_100994702 245
30 3300025924 Ga0207694_10239393 Ga0207694_102393932 245
31 iso_pu_bacteria 2829745981 2829748787 249
32 iso_pu_bacteria 2861691609 2861696301 249
33 iso_pu_bacteria 2503198000 2503201001 250
34 iso_pu_bacteria 2510065057 2510306796 250
35 iso_pu_bacteria 2511231007 2511273013 250
36 iso_pu_bacteria 2511231052 2511498284 250
37 iso_pu_bacteria 2513237305 2514422870 250
38 iso_pu_bacteria 2516653046 2516896078 250
39 iso_pu_bacteria 2551306086 2551696540 250
40 iso_pu_bacteria 2551306089 2551711524 250
41 iso_pu_bacteria 2551306091 2551726192 250
42 iso_pu_bacteria 2721755686 2723577655 250
43 iso_pu_bacteria 2818991461 2819686269 250
44 iso_pu_bacteria 2834028612 2834029598 250
45 iso_pu_bacteria 2842694124 2842695107 250
46 iso_pu_bacteria 2876392853 2876398836 250
47 iso_pu_bacteria 2881161766 2881163049 250
48 iso_pu_bacteria 2904659560 2904665368 250
49 iso_pu_bacteria 2937002841 2937007542 250
50 iso_pu_bacteria 2937009748 2937014052 250
51 iso_pu_bacteria 2937016420 2937020230 250
52 iso_pu_bacteria 2937091812 2937095014 250
53 iso_pu_bacteria 2937106411 2937106811 250
54 iso_pu_bacteria 2939679117 2939684650 250
55 iso_pu_bacteria 2957382221 2957386518 250
56 iso_pu_bacteria 2957402308 2957406814 250
57 iso_pu_bacteria 2957415311 2957421689 250
58 iso_pu_bacteria 2957457609 2957461495 250
59 iso_pu_bacteria 2957464669 2957469279 250
60 iso_pu_bacteria 2960584000 2960589721 250
61 iso_pu_bacteria 2960603979 2960609437 250
62 iso_pu_bacteria 2960610863 2960615634 250
63 iso_pu_bacteria 2960667422 2960667927 250
64 iso_pu_bacteria 2961114664 2961120368 250
65 iso_pu_bacteria 2964621998 2964626485 250
66 iso_pu_bacteria 2964643177 2964645363 250
67 iso_pu_bacteria 2964656573 2964660642 250
68 iso_pu_bacteria 2964670856 2964670971 250
69 iso_pu_bacteria 2964685014 2964689971 250
70 iso_pu_bacteria 2964691889 2964695562 250
71 iso_pu_bacteria 2967664464 2967670064 250
72 iso_pu_bacteria 2967671571 2967677389 250
73 iso_pu_bacteria 2967699805 2967700691 250
74 iso_pu_bacteria 2967714385 2967717236 250
75 iso_pu_bacteria 2967735183 2967739821 250
76 iso_pu_bacteria 2967742019 2967746273 250
77 iso_pu_bacteria 2968110612 2968116835 250
78 iso_pu_bacteria 2970088815 2970092920 250
79 iso_pu_bacteria 2970095765 2970098704 250
80 iso_pu_bacteria 2970177841 2970179098 250
81 iso_pu_bacteria 2970184632 2970190169 250
82 iso_pu_bacteria 2977516862 2977522429 250
83 iso_pu_bacteria 2977523885 2977527537 250
84 iso_pu_bacteria 648276728 648738381 250
85 iso_pu_bacteria 8019504834 8019505371 250
86 3300017792 Ga0163161_10199212 Ga0163161_101992122 251
87 3300045051 Ga0451576_0023858 Ga0451576_0023858_27_788 251
88 iso_pu_bacteria 2513237104 2513722810 251
89 iso_pu_bacteria 2935630451 2935638025 251
90 iso_pu_bacteria 2935883170 2935890683 251
91 iso_pu_bacteria 2941507105 2941514667 251
92 iso_pu_bacteria 2941515067 2941522589 251
93 iso_pu_bacteria 2941523033 2941530531 251
94 iso_pu_bacteria 8056681323 8056689021 251
95 3300005290 Ga0065712_10103794 Ga0065712_101037942 252
96 3300005331 Ga0070670_100159876 Ga0070670_1001598762 252
97 3300005983 Ga0081540_1006514 Ga0081540_10065147 252
98 3300006358 Ga0068871_100751633 Ga0068871_1007516331 252
99 3300007076 Ga0075435_100200335 Ga0075435_1002003351 252
100 3300009551 Ga0105238_10164968 Ga0105238_101649682 252
101 3300013306 Ga0163162_10275686 Ga0163162_102756862 252
102 3300025925 Ga0207650_10095014 Ga0207650_100950142 252
103 3300026121 Ga0207683_10669916 Ga0207683_106699161 252
104 3300028800 Ga0265338_10033340 Ga0265338_100333405 252
105 3300042876 Ga0451577_0000001 Ga0451577_0000001_1497429_1498193 252
106 3300049570 Ga0501033_0043001 Ga0501033_0043001_1193_1963 252
107 3300049573 Ga0501037_0007267 Ga0501037_0007267_5220_5990 252
108 3300049579 Ga0501043_0457693 Ga0501043_0457693_63_833 252
109 3300049823 Ga0501044_0124526 Ga0501044_0124526_145_915 252
110 3300053136 Ga0500559_0005494 Ga0500559_0005494_718_1482 252
111 3300003215 JGI25153J46596_10004924 JGI25153J46596_100049246 253
112 3300003320 rootH2_10008034 rootH2_1000803418 253
113 3300003322 rootL2_10000040 rootL2_100000408 253
114 3300003323 rootH1_10008851 rootH1_1000885114 253
115 3300005330 Ga0070690_100031713 Ga0070690_1000317133 253
116 3300005336 Ga0070680_100288905 Ga0070680_1002889051 253
117 3300005353 Ga0070669_100639490 Ga0070669_1006394901 253
118 3300005366 Ga0070659_100165743 Ga0070659_1001657432 253
119 3300005436 Ga0070713_100054174 Ga0070713_1000541742 253
120 3300005441 Ga0070700_100214121 Ga0070700_1002141212 253
121 3300005444 Ga0070694_100124788 Ga0070694_1001247881 253
122 3300005455 Ga0070663_100011657 Ga0070663_1000116573 253
123 3300005457 Ga0070662_100121276 Ga0070662_1001212762 253
124 3300005458 Ga0070681_10012085 Ga0070681_100120852 253
125 3300005459 Ga0068867_100399708 Ga0068867_1003997082 253
126 3300005466 Ga0070685_10095167 Ga0070685_100951672 253
127 3300005471 Ga0070698_100331444 Ga0070698_1003314442 253
128 3300005530 Ga0070679_100402247 Ga0070679_1004022472 253
129 3300005544 Ga0070686_100391816 Ga0070686_1003918161 253
130 3300005563 Ga0068855_100080587 Ga0068855_1000805871 253
131 3300005577 Ga0068857_100846168 Ga0068857_1008461681 253
132 3300005618 Ga0068864_100557814 Ga0068864_1005578141 253
133 3300005843 Ga0068860_100457721 Ga0068860_1004577212 253
134 3300005844 Ga0068862_100008309 Ga0068862_1000083096 253
135 3300006186 Ga0075369_10026822 Ga0075369_100268222 253
136 3300006881 Ga0068865_100628562 Ga0068865_1006285621 253
137 3300009093 Ga0105240_10019120 Ga0105240_100191204 253
138 3300009093 Ga0105240_10131728 Ga0105240_101317283 253
139 3300009177 Ga0105248_10648508 Ga0105248_106485081 253
140 3300009545 Ga0105237_10455149 Ga0105237_104551492 253
141 3300013102 Ga0157371_10342053 Ga0157371_103420532 253
142 3300013104 Ga0157370_10371367 Ga0157370_103713672 253
143 3300013105 Ga0157369_10470432 Ga0157369_104704322 253
144 3300013307 Ga0157372_10129704 Ga0157372_101297043 253
145 3300013308 Ga0157375_10391174 Ga0157375_103911742 253
146 3300020078 Ga0206352_10208239 Ga0206352_102082392 253
147 3300022467 Ga0224712_10096016 Ga0224712_100960161 253
148 3300025297 Ga0209758_1000628 Ga0209758_100062848 253
149 3300025912 Ga0207707_10028611 Ga0207707_100286112 253
150 3300025913 Ga0207695_10105007 Ga0207695_101050073 253
151 3300025917 Ga0207660_10464829 Ga0207660_104648292 253
152 3300025921 Ga0207652_10472567 Ga0207652_104725672 253
153 3300025923 Ga0207681_10469445 Ga0207681_104694451 253
154 3300025928 Ga0207700_10201213 Ga0207700_102012132 253
155 3300025938 Ga0207704_10609887 Ga0207704_106098871 253
156 3300025944 Ga0207661_10160996 Ga0207661_101609962 253
157 3300025945 Ga0207679_10011547 Ga0207679_100115473 253
158 3300025949 Ga0207667_10050878 Ga0207667_100508783 253
159 3300026023 Ga0207677_10369714 Ga0207677_103697142 253
160 3300026067 Ga0207678_10022160 Ga0207678_100221604 253
161 3300026089 Ga0207648_10291027 Ga0207648_102910271 253
162 3300026116 Ga0207674_10707190 Ga0207674_107071902 253
163 3300028380 Ga0268265_10075892 Ga0268265_100758922 253
164 3300028381 Ga0268264_10409607 Ga0268264_104096072 253
165 3300028556 Ga0265337_1033854 Ga0265337_10338541 253
166 3300031238 Ga0265332_10005214 Ga0265332_100052142 253
167 3300031251 Ga0265327_10005325 Ga0265327_100053258 253
168 3300031548 Ga0307408_100023592 Ga0307408_1000235922 253
169 3300031711 Ga0265314_10002337 Ga0265314_100023378 253
170 3300031711 Ga0265314_10014389 Ga0265314_100143894 253
171 3300031731 Ga0307405_10139995 Ga0307405_101399952 253
172 3300031824 Ga0307413_10071079 Ga0307413_100710791 253
173 3300031852 Ga0307410_10152579 Ga0307410_101525792 253
174 3300031901 Ga0307406_10088928 Ga0307406_100889282 253
175 3300031901 Ga0307406_10117275 Ga0307406_101172752 253
176 3300031911 Ga0307412_10024423 Ga0307412_100244232 253
177 3300031995 Ga0307409_100057975 Ga0307409_1000579753 253
178 3300031995 Ga0307409_100105483 Ga0307409_1001054832 253
179 3300032002 Ga0307416_100111070 Ga0307416_1001110702 253
180 3300032004 Ga0307414_10129784 Ga0307414_101297842 253
181 3300032005 Ga0307411_10158042 Ga0307411_101580421 253
182 3300032126 Ga0307415_100071567 Ga0307415_1000715672 253
183 3300035172 Ga0373955_0106974 Ga0373955_0106974_560_1360 253
184 3300037068 Ga0373925_0282994 Ga0373925_0282994_388_1188 253
185 3300037466 Ga0395898_0274010 Ga0395898_0274010_37_822 253
186 3300038726 Ga0400490_10463 Ga0400490_10463_3681_4451 253
187 3300039062 Ga0400483_183966 Ga0400483_183966_20919_21692 253
188 3300041512 Ga0451853_2254729 Ga0451853_2254729_413_1186 253
189 3300042134 Ga0450898_015288 Ga0450898_015288_252_1025 253
190 3300044684 Ga0466966_0159658 Ga0466966_0159658_21_797 253
191 3300044712 Ga0453684_0000020 Ga0453684_0000020_846415_847188 253
192 3300044712 Ga0453684_0110387 Ga0453684_0110387_1469_2236 253
193 3300044712 Ga0453684_0228695 Ga0453684_0228695_1064_1831 253
194 3300046689 Ga0495613_0232896 Ga0495613_0232896_245_1018 253
195 3300048908 Ga0496105_0379287 Ga0496105_0379287_147_920 253
196 3300048921 Ga0496118_0006575 Ga0496118_0006575_3108_3881 253
197 3300048921 Ga0496118_0023079 Ga0496118_0023079_2801_3574 253
198 3300049571 Ga0501034_0076207 Ga0501034_0076207_2115_2882 253
199 3300049572 Ga0501036_0003972 Ga0501036_0003972_1295_2068 253
200 3300049575 Ga0501039_0015272 Ga0501039_0015272_411_1184 253
201 3300049576 Ga0501040_0031414 Ga0501040_0031414_71_844 253
202 3300049576 Ga0501040_0418220 Ga0501040_0418220_111_881 253
203 3300049577 Ga0501041_0073283 Ga0501041_0073283_456_1229 253
204 3300049578 Ga0501042_0031694 Ga0501042_0031694_1677_2450 253
205 3300049579 Ga0501043_0212519 Ga0501043_0212519_703_1476 253
206 3300049586 Ga0501070_0046029 Ga0501070_0046029_2681_3457 253
207 3300049586 Ga0501070_0291991 Ga0501070_0291991_165_938 253
208 3300049588 Ga0501072_0002633 Ga0501072_0002633_3566_4339 253
209 3300049590 Ga0501074_0089544 Ga0501074_0089544_24_797 253
210 3300049591 Ga0501075_0002089 Ga0501075_0002089_5202_5975 253
211 3300049591 Ga0501075_0086520 Ga0501075_0086520_1190_1960 253
212 3300049592 Ga0501076_0002054 Ga0501076_0002054_9977_10750 253
213 3300049593 Ga0501077_0016257 Ga0501077_0016257_3120_3893 253
214 3300049593 Ga0501077_0104031 Ga0501077_0104031_464_1237 253
215 3300049741 Ga0501079_0101119 Ga0501079_0101119_222_995 253
216 3300049742 Ga0501080_0362672 Ga0501080_0362672_158_925 253
217 3300049743 Ga0501081_0122483 Ga0501081_0122483_623_1396 253
218 3300049822 Ga0501035_0032015 Ga0501035_0032015_71_844 253
219 3300049824 Ga0501045_0047245 Ga0501045_0047245_1182_1955 253
220 3300050516 nmdc:mga0sz30_45853_c1 nmdc:mga0sz30_45853_c1_785_1558 253
221 3300053153 Ga0500616_0002276 Ga0500616_0002276_5160_5927 253
222 3300053153 Ga0500616_0184370 Ga0500616_0184370_85_855 253
223 3300053158 Ga0500627_0001581 Ga0500627_0001581_2986_3759 253
224 3300053730 Ga0500645_018722 Ga0500645_018722_214_987 253
225 3300054114 Ga0501084_0654521 Ga0501084_0654521_88_861 253
226 3300060353 Ga0501082_0070695 Ga0501082_0070695_1363_2136 253
227 3300061734 Ga0530510_0003659 Ga0530510_0003659_6443_7216 253
228 3300061734 Ga0530510_0393242 Ga0530510_0393242_131_901 253
229 iso_pu_bacteria 8016630954 8016632918 253
230 3300004800 Ga0058861_12075980 Ga0058861_120759801 254
231 3300005288 Ga0065714_10068111 Ga0065714_100681114 254
232 3300005289 Ga0065704_10075142 Ga0065704_100751425 254
233 3300005293 Ga0065715_10222802 Ga0065715_102228021 254
234 3300005327 Ga0070658_10010293 Ga0070658_100102932 254
235 3300005327 Ga0070658_10043883 Ga0070658_100438832 254
236 3300005330 Ga0070690_100036391 Ga0070690_1000363912 254
237 3300005334 Ga0068869_100053794 Ga0068869_1000537942 254
238 3300005336 Ga0070680_100007419 Ga0070680_1000074194 254
239 3300005336 Ga0070680_100097059 Ga0070680_1000970593 254
240 3300005340 Ga0070689_100193624 Ga0070689_1001936242 254
241 3300005353 Ga0070669_100023032 Ga0070669_1000230324 254
242 3300005366 Ga0070659_100441739 Ga0070659_1004417392 254
243 3300005436 Ga0070713_100022820 Ga0070713_1000228204 254
244 3300005436 Ga0070713_100389447 Ga0070713_1003894472 254
245 3300005437 Ga0070710_10030913 Ga0070710_100309132 254
246 3300005437 Ga0070710_10214402 Ga0070710_102144021 254
247 3300005439 Ga0070711_100056035 Ga0070711_1000560352 254
248 3300005456 Ga0070678_100016026 Ga0070678_1000160265 254
249 3300005456 Ga0070678_100031710 Ga0070678_1000317103 254
250 3300005458 Ga0070681_10007242 Ga0070681_100072429 254
251 3300005458 Ga0070681_10008929 Ga0070681_100089293 254
252 3300005458 Ga0070681_10034142 Ga0070681_100341425 254
253 3300005458 Ga0070681_10066183 Ga0070681_100661833 254
254 3300005459 Ga0068867_100154765 Ga0068867_1001547652 254
255 3300005467 Ga0070706_100032224 Ga0070706_1000322244 254
256 3300005467 Ga0070706_100056635 Ga0070706_1000566353 254
257 3300005467 Ga0070706_100231754 Ga0070706_1002317542 254
258 3300005468 Ga0070707_100160425 Ga0070707_1001604253 254
259 3300005471 Ga0070698_100000229 Ga0070698_10000022917 254
260 3300005471 Ga0070698_100009796 Ga0070698_1000097962 254
261 3300005471 Ga0070698_100099966 Ga0070698_1000999663 254
262 3300005471 Ga0070698_100564484 Ga0070698_1005644841 254
263 3300005518 Ga0070699_100026893 Ga0070699_1000268933 254
264 3300005518 Ga0070699_100459014 Ga0070699_1004590141 254
265 3300005530 Ga0070679_100011032 Ga0070679_1000110323 254
266 3300005530 Ga0070679_100030534 Ga0070679_1000305343 254
267 3300005530 Ga0070679_100086879 Ga0070679_1000868792 254
268 3300005530 Ga0070679_100169517 Ga0070679_1001695172 254
269 3300005535 Ga0070684_100014502 Ga0070684_1000145025 254
270 3300005536 Ga0070697_100071601 Ga0070697_1000716013 254
271 3300005546 Ga0070696_100002003 Ga0070696_1000020037 254
272 3300005548 Ga0070665_100048548 Ga0070665_1000485482 254
273 3300005563 Ga0068855_100001147 Ga0068855_10000114721 254
274 3300005563 Ga0068855_100009153 Ga0068855_1000091533 254
275 3300005563 Ga0068855_100082797 Ga0068855_1000827972 254
276 3300005577 Ga0068857_100189448 Ga0068857_1001894482 254
277 3300005614 Ga0068856_100016724 Ga0068856_1000167246 254
278 3300005617 Ga0068859_100115359 Ga0068859_1001153591 254
279 3300005618 Ga0068864_100927243 Ga0068864_1009272431 254
280 3300005719 Ga0068861_100613892 Ga0068861_1006138922 254
281 3300005840 Ga0068870_10066078 Ga0068870_100660782 254
282 3300005937 Ga0081455_10000679 Ga0081455_100006795 254
283 3300005937 Ga0081455_10005986 Ga0081455_100059866 254
284 3300005937 Ga0081455_10131541 Ga0081455_101315411 254
285 3300006028 Ga0070717_10136601 Ga0070717_101366012 254
286 3300006038 Ga0075365_10154328 Ga0075365_101543282 254
287 3300006173 Ga0070716_100000001 Ga0070716_100000001351 254
288 3300006175 Ga0070712_100162695 Ga0070712_1001626952 254
289 3300006237 Ga0097621_100081995 Ga0097621_1000819953 254
290 3300006237 Ga0097621_100394194 Ga0097621_1003941942 254
291 3300006931 Ga0097620_100115357 Ga0097620_1001153573 254
292 3300007265 Ga0099794_10005493 Ga0099794_100054932 254
293 3300007788 Ga0099795_10117592 Ga0099795_101175921 254
294 3300009011 Ga0105251_10001908 Ga0105251_100019083 254
295 3300009036 Ga0105244_10000783 Ga0105244_1000078323 254
296 3300009093 Ga0105240_10035059 Ga0105240_100350592 254
297 3300009093 Ga0105240_10038367 Ga0105240_100383676 254
298 3300009093 Ga0105240_10112395 Ga0105240_101123952 254
299 3300009093 Ga0105240_10441133 Ga0105240_104411332 254
300 3300009098 Ga0105245_10604829 Ga0105245_106048292 254
301 3300009101 Ga0105247_10133212 Ga0105247_101332122 254
302 3300009147 Ga0114129_10096840 Ga0114129_100968403 254
303 3300009174 Ga0105241_10468572 Ga0105241_104685721 254
304 3300009176 Ga0105242_10066263 Ga0105242_100662634 254
305 3300009177 Ga0105248_10556375 Ga0105248_105563752 254
306 3300009545 Ga0105237_10108814 Ga0105237_101088142 254
307 3300009545 Ga0105237_10368543 Ga0105237_103685432 254
308 3300009551 Ga0105238_10008139 Ga0105238_100081394 254
309 3300009551 Ga0105238_10068035 Ga0105238_100680352 254
310 3300010159 Ga0099796_10013632 Ga0099796_100136322 254
311 3300010375 Ga0105239_10133686 Ga0105239_101336863 254
312 3300011119 Ga0105246_10000490 Ga0105246_100004902 254
313 3300011119 Ga0105246_10351534 Ga0105246_103515342 254
314 3300013104 Ga0157370_10002664 Ga0157370_100026642 254
315 3300013104 Ga0157370_10009088 Ga0157370_100090885 254
316 3300013105 Ga0157369_10004921 Ga0157369_100049213 254
317 3300013105 Ga0157369_10080767 Ga0157369_100807673 254
318 3300013296 Ga0157374_10541760 Ga0157374_105417602 254
319 3300013307 Ga0157372_10535770 Ga0157372_105357702 254
320 3300013307 Ga0157372_10948970 Ga0157372_109489702 254
321 3300013308 Ga0157375_10000629 Ga0157375_100006298 254
322 3300013308 Ga0157375_10424719 Ga0157375_104247192 254
323 3300014325 Ga0163163_10003054 Ga0163163_1000305411 254
324 3300014325 Ga0163163_10288020 Ga0163163_102880202 254
325 3300014497 Ga0182008_10002216 Ga0182008_1000221611 254
326 3300014968 Ga0157379_10002195 Ga0157379_100021953 254
327 3300014968 Ga0157379_10198050 Ga0157379_101980502 254
328 3300014968 Ga0157379_10204010 Ga0157379_102040102 254
329 3300017792 Ga0163161_10082936 Ga0163161_100829362 254
330 3300020069 Ga0197907_10300375 Ga0197907_103003751 254
331 3300020070 Ga0206356_10118893 Ga0206356_101188932 254
332 3300020070 Ga0206356_11813778 Ga0206356_118137781 254
333 3300020077 Ga0206351_10004824 Ga0206351_100048241 254
334 3300020081 Ga0206354_10552570 Ga0206354_105525701 254
335 3300020082 Ga0206353_10185489 Ga0206353_101854891 254
336 3300021358 Ga0213873_10042597 Ga0213873_100425972 254
337 3300021384 Ga0213876_10017929 Ga0213876_100179292 254
338 3300022467 Ga0224712_10001804 Ga0224712_100018045 254
339 3300022467 Ga0224712_10002191 Ga0224712_100021911 254
340 3300022467 Ga0224712_10020238 Ga0224712_100202381 254
341 3300022467 Ga0224712_10088131 Ga0224712_100881312 254
342 3300022467 Ga0224712_10122870 Ga0224712_101228701 254
343 3300022467 Ga0224712_10145105 Ga0224712_101451052 254
344 3300025735 Ga0207713_1001686 Ga0207713_100168617 254
345 3300025898 Ga0207692_10015697 Ga0207692_100156972 254
346 3300025900 Ga0207710_10161264 Ga0207710_101612641 254
347 3300025901 Ga0207688_10089314 Ga0207688_100893142 254
348 3300025909 Ga0207705_10039212 Ga0207705_100392122 254
349 3300025910 Ga0207684_10016442 Ga0207684_100164423 254
350 3300025910 Ga0207684_10026203 Ga0207684_100262033 254
351 3300025911 Ga0207654_10270798 Ga0207654_102707982 254
352 3300025912 Ga0207707_10003776 Ga0207707_1000377610 254
353 3300025912 Ga0207707_10014184 Ga0207707_100141842 254
354 3300025912 Ga0207707_10045534 Ga0207707_100455343 254
355 3300025912 Ga0207707_10113576 Ga0207707_101135762 254
356 3300025913 Ga0207695_10006739 Ga0207695_1000673911 254
357 3300025913 Ga0207695_10042155 Ga0207695_100421552 254
358 3300025913 Ga0207695_10060575 Ga0207695_100605753 254
359 3300025914 Ga0207671_10041349 Ga0207671_100413493 254
360 3300025915 Ga0207693_10025413 Ga0207693_100254134 254
361 3300025915 Ga0207693_10274472 Ga0207693_102744722 254
362 3300025917 Ga0207660_10009454 Ga0207660_100094543 254
363 3300025917 Ga0207660_10011552 Ga0207660_100115522 254
364 3300025917 Ga0207660_10073983 Ga0207660_100739832 254
365 3300025917 Ga0207660_10292960 Ga0207660_102929602 254
366 3300025921 Ga0207652_10006501 Ga0207652_100065018 254
367 3300025921 Ga0207652_10020131 Ga0207652_100201313 254
368 3300025921 Ga0207652_10045269 Ga0207652_100452692 254
369 3300025921 Ga0207652_10101220 Ga0207652_101012203 254
370 3300025924 Ga0207694_10008696 Ga0207694_100086966 254
371 3300025928 Ga0207700_10026680 Ga0207700_100266804 254
372 3300025928 Ga0207700_10151886 Ga0207700_101518862 254
373 3300025928 Ga0207700_10324709 Ga0207700_103247091 254
374 3300025929 Ga0207664_10038416 Ga0207664_100384163 254
375 3300025933 Ga0207706_10180012 Ga0207706_101800122 254
376 3300025936 Ga0207670_10429549 Ga0207670_104295491 254
377 3300025939 Ga0207665_10000002 Ga0207665_10000002223 254
378 3300025941 Ga0207711_10337008 Ga0207711_103370082 254
379 3300025942 Ga0207689_10109936 Ga0207689_101099361 254
380 3300025949 Ga0207667_10000927 Ga0207667_1000092730 254
381 3300025949 Ga0207667_10032914 Ga0207667_100329142 254
382 3300025949 Ga0207667_10163664 Ga0207667_101636642 254
383 3300026035 Ga0207703_10016711 Ga0207703_100167112 254
384 3300026078 Ga0207702_10034771 Ga0207702_100347715 254
385 3300026089 Ga0207648_10082153 Ga0207648_100821532 254
386 3300026089 Ga0207648_10363845 Ga0207648_103638452 254
387 3300026095 Ga0207676_10708763 Ga0207676_107087631 254
388 3300026116 Ga0207674_10171845 Ga0207674_101718452 254
389 3300026116 Ga0207674_10746600 Ga0207674_107466002 254
390 3300026118 Ga0207675_100443047 Ga0207675_1004430472 254
391 3300026121 Ga0207683_10061340 Ga0207683_100613404 254
392 3300026121 Ga0207683_10075657 Ga0207683_100756572 254
393 3300026142 Ga0207698_10312661 Ga0207698_103126612 254
394 3300027111 Ga0209281_1000547 Ga0209281_100054725 254
395 3300028379 Ga0268266_10006924 Ga0268266_100069245 254
396 3300028573 Ga0265334_10003091 Ga0265334_100030915 254
397 3300028573 Ga0265334_10009303 Ga0265334_100093033 254
398 3300028577 Ga0265318_10081539 Ga0265318_100815391 254
399 3300028794 Ga0307515_10006229 Ga0307515_1000622910 254
400 3300031250 Ga0265331_10003584 Ga0265331_100035846 254
401 3300031251 Ga0265327_10034980 Ga0265327_100349802 254
402 3300031507 Ga0307509_10309770 Ga0307509_103097701 254
403 3300031548 Ga0307408_100004836 Ga0307408_1000048363 254
404 3300031727 Ga0316576_10162678 Ga0316576_101626782 254
405 3300031728 Ga0316578_10076786 Ga0316578_100767863 254
406 3300031728 Ga0316578_10093655 Ga0316578_100936552 254
407 3300031728 Ga0316578_10260783 Ga0316578_102607832 254
408 3300031733 Ga0316577_10010591 Ga0316577_100105916 254
409 3300032005 Ga0307411_10021817 Ga0307411_100218174 254
410 3300032137 Ga0316585_10054310 Ga0316585_100543102 254
411 3300032139 Ga0316580_10018799 Ga0316580_100187992 254
412 3300032168 Ga0316593_10033471 Ga0316593_100334712 254
413 3300033524 Ga0316592_1003348 Ga0316592_10033483 254
414 3300033541 Ga0316596_1007122 Ga0316596_10071222 254
415 3300036401 Ga0373937_0283492 Ga0373937_0283492_328_1098 254
416 3300036647 Ga0316582_0046478 Ga0316582_0046478_1435_2205 254
417 3300036712 Ga0316584_0099710 Ga0316584_0099710_344_1114 254
418 3300037068 Ga0373925_0130487 Ga0373925_0130487_32_910 254
419 3300037312 Ga0395899_0023786 Ga0395899_0023786_2723_3577 254
420 3300037312 Ga0395899_0038937 Ga0395899_0038937_343_1269 254
421 3300037418 Ga0395900_0017307 Ga0395900_0017307_2046_2900 254
422 3300037418 Ga0395900_0023417 Ga0395900_0023417_64_990 254
423 3300037418 Ga0395900_0182228 Ga0395900_0182228_49_834 254
424 3300037418 Ga0395900_0294704 Ga0395900_0294704_194_967 254
425 3300037466 Ga0395898_0046730 Ga0395898_0046730_2810_3736 254
426 3300037466 Ga0395898_0077145 Ga0395898_0077145_1657_2442 254
427 3300037471 Ga0395905_0353349 Ga0395905_0353349_414_1187 254
428 3300037471 Ga0395905_0421634 Ga0395905_0421634_357_1130 254
429 3300038443 Ga0395901_0014999 Ga0395901_0014999_6997_7851 254
430 3300038443 Ga0395901_0024360 Ga0395901_0024360_2603_3529 254
431 3300038725 Ga0400484_44773 Ga0400484_44773_1387_2160 254
432 3300039062 Ga0400483_015883 Ga0400483_015883_2192_2962 254
433 3300039062 Ga0400483_150553 Ga0400483_150553_61_831 254
434 3300039437 Ga0436365_0296501 Ga0436365_0296501_162_935 254
435 3300039437 Ga0436365_0319120 Ga0436365_0319120_10843_11616 254
436 3300039438 Ga0436360_0906789 Ga0436360_0906789_456_1238 254
437 3300039438 Ga0436360_1262558 Ga0436360_1262558_471_1244 254
438 3300039453 Ga0436362_0091673 Ga0436362_0091673_2417_3190 254
439 3300039453 Ga0436362_0144001 Ga0436362_0144001_22_795 254
440 3300039453 Ga0436362_1282354 Ga0436362_1282354_1003_1773 254
441 3300042010 Ga0439452_000020 Ga0439452_000020_256803_257672 254
442 3300042126 Ga0450888_001864 Ga0450888_001864_858_1631 254
443 3300044656 Ga0466969_0043134 Ga0466969_0043134_1163_1948 254
444 3300044683 Ga0466965_0004523 Ga0466965_0004523_2283_3056 254
445 3300044693 Ga0466961_0270045 Ga0466961_0270045_127_900 254
446 3300044694 Ga0466963_0099901 Ga0466963_0099901_214_987 254
447 3300044712 Ga0453684_0006299 Ga0453684_0006299_5179_5949 254
448 3300044712 Ga0453684_0070320 Ga0453684_0070320_337_1107 254
449 3300044901 Ga0466960_0205438 Ga0466960_0205438_195_968 254
450 3300045049 Ga0466959_0029349 Ga0466959_0029349_1919_2707 254
451 3300045049 Ga0466959_0118067 Ga0466959_0118067_209_991 254
452 3300045836 Ga0466958_0056212 Ga0466958_0056212_98_883 254
453 3300045976 Ga0466967_0552490 Ga0466967_0552490_210_1040 254
454 3300046460 Ga0495638_0000602 Ga0495638_0000602_27456_28229 254
455 3300046471 Ga0495650_0000454 Ga0495650_0000454_59096_59869 254
456 3300046472 Ga0495580_0303097 Ga0495580_0303097_204_977 254
457 3300046474 Ga0495605_0011627 Ga0495605_0011627_3848_4621 254
458 3300046501 Ga0495607_0000962 Ga0495607_0000962_14214_14987 254
459 3300046506 Ga0495583_0000553 Ga0495583_0000553_7549_8322 254
460 3300046513 Ga0495616_0000178 Ga0495616_0000178_30894_31667 254
461 3300046518 Ga0495631_0000838 Ga0495631_0000838_13544_14317 254
462 3300046519 Ga0495632_0000110 Ga0495632_0000110_21407_22180 254
463 3300046520 Ga0495637_0004155 Ga0495637_0004155_1227_2000 254
464 3300046522 Ga0495643_0015981 Ga0495643_0015981_185_958 254
465 3300046528 Ga0495642_0006402 Ga0495642_0006402_1632_2405 254
466 3300046530 Ga0495654_0010562 Ga0495654_0010562_2247_3020 254
467 3300046538 Ga0495609_0000002 Ga0495609_0000002_520610_521383 254
468 3300046665 Ga0495661_0000207 Ga0495661_0000207_44223_44996 254
469 3300046665 Ga0495661_0000723 Ga0495661_0000723_6641_7414 254
470 3300046665 Ga0495661_0004690 Ga0495661_0004690_5181_5954 254
471 3300046683 Ga0495658_0321157 Ga0495658_0321157_115_885 254
472 3300046692 Ga0495671_0046698 Ga0495671_0046698_1306_2079 254
473 3300046694 Ga0495649_0245336 Ga0495649_0245336_101_874 254
474 3300046794 Ga0495589_0000009 Ga0495589_0000009_215473_216246 254
475 3300047320 Ga0495672_0035241 Ga0495672_0035241_639_1412 254
476 3300047443 Ga0495687_000013 Ga0495687_000013_215473_216246 254
477 3300047443 Ga0495687_000811 Ga0495687_000811_12097_12870 254
478 3300047445 Ga0495677_0000024 Ga0495677_0000024_38027_38800 254
479 3300047446 Ga0495679_000373 Ga0495679_000373_26033_26806 254
480 3300047472 Ga0495686_0094149 Ga0495686_0094149_113_886 254
481 3300048091 Ga0495626_0000151 Ga0495626_0000151_33613_34386 254
482 3300048091 Ga0495626_0005839 Ga0495626_0005839_3063_3836 254
483 3300048912 Ga0496109_0084440 Ga0496109_0084440_289_1059 254
484 3300048919 Ga0496116_0000500 Ga0496116_0000500_1298_2068 254
485 3300048919 Ga0496116_0061746 Ga0496116_0061746_914_1684 254
486 3300048920 Ga0496117_0002526 Ga0496117_0002526_3080_3853 254
487 3300048920 Ga0496117_0026078 Ga0496117_0026078_893_1663 254
488 3300048921 Ga0496118_0002734 Ga0496118_0002734_3354_4127 254
489 3300048921 Ga0496118_0068004 Ga0496118_0068004_757_1527 254
490 3300048922 Ga0496119_0001539 Ga0496119_0001539_1296_2066 254
491 3300048924 Ga0496121_0002258 Ga0496121_0002258_24660_25433 254
492 3300048925 Ga0496122_0029791 Ga0496122_0029791_1373_2143 254
493 3300048927 Ga0496124_0013995 Ga0496124_0013995_4825_5598 254
494 3300048927 Ga0496124_0081936 Ga0496124_0081936_61_831 254
495 3300048927 Ga0496124_0147571 Ga0496124_0147571_534_1304 254
496 3300048928 Ga0496125_0038497 Ga0496125_0038497_2337_3107 254
497 3300049522 Ga0501299_016515 Ga0501299_016515_405_1178 254
498 3300049588 Ga0501072_0007546 Ga0501072_0007546_5555_6325 254
499 3300049591 Ga0501075_0417637 Ga0501075_0417637_118_894 254
500 3300050492 nmdc:mga0yw44_221884_c1 nmdc:mga0yw44_221884_c1_235_1005 254
501 3300050507 nmdc:mga05p37_19510_c1 nmdc:mga05p37_19510_c1_4081_4854 254
502 3300050512 nmdc:mga0n895_193051_c1 nmdc:mga0n895_193051_c1_949_1722 254
503 3300050515 nmdc:mga0a205_169116_c1 nmdc:mga0a205_169116_c1_46_819 254
504 3300053085 Ga0495619_0276360 Ga0495619_0276360_136_906 254
505 3300053091 Ga0500647_0217439 Ga0500647_0217439_14_799 254
506 3300053092 Ga0500583_0129257 Ga0500583_0129257_303_1088 254
507 3300053119 Ga0500595_009012 Ga0500595_009012_2763_3533 254
508 3300053124 Ga0500617_092539 Ga0500617_092539_495_1268 254
509 3300053134 Ga0500658_0013446 Ga0500658_0013446_1487_2260 254
510 3300053153 Ga0500616_0000018 Ga0500616_0000018_568400_569185 254
511 3300053153 Ga0500616_0096217 Ga0500616_0096217_405_1199 254
512 3300053161 Ga0500634_0000104 Ga0500634_0000104_6670_7443 254
513 3300059421 Ga0590071_011742 Ga0590071_011742_988_1761 254
514 3300059504 Ga0587082_016198 Ga0587082_016198_230_1015 254
515 3300059508 Ga0587088_013855 Ga0587088_013855_388_1161 254
516 3300059511 Ga0587091_010222 Ga0587091_010222_532_1317 254
517 3300059643 Ga0587072_034318 Ga0587072_034318_111_884 254
518 3300061734 Ga0530510_0129888 Ga0530510_0129888_790_1560 254
519 3300005347 Ga0070668_100366372 Ga0070668_1003663721 255
520 3300005719 Ga0068861_100002243 Ga0068861_1000022437 255
521 3300007265 Ga0099794_10064511 Ga0099794_100645111 255
522 3300007788 Ga0099795_10001876 Ga0099795_100018763 255
523 3300010159 Ga0099796_10000295 Ga0099796_100002955 255
524 3300025972 Ga0207668_10454178 Ga0207668_104541782 255
525 3300026118 Ga0207675_100074734 Ga0207675_1000747341 255
526 3300027512 Ga0209179_1000201 Ga0209179_10002015 255
527 3300028017 Ga0265356_1001416 Ga0265356_10014164 255
528 3300028573 Ga0265334_10001556 Ga0265334_100015563 255
529 3300061734 Ga0530510_0419788 Ga0530510_0419788_154_927 255
530 3300013306 Ga0163162_10077042 Ga0163162_100770422 256
531 3300005353 Ga0070669_100396106 Ga0070669_1003961062 257
532 3300005366 Ga0070659_100383333 Ga0070659_1003833331 257
533 3300005549 Ga0070704_100385297 Ga0070704_1003852971 257
534 3300009176 Ga0105242_10710026 Ga0105242_107100261 257
535 3300031235 Ga0265330_10024209 Ga0265330_100242092 257
536 3300031247 Ga0265340_10009277 Ga0265340_100092772 257
537 3300013308 Ga0157375_10735758 Ga0157375_107357582 258
538 3300026035 Ga0207703_10341848 Ga0207703_103418482 258
539 3300005331 Ga0070670_100003750 Ga0070670_1000037505 259
540 3300005336 Ga0070680_100019022 Ga0070680_1000190223 259
541 3300005344 Ga0070661_100024247 Ga0070661_1000242471 259
542 3300005355 Ga0070671_100117833 Ga0070671_1001178331 259
543 3300005366 Ga0070659_100020751 Ga0070659_1000207514 259
544 3300005457 Ga0070662_100054577 Ga0070662_1000545772 259
545 3300005458 Ga0070681_10000391 Ga0070681_1000039132 259
546 3300005530 Ga0070679_100010196 Ga0070679_1000101961 259
547 3300005840 Ga0068870_10068334 Ga0068870_100683342 259
548 3300006844 Ga0075428_100848386 Ga0075428_1008483862 259
549 3300013105 Ga0157369_10278894 Ga0157369_102788942 259
550 3300013297 Ga0157378_10677494 Ga0157378_106774941 259
551 3300014325 Ga0163163_10001907 Ga0163163_100019078 259
552 3300025912 Ga0207707_10016325 Ga0207707_100163252 259
553 3300025917 Ga0207660_10033713 Ga0207660_100337132 259
554 3300025920 Ga0207649_10012195 Ga0207649_100121952 259
555 3300025921 Ga0207652_10156827 Ga0207652_101568272 259
556 3300025932 Ga0207690_10116443 Ga0207690_101164432 259
557 3300025933 Ga0207706_10068767 Ga0207706_100687673 259
558 3300025945 Ga0207679_10048003 Ga0207679_100480034 259
559 3300026078 Ga0207702_10620199 Ga0207702_106201991 259
560 3300026116 Ga0207674_10000111 Ga0207674_1000011145 259
561 3300048915 Ga0496112_0190493 Ga0496112_0190493_448_1236 259
562 3300046522 Ga0495643_0183825 Ga0495643_0183825_201_989 260
563 3300049589 Ga0501073_0429424 Ga0501073_0429424_79_879 260
564 3300005536 Ga0070697_100212008 Ga0070697_1002120081 263
565 iso_pu_bacteria 3003930520 3003934179 267
566 iso_pu_bacteria 2643221557 2643805502 268
567 iso_pu_bacteria 2643221610 2644068256 268
568 iso_pu_bacteria 2643221668 2644376088 268
569 iso_pu_bacteria 2643221675 2644419182 268
570 iso_pu_bacteria 2643221680 2644452539 268
571 iso_pu_bacteria 2643221726 2644691313 268
572 iso_pu_bacteria 2838074704 2838077687 268
573 iso_pu_bacteria 2896384573 2896389628 268
574 iso_pu_bacteria 2920760137 2920765066 268
575 iso_pu_bacteria 2977565890 2977565891 268
576 iso_pu_bacteria 2508501127 2509143031 270
577 iso_pu_bacteria 2869162929 2869168591 270
578 iso_pu_bacteria 2882632389 2882637786 270
579 iso_pu_bacteria 2885312484 2885316058 270
580 iso_pu_bacteria 8055617313 8055622917 270
581 3300003775 Ga0055524_1000412 Ga0055524_100041221 272
582 3300025294 Ga0209025_1009820 Ga0209025_10098201 272
583 3300025299 Ga0209256_1000412 Ga0209256_100041227 272
584 iso_pu_bacteria 2509276019 2509377122 272
585 iso_pu_bacteria 2558860100 2558862355 272
586 iso_pu_bacteria 2850079185 2850085261 272
587 3300032002 Ga0307416_100947185 Ga0307416_1009471852 274
588 iso_pu_bacteria 2508501122 2509109944 274
589 iso_pu_bacteria 2855872281 2855872568 274
590 3300003320 rootH2_10067998 rootH2_100679983 275
591 3300004799 Ga0058863_11804459 Ga0058863_118044592 275
592 3300004800 Ga0058861_11441847 Ga0058861_114418472 275
593 3300004803 Ga0058862_12726379 Ga0058862_127263792 275
594 3300009148 Ga0105243_10005913 Ga0105243_100059134 275
595 3300049569 Ga0501032_0122988 Ga0501032_0122988_32_901 275
596 3300049571 Ga0501034_0009667 Ga0501034_0009667_8963_9832 275
597 3300049573 Ga0501037_0056280 Ga0501037_0056280_266_1135 275
598 3300049579 Ga0501043_0137738 Ga0501043_0137738_934_1803 275
599 3300049580 Ga0501046_0103190 Ga0501046_0103190_920_1789 275
600 3300049581 Ga0501047_0036234 Ga0501047_0036234_3083_3952 275
601 3300049586 Ga0501070_0084292 Ga0501070_0084292_557_1426 275
602 3300049589 Ga0501073_0106349 Ga0501073_0106349_622_1491 275
603 3300049822 Ga0501035_0023170 Ga0501035_0023170_4293_5162 275
604 3300049823 Ga0501044_0052019 Ga0501044_0052019_1131_2000 275
605 iso_pu_bacteria 2874123672 2874130870 275
606 iso_pu_bacteria 2889790730 2889796208 275
607 3300021327 Ga0214543_1000005 Ga0214543_1000005360 276
608 3300039438 Ga0436360_0664306 Ga0436360_0664306_334_1203 276
609 3300003203 JGI25406J46586_10035637 JGI25406J46586_100356371 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

53

125

0.85

PF00483

NTP_transferase

Nucleotidyl transferase

53

286

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.9064 2 256
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9052 2 256
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8951 2 256
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8927 2 256
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8099 1 248
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9064 2 256 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8927 2 256 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7955 2 249 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7856 1 248 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7767 2 249 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A383BKH4-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9686 1 148 GO:0009058
GO:0047343
AF-A0A529I2Z1-F1-model_v4 deleted 0.9681 1 148
AF-A0A382IIP5-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9611 1 163 GO:0009058
GO:0047343
AF-A0A258KUJ6-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.961 1 144 GO:0009058
GO:0047343
AF-A0A257GWQ9-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9609 1 135 GO:0009058
GO:0047343

Feature Viewer

pLDDT pTM Quality
85.86 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map