F468878
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 609 | 384 | 548 | 574 |
Family's Representative Sequence
| Representative Sequence | 3300027907|Ga0207428_10002133|Ga0207428_1000213317 |
| Length | 689 |
| Sequence | MSDPLLGLSMLALIVAAIMMGFPTAFTMMGLGMFFGYLAFWDPASHHWLDNQIFDLMVQRTYGVMNNDTLLSIPLFVFMGYIIERAALVDKMFFSVQLAFRRLPASLAVTTLLVCAFWGIASGIVGAVVVLMGVIAMRPMLKAGYDVRLASGVITAGGTLGILIPPSVMIIVYAAVAGQSIVKLYAAAMLPGFFLTFLYLVYIIGWAMLNPKIAPKLGEDEFRITVPAWLTKVERGPSRRVFVGLLQALFRPGMLKATIRPDGLAVDYPFILKNVFSLLVPAGLVVALFHNAAPVDVQPGSAISERTAQAPQSTESTKPALPEAQPQAPGGSAEQPELSSSEASTPDPAVKEEGPPEQVGMEVQERNEALGRIPENFYAWFWGLALLSAIVVFIYYWRLDGEHFEILKLLESSVVPLGVLTFIVLAVILFGITTATESAGVGALGAMYLAGYSKYPHRVLWSSLVGVIDVATLIVSGSLGGVFLGTFVPWLWDFATRRQLLQNLKESTFLTAKTTAMVCWLFVGSALFSAVFALHGGQGIIERWVLSLNMTPVQFLLLSQAIIFFLGWPLEWTEIIVIFIPXXXXLLAHFNVDPVLFGTMVAVNLQAAFLSPPVAMSAFYLKGVSPPHVTLNQIFAGMMPYMLIVILCLVCMYIWPGMTLWLPNFLVWELMPLRDPVREFRSSRWLLFS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 8 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 9 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 10 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 11 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 12 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 13 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 14 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 15 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 16 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 17 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 18 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 19 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 20 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 21 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 22 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 23 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 24 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 25 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 26 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 27 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 28 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 29 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 30 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 31 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 32 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 33 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 34 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 35 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 36 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 37 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 38 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 39 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 40 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 41 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 42 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 43 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 44 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 45 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 46 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 47 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 48 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 49 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 50 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 51 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 52 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 53 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 54 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 55 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 56 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 57 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 58 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 59 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 61 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 63 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 65 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 66 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 67 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 68 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 69 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 70 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 71 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 73 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 74 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 75 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 78 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 80 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 83 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 89 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 92 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 98 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 109 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 115 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 120 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 121 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 122 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 124 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 125 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 126 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 127 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 128 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 129 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 130 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 131 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 132 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 133 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 134 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 136 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 137 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 138 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 139 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 140 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 141 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 142 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 143 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 144 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 145 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 147 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 148 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 149 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 150 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 151 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 152 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 153 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 154 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 156 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 157 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 169 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 182 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 183 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 243 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 246 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 247 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 248 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 253 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 254 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 255 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 256 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 257 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 258 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 259 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 262 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 263 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 275 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 280 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 282 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 283 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 284 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 323 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 333 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 364 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 365 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 367 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 369 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 370 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 371 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 372 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 373 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 375 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 376 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 379 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 380 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 381 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 382 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 383 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 384 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.98 |
| Metatranscriptomes | 0 |
| Isolates | 10.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.88 |
| Nodule | 5.42 |
| Rhizoplane | 7.55 |
| Rhizosphere | 58.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_531915 | 2162886007 | Bacteria | 2322 |
| 2 | 2214828545 | 2209111006 | Bacteria | 9090 |
| 3 | ARcpr5oldR_c001419 | 3300000041 | Bacteria | 2416 |
| 4 | ARSoilYngRDRAFT_c00204 | 3300000042 | Bacteria | 9917 |
| 5 | ARcpr5yngRDRAFT_c001717 | 3300000043 | Bacteria | 2360 |
| 6 | ARSoilOldRDRAFT_c000097 | 3300000044 | Bacteria | 16585 |
| 7 | ARCol0oldRDRAFT_c00920 | 3300000045 | Bacteria | 2296 |
| 8 | ARCol0yngRDRAFT_1000138 | 3300000652 | Bacteria | 12930 |
| 9 | JGI24750J21931_1000071 | 3300002070 | Bacteria | 14849 |
| 10 | JGI24749J21850_1000123 | 3300002076 | Bacteria | 13152 |
| 11 | JGI24751J29686_10006799 | 3300002459 | Bacteria | 2331 |
| 12 | JGI25158J39367_1001450 | 3300002739 | Bacteria | 4148 |
| 13 | JGI25159J45721_1000004 | 3300002987 | Bacteria | 215789 |
| 14 | JGI25151J46595_10000246 | 3300003187 | Bacteria | 63372 |
| 15 | JGI25406J46586_10000160 | 3300003203 | Bacteria | 30150 |
| 16 | JGI25153J46596_10001104 | 3300003215 | Bacteria | 16391 |
| 17 | JGI25160J50197_1000021 | 3300003354 | Bacteria | 215789 |
| 18 | JGI25161J50226_1000218 | 3300003374 | Bacteria | 36216 |
| 19 | Ga0055526_1001422 | 3300003771 | Bacteria | 17040 |
| 20 | Ga0055536_1000269 | 3300003781 | Bacteria | 39889 |
| 21 | Ga0055536_1000891 | 3300003781 | Bacteria | 19442 |
| 22 | Ga0055528_1001600 | 3300003790 | Bacteria | 13383 |
| 23 | Ga0055530_10002560 | 3300003791 | Bacteria | 11547 |
| 24 | Ga0055540_1001142 | 3300003792 | Bacteria | 16576 |
| 25 | Ga0055540_1003959 | 3300003792 | Bacteria | 6912 |
| 26 | Ga0055531_10000158 | 3300003794 | Bacteria | 77918 |
| 27 | Ga0055531_10000586 | 3300003794 | Bacteria | 31786 |
| 28 | Ga0055531_10008595 | 3300003794 | Bacteria | 5354 |
| 29 | Ga0055543_1000164 | 3300004625 | Bacteria | 55304 |
| 30 | Ga0065165_1000033 | 3300005262 | Bacteria | 215827 |
| 31 | Ga0065716_1001798 | 3300005277 | Bacteria | 3364 |
| 32 | Ga0065704_10090917 | 3300005289 | Bacteria | 2755 |
| 33 | Ga0070683_100041220 | 3300005329 | Bacteria | 4246 |
| 34 | Ga0070683_100079642 | 3300005329 | Bacteria | 3066 |
| 35 | Ga0070690_100019176 | 3300005330 | Bacteria | 4146 |
| 36 | Ga0070670_100002410 | 3300005331 | Bacteria | 15422 |
| 37 | Ga0070670_100017353 | 3300005331 | Bacteria | 6174 |
| 38 | Ga0070670_100093816 | 3300005331 | Bacteria | 2581 |
| 39 | Ga0068869_100003935 | 3300005334 | Bacteria | 9173 |
| 40 | Ga0070680_100040428 | 3300005336 | Bacteria | 3776 |
| 41 | Ga0070682_100000567 | 3300005337 | Bacteria | 22786 |
| 42 | Ga0068868_100024412 | 3300005338 | Bacteria | 4586 |
| 43 | Ga0068868_100043264 | 3300005338 | Bacteria | 3517 |
| 44 | Ga0070689_100014581 | 3300005340 | Bacteria | 5712 |
| 45 | Ga0070689_100041356 | 3300005340 | Bacteria | 3538 |
| 46 | Ga0070669_100021219 | 3300005353 | Bacteria | 4641 |
| 47 | Ga0070671_100006687 | 3300005355 | Bacteria | 9221 |
| 48 | Ga0070671_100020002 | 3300005355 | Bacteria | 5454 |
| 49 | Ga0070674_100028198 | 3300005356 | Bacteria | 3686 |
| 50 | Ga0070674_100095080 | 3300005356 | Bacteria | 2159 |
| 51 | Ga0070673_100050061 | 3300005364 | Bacteria | 3264 |
| 52 | Ga0070688_100011433 | 3300005365 | Bacteria | 4931 |
| 53 | Ga0070659_100102796 | 3300005366 | Bacteria | 2301 |
| 54 | Ga0070667_100056670 | 3300005367 | Bacteria | 3311 |
| 55 | Ga0070667_100115840 | 3300005367 | Bacteria | 2328 |
| 56 | Ga0070667_100144311 | 3300005367 | Bacteria | 2087 |
| 57 | Ga0070714_100007553 | 3300005435 | Bacteria | 8464 |
| 58 | Ga0070714_100019726 | 3300005435 | Bacteria | 5498 |
| 59 | Ga0070714_100133451 | 3300005435 | Bacteria | 2221 |
| 60 | Ga0070713_100014064 | 3300005436 | Bacteria | 5927 |
| 61 | Ga0070713_100034469 | 3300005436 | Bacteria | 4067 |
| 62 | Ga0070711_100059328 | 3300005439 | Bacteria | 2656 |
| 63 | Ga0070700_100005882 | 3300005441 | Bacteria | 6518 |
| 64 | Ga0070700_100059602 | 3300005441 | Bacteria | 2403 |
| 65 | Ga0070708_100000133 | 3300005445 | Bacteria | 50894 |
| 66 | Ga0070663_100000390 | 3300005455 | Bacteria | 23042 |
| 67 | Ga0070678_100019298 | 3300005456 | Bacteria | 4441 |
| 68 | Ga0070678_100035561 | 3300005456 | Bacteria | 3479 |
| 69 | Ga0070681_10004361 | 3300005458 | Bacteria | 13455 |
| 70 | Ga0070681_10004989 | 3300005458 | Bacteria | 12780 |
| 71 | Ga0070681_10069587 | 3300005458 | Bacteria | 3486 |
| 72 | Ga0070681_10077642 | 3300005458 | Bacteria | 3278 |
| 73 | Ga0070681_10080534 | 3300005458 | Bacteria | 3212 |
| 74 | Ga0068867_100062697 | 3300005459 | Bacteria | 2762 |
| 75 | Ga0070685_10007824 | 3300005466 | Bacteria | 5470 |
| 76 | Ga0070698_100001905 | 3300005471 | Bacteria | 23252 |
| 77 | Ga0070698_100016038 | 3300005471 | Bacteria | 7912 |
| 78 | Ga0070698_100125871 | 3300005471 | Bacteria | 2520 |
| 79 | Ga0070679_100001064 | 3300005530 | Bacteria | 23969 |
| 80 | Ga0070679_100004826 | 3300005530 | Bacteria | 12433 |
| 81 | Ga0070679_100029327 | 3300005530 | Bacteria | 5429 |
| 82 | Ga0070679_100033406 | 3300005530 | Bacteria | 5094 |
| 83 | Ga0070684_100045196 | 3300005535 | Bacteria | 3813 |
| 84 | Ga0070697_100009294 | 3300005536 | Bacteria | 7683 |
| 85 | Ga0068853_100004009 | 3300005539 | Bacteria | 11323 |
| 86 | Ga0068853_100042938 | 3300005539 | Bacteria | 3867 |
| 87 | Ga0068853_100060831 | 3300005539 | Bacteria | 3264 |
| 88 | Ga0070672_100015332 | 3300005543 | Bacteria | 5454 |
| 89 | Ga0070672_100017060 | 3300005543 | Bacteria | 5216 |
| 90 | Ga0070672_100017477 | 3300005543 | Bacteria | 5164 |
| 91 | Ga0070695_100005491 | 3300005545 | Bacteria | 7468 |
| 92 | Ga0070696_100017960 | 3300005546 | Bacteria | 4777 |
| 93 | Ga0070665_100002577 | 3300005548 | Bacteria | 19865 |
| 94 | Ga0070665_100013258 | 3300005548 | Bacteria | 8301 |
| 95 | Ga0068855_100025032 | 3300005563 | Bacteria | 7144 |
| 96 | Ga0068855_100045298 | 3300005563 | Bacteria | 5202 |
| 97 | Ga0068855_100113648 | 3300005563 | Bacteria | 3106 |
| 98 | Ga0068855_100146993 | 3300005563 | Bacteria | 2682 |
| 99 | Ga0068857_100029996 | 3300005577 | Bacteria | 4799 |
| 100 | Ga0068856_100022824 | 3300005614 | Bacteria | 6085 |
| 101 | Ga0068856_100030872 | 3300005614 | Bacteria | 5240 |
| 102 | Ga0068856_100034496 | 3300005614 | Bacteria | 4956 |
| 103 | Ga0070702_100007354 | 3300005615 | Bacteria | 5269 |
| 104 | Ga0068859_100031914 | 3300005617 | Bacteria | 5291 |
| 105 | Ga0068859_100049927 | 3300005617 | Bacteria | 4203 |
| 106 | Ga0068859_100066070 | 3300005617 | Bacteria | 3651 |
| 107 | Ga0068864_100004280 | 3300005618 | Bacteria | 11735 |
| 108 | Ga0068864_100013488 | 3300005618 | Bacteria | 6775 |
| 109 | Ga0068864_100013717 | 3300005618 | Bacteria | 6722 |
| 110 | Ga0068864_100025475 | 3300005618 | Bacteria | 4982 |
| 111 | Ga0068864_100040947 | 3300005618 | Bacteria | 3962 |
| 112 | Ga0068866_10042525 | 3300005718 | Bacteria | 2261 |
| 113 | Ga0068861_100073057 | 3300005719 | Bacteria | 2663 |
| 114 | Ga0068863_100008635 | 3300005841 | Bacteria | 9954 |
| 115 | Ga0068858_100022251 | 3300005842 | Bacteria | 5919 |
| 116 | Ga0068858_100036326 | 3300005842 | Bacteria | 4568 |
| 117 | Ga0068858_100081487 | 3300005842 | Bacteria | 3008 |
| 118 | Ga0068860_100028824 | 3300005843 | Bacteria | 5342 |
| 119 | Ga0068860_100030330 | 3300005843 | Bacteria | 5202 |
| 120 | Ga0068862_100048026 | 3300005844 | Bacteria | 3643 |
| 121 | Ga0081455_10018535 | 3300005937 | Bacteria | 6625 |
| 122 | Ga0081455_10061387 | 3300005937 | Bacteria | 3163 |
| 123 | Ga0081540_1000922 | 3300005983 | Bacteria | 26453 |
| 124 | Ga0081540_1001425 | 3300005983 | Bacteria | 20682 |
| 125 | Ga0081540_1003997 | 3300005983 | Bacteria | 11434 |
| 126 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 127 | Ga0081539_10004392 | 3300005985 | Bacteria | 15647 |
| 128 | Ga0081539_10027315 | 3300005985 | Bacteria | 3618 |
| 129 | Ga0070717_10047682 | 3300006028 | Bacteria | 3511 |
| 130 | Ga0070717_10088575 | 3300006028 | Bacteria | 2609 |
| 131 | Ga0075365_10005063 | 3300006038 | Bacteria | 7072 |
| 132 | Ga0075365_10010896 | 3300006038 | Bacteria | 5323 |
| 133 | Ga0075368_10004400 | 3300006042 | Bacteria | 4775 |
| 134 | Ga0075368_10013178 | 3300006042 | Bacteria | 3033 |
| 135 | Ga0075363_100001360 | 3300006048 | Bacteria | 9194 |
| 136 | Ga0075363_100040709 | 3300006048 | Bacteria | 2449 |
| 137 | Ga0075364_10004279 | 3300006051 | Bacteria | 8197 |
| 138 | Ga0075364_10010428 | 3300006051 | Bacteria | 5613 |
| 139 | Ga0075432_10006475 | 3300006058 | Bacteria | 3984 |
| 140 | Ga0070712_100060996 | 3300006175 | Bacteria | 2663 |
| 141 | Ga0075362_10002395 | 3300006177 | Bacteria | 6279 |
| 142 | Ga0075367_10000458 | 3300006178 | Bacteria | 15161 |
| 143 | Ga0075367_10001100 | 3300006178 | Bacteria | 11173 |
| 144 | Ga0075367_10001562 | 3300006178 | Bacteria | 9899 |
| 145 | Ga0075367_10005385 | 3300006178 | Bacteria | 6347 |
| 146 | Ga0075367_10026557 | 3300006178 | Bacteria | 3285 |
| 147 | Ga0075367_10046031 | 3300006178 | Bacteria | 2562 |
| 148 | Ga0075367_10050199 | 3300006178 | Bacteria | 2462 |
| 149 | Ga0075369_10003922 | 3300006186 | Bacteria | 5455 |
| 150 | Ga0075369_10005721 | 3300006186 | Bacteria | 4665 |
| 151 | Ga0075366_10002532 | 3300006195 | Bacteria | 9394 |
| 152 | Ga0075366_10017650 | 3300006195 | Bacteria | 4110 |
| 153 | Ga0075366_10029899 | 3300006195 | Bacteria | 3201 |
| 154 | Ga0097621_100003286 | 3300006237 | Bacteria | 11119 |
| 155 | Ga0097621_100047178 | 3300006237 | Bacteria | 3490 |
| 156 | Ga0075370_10013050 | 3300006353 | Bacteria | 4408 |
| 157 | Ga0075370_10014550 | 3300006353 | Bacteria | 4200 |
| 158 | Ga0075370_10022157 | 3300006353 | Bacteria | 3485 |
| 159 | Ga0075370_10024557 | 3300006353 | Bacteria | 3330 |
| 160 | Ga0075428_100002073 | 3300006844 | Bacteria | 21627 |
| 161 | Ga0075430_100000192 | 3300006846 | Bacteria | 41250 |
| 162 | Ga0075431_100019202 | 3300006847 | Bacteria | 6966 |
| 163 | Ga0075434_100038462 | 3300006871 | Bacteria | 4739 |
| 164 | Ga0075434_100067360 | 3300006871 | Bacteria | 3567 |
| 165 | Ga0075434_100073983 | 3300006871 | Bacteria | 3400 |
| 166 | Ga0075434_100092148 | 3300006871 | Bacteria | 3032 |
| 167 | Ga0075429_100041037 | 3300006880 | Bacteria | 4030 |
| 168 | Ga0068865_100016167 | 3300006881 | Bacteria | 4768 |
| 169 | Ga0068865_100083388 | 3300006881 | Bacteria | 2301 |
| 170 | Ga0075436_100002869 | 3300006914 | Bacteria | 11811 |
| 171 | Ga0075436_100006942 | 3300006914 | Bacteria | 7748 |
| 172 | Ga0075436_100017707 | 3300006914 | Bacteria | 4877 |
| 173 | Ga0097620_100031914 | 3300006931 | Bacteria | 5291 |
| 174 | Ga0097620_100049926 | 3300006931 | Bacteria | 4203 |
| 175 | Ga0097620_100066069 | 3300006931 | Bacteria | 3651 |
| 176 | Ga0099823_1022458 | 3300006944 | Bacteria | 5837 |
| 177 | Ga0099795_10004985 | 3300007788 | Bacteria | 3485 |
| 178 | Ga0105240_10011902 | 3300009093 | Bacteria | 12070 |
| 179 | Ga0111539_10011469 | 3300009094 | Bacteria | 11123 |
| 180 | Ga0111539_10021244 | 3300009094 | Bacteria | 7992 |
| 181 | Ga0111539_10097380 | 3300009094 | Bacteria | 3456 |
| 182 | Ga0105245_10128425 | 3300009098 | Bacteria | 2375 |
| 183 | Ga0105247_10010927 | 3300009101 | Bacteria | 5484 |
| 184 | Ga0114129_10010074 | 3300009147 | Bacteria | 13473 |
| 185 | Ga0114129_10035342 | 3300009147 | Bacteria | 7059 |
| 186 | Ga0114129_10035914 | 3300009147 | Bacteria | 6998 |
| 187 | Ga0105243_10014028 | 3300009148 | Bacteria | 6065 |
| 188 | Ga0105243_10018411 | 3300009148 | Bacteria | 5290 |
| 189 | Ga0105242_10001652 | 3300009176 | Bacteria | 17627 |
| 190 | Ga0105242_10035792 | 3300009176 | Bacteria | 3981 |
| 191 | Ga0105248_10003122 | 3300009177 | Bacteria | 18333 |
| 192 | Ga0105248_10060607 | 3300009177 | Bacteria | 4248 |
| 193 | Ga0105237_10004886 | 3300009545 | Bacteria | 15354 |
| 194 | Ga0105238_10005134 | 3300009551 | Bacteria | 12941 |
| 195 | Ga0105238_10007610 | 3300009551 | Bacteria | 10852 |
| 196 | Ga0105249_10022878 | 3300009553 | Bacteria | 5602 |
| 197 | Ga0123342_1003939 | 3300009766 | Bacteria | 23272 |
| 198 | Ga0105239_10008583 | 3300010375 | Bacteria | 11589 |
| 199 | Ga0105239_10016888 | 3300010375 | Bacteria | 8066 |
| 200 | Ga0157373_10015870 | 3300013100 | Bacteria | 5499 |
| 201 | Ga0157370_10008445 | 3300013104 | Bacteria | 11109 |
| 202 | Ga0157370_10147726 | 3300013104 | Bacteria | 2188 |
| 203 | Ga0157369_10002895 | 3300013105 | Bacteria | 20503 |
| 204 | Ga0157369_10008444 | 3300013105 | Bacteria | 11815 |
| 205 | Ga0157369_10065123 | 3300013105 | Bacteria | 3924 |
| 206 | Ga0157374_10016908 | 3300013296 | Bacteria | 6420 |
| 207 | Ga0157374_10033492 | 3300013296 | Bacteria | 4687 |
| 208 | Ga0157378_10056200 | 3300013297 | Bacteria | 3507 |
| 209 | Ga0157372_10031877 | 3300013307 | Bacteria | 5776 |
| 210 | Ga0157372_10060311 | 3300013307 | Bacteria | 4245 |
| 211 | Ga0157375_10037213 | 3300013308 | Bacteria | 4660 |
| 212 | Ga0157375_10061079 | 3300013308 | Bacteria | 3740 |
| 213 | Ga0157375_10116382 | 3300013308 | Bacteria | 2777 |
| 214 | Ga0163163_10090922 | 3300014325 | Bacteria | 3066 |
| 215 | Ga0157380_10010872 | 3300014326 | Bacteria | 6563 |
| 216 | Ga0157380_10035779 | 3300014326 | Bacteria | 3837 |
| 217 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 218 | Ga0163161_10002473 | 3300017792 | Bacteria | 13182 |
| 219 | Ga0228711_1002116 | 3300022739 | Bacteria | 30198 |
| 220 | Ga0228710_1011349 | 3300022740 | Bacteria | 11539 |
| 221 | Ga0209436_103264 | 3300025208 | Bacteria | 4385 |
| 222 | Ga0209673_1001841 | 3300025273 | Bacteria | 17324 |
| 223 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 224 | Ga0209130_1000591 | 3300025284 | Bacteria | 35327 |
| 225 | Ga0209676_1000873 | 3300025292 | Bacteria | 38608 |
| 226 | Ga0209676_1000876 | 3300025292 | Bacteria | 38530 |
| 227 | Ga0209025_1000161 | 3300025294 | Bacteria | 166506 |
| 228 | Ga0209025_1000265 | 3300025294 | Bacteria | 123182 |
| 229 | Ga0209025_1014259 | 3300025294 | Bacteria | 4909 |
| 230 | Ga0209025_1016031 | 3300025294 | Bacteria | 4461 |
| 231 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 232 | Ga0209564_1001504 | 3300025295 | Bacteria | 23379 |
| 233 | Ga0209564_1002751 | 3300025295 | Bacteria | 13218 |
| 234 | Ga0209758_1000628 | 3300025297 | Bacteria | 54130 |
| 235 | Ga0209758_1002358 | 3300025297 | Bacteria | 19467 |
| 236 | Ga0209758_1006011 | 3300025297 | Bacteria | 8968 |
| 237 | Ga0209758_1011107 | 3300025297 | Bacteria | 5265 |
| 238 | Ga0209050_1000759 | 3300025298 | Bacteria | 46447 |
| 239 | Ga0209050_1002190 | 3300025298 | Bacteria | 17613 |
| 240 | Ga0209256_1002058 | 3300025299 | Bacteria | 17780 |
| 241 | Ga0209256_1004740 | 3300025299 | Bacteria | 8313 |
| 242 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 243 | Ga0207426_1000287 | 3300025302 | Bacteria | 100566 |
| 244 | Ga0209051_1000315 | 3300025303 | Bacteria | 73579 |
| 245 | Ga0209051_1000773 | 3300025303 | Bacteria | 33955 |
| 246 | Ga0209051_1003896 | 3300025303 | Bacteria | 9525 |
| 247 | Ga0209051_1006359 | 3300025303 | Bacteria | 6683 |
| 248 | Ga0209051_1007350 | 3300025303 | Bacteria | 6041 |
| 249 | Ga0209257_1000061 | 3300025304 | Bacteria | 367698 |
| 250 | Ga0209257_1000309 | 3300025304 | Bacteria | 104166 |
| 251 | Ga0209257_1006709 | 3300025304 | Bacteria | 7278 |
| 252 | Ga0207692_10045290 | 3300025898 | Bacteria | 2200 |
| 253 | Ga0207688_10042184 | 3300025901 | Bacteria | 2540 |
| 254 | Ga0207647_10015046 | 3300025904 | Bacteria | 5318 |
| 255 | Ga0207647_10057132 | 3300025904 | Bacteria | 2393 |
| 256 | Ga0207645_10017396 | 3300025907 | Bacteria | 4746 |
| 257 | Ga0207645_10025420 | 3300025907 | Bacteria | 3831 |
| 258 | Ga0207643_10030254 | 3300025908 | Bacteria | 3012 |
| 259 | Ga0207643_10036424 | 3300025908 | Bacteria | 2759 |
| 260 | Ga0207684_10038233 | 3300025910 | Bacteria | 4072 |
| 261 | Ga0207684_10042982 | 3300025910 | Bacteria | 3831 |
| 262 | Ga0207707_10002780 | 3300025912 | Bacteria | 15612 |
| 263 | Ga0207707_10016874 | 3300025912 | Bacteria | 6360 |
| 264 | Ga0207695_10004829 | 3300025913 | Bacteria | 18197 |
| 265 | Ga0207671_10012628 | 3300025914 | Bacteria | 6784 |
| 266 | Ga0207671_10036566 | 3300025914 | Bacteria | 3642 |
| 267 | Ga0207693_10037698 | 3300025915 | Bacteria | 3810 |
| 268 | Ga0207663_10020266 | 3300025916 | Bacteria | 3763 |
| 269 | Ga0207663_10090076 | 3300025916 | Bacteria | 2033 |
| 270 | Ga0207662_10015709 | 3300025918 | Bacteria | 4263 |
| 271 | Ga0207652_10012067 | 3300025921 | Bacteria | 6975 |
| 272 | Ga0207652_10016979 | 3300025921 | Bacteria | 5954 |
| 273 | Ga0207652_10050807 | 3300025921 | Bacteria | 3553 |
| 274 | Ga0207646_10043993 | 3300025922 | Bacteria | 4008 |
| 275 | Ga0207681_10021524 | 3300025923 | Bacteria | 4100 |
| 276 | Ga0207681_10060735 | 3300025923 | Bacteria | 2596 |
| 277 | Ga0207694_10082520 | 3300025924 | Bacteria | 2527 |
| 278 | Ga0207687_10087839 | 3300025927 | Bacteria | 2260 |
| 279 | Ga0207700_10024746 | 3300025928 | Bacteria | 4160 |
| 280 | Ga0207644_10006370 | 3300025931 | Bacteria | 7687 |
| 281 | Ga0207644_10014326 | 3300025931 | Bacteria | 5305 |
| 282 | Ga0207690_10052614 | 3300025932 | Bacteria | 2728 |
| 283 | Ga0207706_10028017 | 3300025933 | Bacteria | 5033 |
| 284 | Ga0207706_10033719 | 3300025933 | Bacteria | 4555 |
| 285 | Ga0207709_10000497 | 3300025935 | Bacteria | 35233 |
| 286 | Ga0207670_10038227 | 3300025936 | Bacteria | 3134 |
| 287 | Ga0207669_10025556 | 3300025937 | Bacteria | 3194 |
| 288 | Ga0207704_10038696 | 3300025938 | Bacteria | 2769 |
| 289 | Ga0207665_10050882 | 3300025939 | Bacteria | 2787 |
| 290 | Ga0207691_10001616 | 3300025940 | Bacteria | 22379 |
| 291 | Ga0207691_10007860 | 3300025940 | Bacteria | 10272 |
| 292 | Ga0207691_10020845 | 3300025940 | Bacteria | 6194 |
| 293 | Ga0207691_10025838 | 3300025940 | Bacteria | 5511 |
| 294 | Ga0207711_10041464 | 3300025941 | Bacteria | 3920 |
| 295 | Ga0207667_10012495 | 3300025949 | Bacteria | 9776 |
| 296 | Ga0207639_10013959 | 3300026041 | Bacteria | 5637 |
| 297 | Ga0207639_10062849 | 3300026041 | Bacteria | 2873 |
| 298 | Ga0207678_10003222 | 3300026067 | Bacteria | 14749 |
| 299 | Ga0207678_10062852 | 3300026067 | Bacteria | 3191 |
| 300 | Ga0207708_10004713 | 3300026075 | Bacteria | 10029 |
| 301 | Ga0207708_10020468 | 3300026075 | Bacteria | 4989 |
| 302 | Ga0207641_10028618 | 3300026088 | Bacteria | 4605 |
| 303 | Ga0207648_10011919 | 3300026089 | Bacteria | 8164 |
| 304 | Ga0207648_10029742 | 3300026089 | Bacteria | 4844 |
| 305 | Ga0207648_10049421 | 3300026089 | Bacteria | 3680 |
| 306 | Ga0207648_10085947 | 3300026089 | Bacteria | 2744 |
| 307 | Ga0207676_10004233 | 3300026095 | Bacteria | 10135 |
| 308 | Ga0207676_10039058 | 3300026095 | Bacteria | 3628 |
| 309 | Ga0207674_10025674 | 3300026116 | Bacteria | 6274 |
| 310 | Ga0207674_10060152 | 3300026116 | Bacteria | 3843 |
| 311 | Ga0207674_10073574 | 3300026116 | Bacteria | 3430 |
| 312 | Ga0207675_100016991 | 3300026118 | Bacteria | 6798 |
| 313 | Ga0207675_100060081 | 3300026118 | Bacteria | 3548 |
| 314 | Ga0207683_10036564 | 3300026121 | Bacteria | 4277 |
| 315 | Ga0207698_10075114 | 3300026142 | Bacteria | 2699 |
| 316 | Ga0207698_10086126 | 3300026142 | Bacteria | 2554 |
| 317 | Ga0209281_1000106 | 3300027111 | Bacteria | 219666 |
| 318 | Ga0209389_1000062 | 3300027296 | Bacteria | 102842 |
| 319 | Ga0209489_100160 | 3300027361 | Bacteria | 102842 |
| 320 | Ga0209700_102603 | 3300027363 | Bacteria | 36098 |
| 321 | Ga0209282_1000083 | 3300027666 | Bacteria | 70247 |
| 322 | Ga0209966_1004075 | 3300027695 | Bacteria | 2469 |
| 323 | Ga0209998_10002323 | 3300027717 | Bacteria | 4395 |
| 324 | Ga0209813_10000917 | 3300027866 | Bacteria | 6637 |
| 325 | Ga0207428_10002133 | 3300027907 | Bacteria | 19893 |
| 326 | Ga0207428_10022909 | 3300027907 | Bacteria | 5262 |
| 327 | Ga0268266_10000680 | 3300028379 | Bacteria | 45937 |
| 328 | Ga0268266_10001248 | 3300028379 | Bacteria | 31070 |
| 329 | Ga0268266_10010351 | 3300028379 | Bacteria | 8158 |
| 330 | Ga0268264_10027442 | 3300028381 | Bacteria | 4652 |
| 331 | Ga0268264_10032869 | 3300028381 | Bacteria | 4258 |
| 332 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 333 | Ga0307515_10000037 | 3300028794 | Bacteria | 331970 |
| 334 | Ga0307515_10008845 | 3300028794 | Bacteria | 19552 |
| 335 | Ga0307515_10014764 | 3300028794 | Bacteria | 14449 |
| 336 | Ga0307511_10000948 | 3300030521 | Bacteria | 30775 |
| 337 | Ga0307512_10038502 | 3300030522 | Bacteria | 4021 |
| 338 | Ga0265325_10002896 | 3300031241 | Bacteria | 11436 |
| 339 | Ga0307513_10000034 | 3300031456 | Bacteria | 185012 |
| 340 | Ga0307513_10012252 | 3300031456 | Bacteria | 10601 |
| 341 | Ga0307513_10015642 | 3300031456 | Bacteria | 9184 |
| 342 | Ga0307509_10022123 | 3300031507 | Bacteria | 7177 |
| 343 | Ga0307408_100000012 | 3300031548 | Bacteria | 408153 |
| 344 | Ga0307516_10000348 | 3300031730 | Bacteria | 60054 |
| 345 | Ga0307516_10005411 | 3300031730 | Bacteria | 15306 |
| 346 | Ga0307516_10008644 | 3300031730 | Bacteria | 11485 |
| 347 | Ga0307516_10061229 | 3300031730 | Bacteria | 3653 |
| 348 | Ga0307406_10023282 | 3300031901 | Bacteria | 3683 |
| 349 | Ga0315914_1002550 | 3300031967 | Bacteria | 27863 |
| 350 | Ga0307510_10025874 | 3300033180 | Bacteria | 6760 |
| 351 | Ga0315913_1001274 | 3300033430 | Bacteria | 27225 |
| 352 | Ga0315911_1000017 | 3300033442 | Bacteria | 161609 |
| 353 | Ga0315915_1000010 | 3300033464 | Bacteria | 240214 |
| 354 | Ga0373930_0000038 | 3300034816 | Bacteria | 11756 |
| 355 | Ga0373930_0001662 | 3300034816 | Bacteria | 3364 |
| 356 | Ga0373948_0000018 | 3300034817 | Bacteria | 21496 |
| 357 | Ga0373958_0000988 | 3300034819 | Bacteria | 3708 |
| 358 | Ga0373958_0001557 | 3300034819 | Bacteria | 3102 |
| 359 | Ga0373938_0000127 | 3300034957 | Bacteria | 10712 |
| 360 | Ga0373928_0000406 | 3300035084 | Bacteria | 8570 |
| 361 | Ga0373929_0000817 | 3300035085 | Bacteria | 6064 |
| 362 | Ga0373934_0001121 | 3300035086 | Bacteria | 9730 |
| 363 | Ga0373949_0004740 | 3300035090 | Bacteria | 3085 |
| 364 | Ga0373951_0000716 | 3300035091 | Bacteria | 9106 |
| 365 | Ga0373952_0000990 | 3300035092 | Bacteria | 5180 |
| 366 | Ga0373952_0010616 | 3300035092 | Bacteria | 1783 |
| 367 | Ga0373923_0009454 | 3300035111 | Bacteria | 3518 |
| 368 | Ga0373932_0001709 | 3300035112 | Bacteria | 5971 |
| 369 | Ga0373936_0038125 | 3300035113 | Bacteria | 1921 |
| 370 | Ga0373941_0000068 | 3300035115 | Bacteria | 16268 |
| 371 | Ga0373945_0018842 | 3300035116 | Bacteria | 2351 |
| 372 | Ga0373954_0000001 | 3300035118 | Bacteria | 158201 |
| 373 | Ga0373954_0026273 | 3300035118 | Bacteria | 2668 |
| 374 | Ga0373956_0000103 | 3300035119 | Bacteria | 29146 |
| 375 | Ga0373942_0008604 | 3300035207 | Bacteria | 2381 |
| 376 | Ga0373961_0002126 | 3300035241 | Bacteria | 5252 |
| 377 | Ga0373931_0000387 | 3300035691 | Bacteria | 18089 |
| 378 | Ga0373931_0005344 | 3300035691 | Bacteria | 5928 |
| 379 | Ga0373931_0005744 | 3300035691 | Bacteria | 5763 |
| 380 | Ga0373933_0000811 | 3300035724 | Bacteria | 19056 |
| 381 | Ga0373937_0000769 | 3300036401 | Bacteria | 27707 |
| 382 | Ga0373937_0005181 | 3300036401 | Bacteria | 11122 |
| 383 | Ga0373937_0018405 | 3300036401 | Bacteria | 6239 |
| 384 | Ga0373937_0103756 | 3300036401 | Bacteria | 2641 |
| 385 | Ga0395899_0007150 | 3300037312 | Bacteria | 8637 |
| 386 | Ga0395899_0012066 | 3300037312 | Bacteria | 6619 |
| 387 | Ga0395899_0071757 | 3300037312 | Bacteria | 2534 |
| 388 | Ga0395900_0049257 | 3300037418 | Bacteria | 4340 |
| 389 | Ga0395900_0067255 | 3300037418 | Bacteria | 3681 |
| 390 | Ga0395898_0008307 | 3300037466 | Bacteria | 10976 |
| 391 | Ga0395898_0018064 | 3300037466 | Bacteria | 7194 |
| 392 | Ga0395898_0098670 | 3300037466 | Bacteria | 2805 |
| 393 | Ga0395905_0011762 | 3300037471 | Bacteria | 8448 |
| 394 | Ga0395901_0001587 | 3300038443 | Bacteria | 23512 |
| 395 | Ga0395901_0004166 | 3300038443 | Bacteria | 14593 |
| 396 | Ga0395901_0051140 | 3300038443 | Bacteria | 4294 |
| 397 | Ga0395901_0131342 | 3300038443 | Bacteria | 2631 |
| 398 | Ga0451577_0092380 | 3300042876 | Bacteria | 2702 |
| 399 | Ga0453683_0020949 | 3300044673 | Bacteria | 4175 |
| 400 | Ga0453684_0040132 | 3300044712 | Bacteria | 6365 |
| 401 | Ga0451576_0005540 | 3300045051 | Bacteria | 15773 |
| 402 | Ga0495617_016482 | 3300046452 | Bacteria | 2499 |
| 403 | Ga0495638_0024553 | 3300046460 | Bacteria | 3928 |
| 404 | Ga0495651_0006045 | 3300046462 | Bacteria | 9240 |
| 405 | Ga0495582_0028029 | 3300046473 | Bacteria | 3089 |
| 406 | Ga0495584_0006643 | 3300046491 | Bacteria | 6047 |
| 407 | Ga0495606_0006516 | 3300046507 | Bacteria | 10744 |
| 408 | Ga0495608_0009334 | 3300046511 | Bacteria | 6860 |
| 409 | Ga0495616_0019335 | 3300046513 | Bacteria | 3718 |
| 410 | Ga0495628_0078737 | 3300046516 | Bacteria | 2563 |
| 411 | Ga0495632_0031101 | 3300046519 | Bacteria | 2764 |
| 412 | Ga0495645_0021487 | 3300046543 | Bacteria | 4662 |
| 413 | Ga0495667_0009010 | 3300046559 | Bacteria | 6780 |
| 414 | Ga0495656_0000081 | 3300046615 | Bacteria | 42254 |
| 415 | Ga0495625_0008887 | 3300046660 | Bacteria | 8498 |
| 416 | Ga0495661_0072885 | 3300046665 | Bacteria | 2002 |
| 417 | Ga0495588_0003613 | 3300046674 | Bacteria | 6761 |
| 418 | Ga0495599_0014731 | 3300046678 | Bacteria | 4842 |
| 419 | Ga0495623_0023795 | 3300046679 | Bacteria | 3952 |
| 420 | Ga0495658_0027228 | 3300046683 | Bacteria | 3073 |
| 421 | Ga0495670_0006538 | 3300046691 | Bacteria | 5728 |
| 422 | Ga0495671_0009334 | 3300046692 | Bacteria | 5480 |
| 423 | Ga0495687_000606 | 3300047443 | Bacteria | 41890 |
| 424 | Ga0495593_0048226 | 3300047673 | Bacteria | 2264 |
| 425 | Ga0496100_0013789 | 3300048903 | Bacteria | 4675 |
| 426 | Ga0496101_0020557 | 3300048904 | Bacteria | 4521 |
| 427 | Ga0496102_0001355 | 3300048905 | Bacteria | 21922 |
| 428 | Ga0496102_0002271 | 3300048905 | Bacteria | 16435 |
| 429 | Ga0496103_0017655 | 3300048906 | Bacteria | 4271 |
| 430 | Ga0496104_0000175 | 3300048907 | Bacteria | 56916 |
| 431 | Ga0496104_0012436 | 3300048907 | Bacteria | 7653 |
| 432 | Ga0496104_0015322 | 3300048907 | Bacteria | 6942 |
| 433 | Ga0496104_0047774 | 3300048907 | Bacteria | 4034 |
| 434 | Ga0496105_0002850 | 3300048908 | Bacteria | 12652 |
| 435 | Ga0496105_0003826 | 3300048908 | Bacteria | 11229 |
| 436 | Ga0496105_0009918 | 3300048908 | Bacteria | 7470 |
| 437 | Ga0496106_0005133 | 3300048909 | Bacteria | 9702 |
| 438 | Ga0496106_0012771 | 3300048909 | Bacteria | 6201 |
| 439 | Ga0496106_0110020 | 3300048909 | Bacteria | 2144 |
| 440 | Ga0496108_0001839 | 3300048911 | Bacteria | 16957 |
| 441 | Ga0496108_0003952 | 3300048911 | Bacteria | 11907 |
| 442 | Ga0496109_0002227 | 3300048912 | Bacteria | 16096 |
| 443 | Ga0496109_0004749 | 3300048912 | Bacteria | 11355 |
| 444 | Ga0496109_0007062 | 3300048912 | Bacteria | 9475 |
| 445 | Ga0496109_0033573 | 3300048912 | Bacteria | 4617 |
| 446 | Ga0496110_0007879 | 3300048913 | Bacteria | 8532 |
| 447 | Ga0496110_0015136 | 3300048913 | Bacteria | 6413 |
| 448 | Ga0496110_0036657 | 3300048913 | Bacteria | 4260 |
| 449 | Ga0496110_0083061 | 3300048913 | Bacteria | 2857 |
| 450 | Ga0496111_0000718 | 3300048914 | Bacteria | 17646 |
| 451 | Ga0496111_0001439 | 3300048914 | Bacteria | 13586 |
| 452 | Ga0496112_0003174 | 3300048915 | Bacteria | 13504 |
| 453 | Ga0496112_0031932 | 3300048915 | Bacteria | 5110 |
| 454 | Ga0496112_0057848 | 3300048915 | Bacteria | 3818 |
| 455 | Ga0496112_0109029 | 3300048915 | Bacteria | 2739 |
| 456 | Ga0496112_0132541 | 3300048915 | Bacteria | 2463 |
| 457 | Ga0496113_0000771 | 3300048916 | Bacteria | 16510 |
| 458 | Ga0496113_0003775 | 3300048916 | Bacteria | 9147 |
| 459 | Ga0496113_0010705 | 3300048916 | Bacteria | 6076 |
| 460 | Ga0496113_0099867 | 3300048916 | Bacteria | 2248 |
| 461 | Ga0496114_0011776 | 3300048917 | Bacteria | 6998 |
| 462 | Ga0496115_0011186 | 3300048918 | Bacteria | 6721 |
| 463 | Ga0496115_0166726 | 3300048918 | Bacteria | 1821 |
| 464 | Ga0496116_0001272 | 3300048919 | Bacteria | 29014 |
| 465 | Ga0496117_0013319 | 3300048920 | Bacteria | 7185 |
| 466 | Ga0496118_0035700 | 3300048921 | Bacteria | 4032 |
| 467 | Ga0496121_0000214 | 3300048924 | Bacteria | 127349 |
| 468 | Ga0496121_0000694 | 3300048924 | Bacteria | 62818 |
| 469 | Ga0496121_0012225 | 3300048924 | Bacteria | 9404 |
| 470 | Ga0496121_0013875 | 3300048924 | Bacteria | 8618 |
| 471 | Ga0496123_0016827 | 3300048926 | Bacteria | 5911 |
| 472 | Ga0496123_0048415 | 3300048926 | Bacteria | 2860 |
| 473 | Ga0496124_0040798 | 3300048927 | Bacteria | 4011 |
| 474 | Ga0496124_0045825 | 3300048927 | Bacteria | 3748 |
| 475 | Ga0496125_0001342 | 3300048928 | Bacteria | 36252 |
| 476 | Ga0496125_0011403 | 3300048928 | Bacteria | 8892 |
| 477 | Ga0496125_0064200 | 3300048928 | Bacteria | 2920 |
| 478 | Ga0496126_0007271 | 3300048929 | Bacteria | 12173 |
| 479 | Ga0496126_0018999 | 3300048929 | Bacteria | 6787 |
| 480 | Ga0496126_0107306 | 3300048929 | Bacteria | 2435 |
| 481 | Ga0501034_0017969 | 3300049571 | Bacteria | 7254 |
| 482 | Ga0501034_0021593 | 3300049571 | Bacteria | 6558 |
| 483 | Ga0501036_0022350 | 3300049572 | Bacteria | 5319 |
| 484 | Ga0501036_0055465 | 3300049572 | Bacteria | 3357 |
| 485 | Ga0501038_0019980 | 3300049574 | Bacteria | 6030 |
| 486 | Ga0501043_0089856 | 3300049579 | Bacteria | 2414 |
| 487 | Ga0501046_0005718 | 3300049580 | Bacteria | 11095 |
| 488 | Ga0501047_0021515 | 3300049581 | Bacteria | 6194 |
| 489 | Ga0501069_0003111 | 3300049585 | Bacteria | 8504 |
| 490 | Ga0501070_0069791 | 3300049586 | Bacteria | 2909 |
| 491 | Ga0501073_0023082 | 3300049589 | Bacteria | 4472 |
| 492 | Ga0501083_0013082 | 3300049744 | Bacteria | 5797 |
| 493 | Ga0501035_0031856 | 3300049822 | Bacteria | 4801 |
| 494 | Ga0501044_0000255 | 3300049823 | Bacteria | 67530 |
| 495 | Ga0501044_0069528 | 3300049823 | Bacteria | 3584 |
| 496 | Ga0501044_0115365 | 3300049823 | Bacteria | 2691 |
| 497 | nmdc:mga03683_994_c1 | 3300050489 | Bacteria | 8286 |
| 498 | nmdc:mga03n38_17384_c1 | 3300050490 | Bacteria | 2816 |
| 499 | nmdc:mga03n38_7023_c1 | 3300050490 | Bacteria | 3958 |
| 500 | nmdc:mga00v17_14927_c1 | 3300050491 | Bacteria | 4349 |
| 501 | nmdc:mga0yw44_1051_c1 | 3300050492 | Bacteria | 10615 |
| 502 | nmdc:mga0yw44_22282_c2 | 3300050492 | Bacteria | 2110 |
| 503 | nmdc:mga0yw44_49384_c1 | 3300050492 | Bacteria | 2539 |
| 504 | nmdc:mga0k408_19023_c1 | 3300050493 | Bacteria | 3835 |
| 505 | nmdc:mga06z11_1676_c1 | 3300050494 | Bacteria | 8308 |
| 506 | nmdc:mga06z11_26802_c1 | 3300050494 | Bacteria | 2748 |
| 507 | nmdc:mga06z11_4933_c1 | 3300050494 | Bacteria | 5296 |
| 508 | nmdc:mga04h51_1465_c1 | 3300050495 | Bacteria | 5465 |
| 509 | nmdc:mga04h51_971_c1 | 3300050495 | Bacteria | 6630 |
| 510 | nmdc:mga07m45_13544_c1 | 3300050496 | Bacteria | 4331 |
| 511 | nmdc:mga07m45_995_c1 | 3300050496 | Bacteria | 12514 |
| 512 | nmdc:mga05p37_220131_c1 | 3300050507 | Bacteria | 2291 |
| 513 | nmdc:mga05p37_4947_c1 | 3300050507 | Bacteria | 15612 |
| 514 | nmdc:mga09592_138974_c1 | 3300050508 | Bacteria | 2093 |
| 515 | nmdc:mga09592_15617_c1 | 3300050508 | Bacteria | 6203 |
| 516 | nmdc:mga0qj67_52_c1 | 3300050509 | Bacteria | 84067 |
| 517 | nmdc:mga06r32_13686_c2 | 3300050510 | Bacteria | 2282 |
| 518 | nmdc:mga06r32_27161_c1 | 3300050510 | Bacteria | 5344 |
| 519 | nmdc:mga08y16_122515_c1 | 3300050511 | Bacteria | 2706 |
| 520 | nmdc:mga08y16_125842_c1 | 3300050511 | Bacteria | 2666 |
| 521 | nmdc:mga08y16_9940_c1 | 3300050511 | Bacteria | 9985 |
| 522 | nmdc:mga0n895_34877_c1 | 3300050512 | Bacteria | 4846 |
| 523 | nmdc:mga0a205_48710_c1 | 3300050515 | Bacteria | 4090 |
| 524 | Ga0500643_013577 | 3300053087 | Bacteria | 2871 |
| 525 | Ga0500651_0030124 | 3300053093 | Bacteria | 3413 |
| 526 | Ga0500651_0084312 | 3300053093 | Bacteria | 1965 |
| 527 | Ga0500566_0000135 | 3300053094 | Bacteria | 37782 |
| 528 | Ga0500641_0002341 | 3300053096 | Bacteria | 6709 |
| 529 | Ga0500556_0000030 | 3300053104 | Bacteria | 165098 |
| 530 | Ga0500569_008121 | 3300053109 | Bacteria | 2389 |
| 531 | Ga0500593_000043 | 3300053117 | Bacteria | 45165 |
| 532 | Ga0500593_001328 | 3300053117 | Bacteria | 8915 |
| 533 | Ga0500595_000055 | 3300053119 | Bacteria | 84205 |
| 534 | Ga0500595_007441 | 3300053119 | Bacteria | 4544 |
| 535 | Ga0500595_019836 | 3300053119 | Bacteria | 2432 |
| 536 | Ga0500642_0000028 | 3300053130 | Bacteria | 117281 |
| 537 | Ga0500652_000106 | 3300053131 | Bacteria | 32646 |
| 538 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 539 | Ga0500616_0000252 | 3300053153 | Bacteria | 83060 |
| 540 | Ga0500616_0001978 | 3300053153 | Bacteria | 18207 |
| 541 | Ga0500616_0002887 | 3300053153 | Bacteria | 13778 |
| 542 | Ga0500619_000027 | 3300053154 | Bacteria | 48298 |
| 543 | Ga0500622_0000810 | 3300053156 | Bacteria | 26795 |
| 544 | Ga0500634_0004846 | 3300053161 | Bacteria | 6300 |
| 545 | Ga0500636_0000525 | 3300053177 | Bacteria | 20813 |
| 546 | Ga0500645_000458 | 3300053730 | Bacteria | 27970 |
| 547 | Ga0500645_008943 | 3300053730 | Bacteria | 3387 |
| 548 | Ga0530510_0019591 | 3300061734 | Bacteria | 4803 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046678 | Ga0495599_0014731 | Ga0495599_0014731_3132_4832 | 458 |
| 2 | 3300035092 | Ga0373952_0010616 | Ga0373952_0010616_21_1499 | 463 |
| 3 | 3300025294 | Ga0209025_1016031 | Ga0209025_10160315 | 470 |
| 4 | 3300003790 | Ga0055528_1001600 | Ga0055528_100160014 | 471 |
| 5 | 3300025273 | Ga0209673_1001841 | Ga0209673_100184112 | 471 |
| 6 | 3300025295 | Ga0209564_1002751 | Ga0209564_100275113 | 471 |
| 7 | 3300025299 | Ga0209256_1004740 | Ga0209256_10047406 | 471 |
| 8 | 3300048916 | Ga0496113_0099867 | Ga0496113_0099867_711_2228 | 471 |
| 9 | 3300013308 | Ga0157375_10116382 | Ga0157375_101163822 | 477 |
| 10 | 3300034817 | Ga0373948_0000018 | Ga0373948_0000018_19947_21461 | 477 |
| 11 | 3300034957 | Ga0373938_0000127 | Ga0373938_0000127_9157_10671 | 477 |
| 12 | 3300035207 | Ga0373942_0008604 | Ga0373942_0008604_12_1526 | 477 |
| 13 | 3300048924 | Ga0496121_0013875 | Ga0496121_0013875_1717_3600 | 485 |
| 14 | 3300053087 | Ga0500643_013577 | Ga0500643_013577_12_1784 | 487 |
| 15 | 3300027907 | Ga0207428_10022909 | Ga0207428_100229093 | 488 |
| 16 | 3300005471 | Ga0070698_100016038 | Ga0070698_1000160382 | 489 |
| 17 | 3300005530 | Ga0070679_100033406 | Ga0070679_1000334063 | 489 |
| 18 | 3300006028 | Ga0070717_10047682 | Ga0070717_100476822 | 489 |
| 19 | 3300025912 | Ga0207707_10016874 | Ga0207707_100168744 | 489 |
| 20 | 3300050492 | nmdc:mga0yw44_49384_c1 | nmdc:mga0yw44_49384_c1_19_1578 | 490 |
| 21 | 3300005458 | Ga0070681_10077642 | Ga0070681_100776422 | 491 |
| 22 | 3300035084 | Ga0373928_0000406 | Ga0373928_0000406_18_1574 | 491 |
| 23 | 3300050511 | nmdc:mga08y16_122515_c1 | nmdc:mga08y16_122515_c1_1140_2696 | 491 |
| 24 | 3300046473 | Ga0495582_0028029 | Ga0495582_0028029_1451_3037 | 499 |
| 25 | 3300048929 | Ga0496126_0018999 | Ga0496126_0018999_2422_4299 | 499 |
| 26 | 3300053156 | Ga0500622_0000810 | Ga0500622_0000810_23210_25039 | 505 |
| 27 | 3300005441 | Ga0070700_100005882 | Ga0070700_1000058826 | 506 |
| 28 | 3300006881 | Ga0068865_100016167 | Ga0068865_1000161674 | 506 |
| 29 | 3300009094 | Ga0111539_10021244 | Ga0111539_100212444 | 506 |
| 30 | 3300009148 | Ga0105243_10018411 | Ga0105243_100184111 | 506 |
| 31 | 3300009553 | Ga0105249_10022878 | Ga0105249_100228785 | 506 |
| 32 | 3300025908 | Ga0207643_10030254 | Ga0207643_100302542 | 506 |
| 33 | 3300026075 | Ga0207708_10004713 | Ga0207708_100047136 | 506 |
| 34 | 3300026118 | Ga0207675_100016991 | Ga0207675_1000169916 | 506 |
| 35 | 3300048924 | Ga0496121_0000694 | Ga0496121_0000694_56554_58422 | 510 |
| 36 | 3300048929 | Ga0496126_0007271 | Ga0496126_0007271_2681_4549 | 510 |
| 37 | 3300048920 | Ga0496117_0013319 | Ga0496117_0013319_4145_6007 | 511 |
| 38 | 3300048919 | Ga0496116_0001272 | Ga0496116_0001272_10013_11875 | 512 |
| 39 | 3300048926 | Ga0496123_0048415 | Ga0496123_0048415_177_2033 | 514 |
| 40 | 3300048928 | Ga0496125_0001342 | Ga0496125_0001342_11687_13543 | 514 |
| 41 | 3300046460 | Ga0495638_0024553 | Ga0495638_0024553_202_2058 | 515 |
| 42 | 3300046665 | Ga0495661_0072885 | Ga0495661_0072885_11_1867 | 515 |
| 43 | 3300048926 | Ga0496123_0016827 | Ga0496123_0016827_2470_4326 | 515 |
| 44 | 3300053093 | Ga0500651_0030124 | Ga0500651_0030124_604_2460 | 515 |
| 45 | 3300005530 | Ga0070679_100029327 | Ga0070679_1000293273 | 517 |
| 46 | 3300005539 | Ga0068853_100004009 | Ga0068853_1000040094 | 517 |
| 47 | 3300005545 | Ga0070695_100005491 | Ga0070695_1000054913 | 517 |
| 48 | 3300005563 | Ga0068855_100146993 | Ga0068855_1001469932 | 517 |
| 49 | 3300005842 | Ga0068858_100081487 | Ga0068858_1000814872 | 517 |
| 50 | 3300005843 | Ga0068860_100030330 | Ga0068860_1000303304 | 517 |
| 51 | 3300009093 | Ga0105240_10011902 | Ga0105240_100119025 | 517 |
| 52 | 3300009551 | Ga0105238_10005134 | Ga0105238_100051343 | 517 |
| 53 | 3300009551 | Ga0105238_10007610 | Ga0105238_100076106 | 517 |
| 54 | 3300010375 | Ga0105239_10008583 | Ga0105239_100085834 | 517 |
| 55 | 3300013105 | Ga0157369_10008444 | Ga0157369_100084444 | 517 |
| 56 | 3300013296 | Ga0157374_10016908 | Ga0157374_100169086 | 517 |
| 57 | 3300025912 | Ga0207707_10002780 | Ga0207707_100027804 | 517 |
| 58 | 3300025914 | Ga0207671_10036566 | Ga0207671_100365661 | 517 |
| 59 | 3300025921 | Ga0207652_10012067 | Ga0207652_100120673 | 517 |
| 60 | 3300025949 | Ga0207667_10012495 | Ga0207667_100124952 | 517 |
| 61 | 3300028381 | Ga0268264_10027442 | Ga0268264_100274423 | 517 |
| 62 | 3300030521 | Ga0307511_10000948 | Ga0307511_1000094819 | 517 |
| 63 | 3300050512 | nmdc:mga0n895_34877_c1 | nmdc:mga0n895_34877_c1_1187_3016 | 518 |
| 64 | 3300046691 | Ga0495670_0006538 | Ga0495670_0006538_2923_4779 | 519 |
| 65 | 3300006237 | Ga0097621_100047178 | Ga0097621_1000471783 | 521 |
| 66 | 3300026089 | Ga0207648_10085947 | Ga0207648_100859472 | 521 |
| 67 | 3300036401 | Ga0373937_0018405 | Ga0373937_0018405_1174_3063 | 521 |
| 68 | 3300046511 | Ga0495608_0009334 | Ga0495608_0009334_2847_4736 | 521 |
| 69 | 3300046543 | Ga0495645_0021487 | Ga0495645_0021487_1585_3474 | 521 |
| 70 | 3300046559 | Ga0495667_0009010 | Ga0495667_0009010_1752_3641 | 521 |
| 71 | 3300046679 | Ga0495623_0023795 | Ga0495623_0023795_162_2051 | 521 |
| 72 | 3300048924 | Ga0496121_0012225 | Ga0496121_0012225_5832_7688 | 521 |
| 73 | 3300053104 | Ga0500556_0000030 | Ga0500556_0000030_46015_47871 | 521 |
| 74 | 3300005355 | Ga0070671_100006687 | Ga0070671_1000066876 | 522 |
| 75 | 3300005367 | Ga0070667_100144311 | Ga0070667_1001443111 | 522 |
| 76 | 3300005543 | Ga0070672_100015332 | Ga0070672_1000153326 | 522 |
| 77 | 3300009177 | Ga0105248_10060607 | Ga0105248_100606073 | 522 |
| 78 | 3300013308 | Ga0157375_10061079 | Ga0157375_100610792 | 522 |
| 79 | 3300025940 | Ga0207691_10007860 | Ga0207691_1000786012 | 522 |
| 80 | 3300025941 | Ga0207711_10041464 | Ga0207711_100414642 | 522 |
| 81 | 3300026142 | Ga0207698_10086126 | Ga0207698_100861262 | 522 |
| 82 | 3300048921 | Ga0496118_0035700 | Ga0496118_0035700_916_2778 | 522 |
| 83 | 3300053109 | Ga0500569_008121 | Ga0500569_008121_71_2002 | 522 |
| 84 | 3300046513 | Ga0495616_0019335 | Ga0495616_0019335_331_2193 | 523 |
| 85 | 3300046660 | Ga0495625_0008887 | Ga0495625_0008887_1846_3708 | 523 |
| 86 | 3300047443 | Ga0495687_000606 | Ga0495687_000606_12112_14013 | 523 |
| 87 | 3300053130 | Ga0500642_0000028 | Ga0500642_0000028_97134_98996 | 523 |
| 88 | 3300053131 | Ga0500652_000106 | Ga0500652_000106_21377_23239 | 523 |
| 89 | 3300053153 | Ga0500616_0000252 | Ga0500616_0000252_40073_41935 | 523 |
| 90 | 3300053730 | Ga0500645_008943 | Ga0500645_008943_479_2341 | 523 |
| 91 | 3300037312 | Ga0395899_0007150 | Ga0395899_0007150_5562_7511 | 524 |
| 92 | 3300037466 | Ga0395898_0018064 | Ga0395898_0018064_2429_4378 | 524 |
| 93 | 3300005471 | Ga0070698_100125871 | Ga0070698_1001258711 | 525 |
| 94 | 3300031730 | Ga0307516_10061229 | Ga0307516_100612292 | 525 |
| 95 | 3300046452 | Ga0495617_016482 | Ga0495617_016482_429_2177 | 526 |
| 96 | 3300003792 | Ga0055540_1003959 | Ga0055540_10039593 | 527 |
| 97 | 3300003794 | Ga0055531_10000158 | Ga0055531_1000015836 | 527 |
| 98 | 3300005435 | Ga0070714_100007553 | Ga0070714_1000075534 | 527 |
| 99 | 3300005435 | Ga0070714_100019726 | Ga0070714_1000197262 | 527 |
| 100 | 3300005436 | Ga0070713_100034469 | Ga0070713_1000344693 | 527 |
| 101 | 3300006871 | Ga0075434_100038462 | Ga0075434_1000384624 | 527 |
| 102 | 3300017792 | Ga0163161_10002473 | Ga0163161_100024738 | 527 |
| 103 | 3300025303 | Ga0209051_1000315 | Ga0209051_100031558 | 527 |
| 104 | 3300025304 | Ga0209257_1000309 | Ga0209257_100030970 | 527 |
| 105 | 3300025910 | Ga0207684_10042982 | Ga0207684_100429823 | 527 |
| 106 | 3300025928 | Ga0207700_10024746 | Ga0207700_100247464 | 527 |
| 107 | 3300044673 | Ga0453683_0020949 | Ga0453683_0020949_2148_4106 | 527 |
| 108 | 3300046507 | Ga0495606_0006516 | Ga0495606_0006516_6625_8373 | 527 |
| 109 | 3300053119 | Ga0500595_007441 | Ga0500595_007441_2595_4478 | 527 |
| 110 | 3300053119 | Ga0500595_019836 | Ga0500595_019836_331_2076 | 527 |
| 111 | 3300005535 | Ga0070684_100045196 | Ga0070684_1000451963 | 528 |
| 112 | 3300005536 | Ga0070697_100009294 | Ga0070697_1000092946 | 528 |
| 113 | 3300005546 | Ga0070696_100017960 | Ga0070696_1000179603 | 528 |
| 114 | 3300005563 | Ga0068855_100045298 | Ga0068855_1000452986 | 528 |
| 115 | 3300005614 | Ga0068856_100030872 | Ga0068856_1000308724 | 528 |
| 116 | 3300006353 | Ga0075370_10013050 | Ga0075370_100130502 | 528 |
| 117 | 3300006914 | Ga0075436_100006942 | Ga0075436_1000069424 | 528 |
| 118 | 3300026116 | Ga0207674_10060152 | Ga0207674_100601523 | 528 |
| 119 | 3300037312 | Ga0395899_0071757 | Ga0395899_0071757_601_2364 | 528 |
| 120 | 3300037418 | Ga0395900_0067255 | Ga0395900_0067255_1835_3598 | 528 |
| 121 | 3300038443 | Ga0395901_0004166 | Ga0395901_0004166_332_2095 | 528 |
| 122 | 3300005329 | Ga0070683_100041220 | Ga0070683_1000412202 | 529 |
| 123 | 3300006237 | Ga0097621_100003286 | Ga0097621_1000032868 | 529 |
| 124 | 3300009176 | Ga0105242_10035792 | Ga0105242_100357922 | 529 |
| 125 | 3300013105 | Ga0157369_10065123 | Ga0157369_100651232 | 529 |
| 126 | 3300025284 | Ga0209130_1000591 | Ga0209130_100059122 | 529 |
| 127 | 3300025302 | Ga0207426_1000287 | Ga0207426_10002873 | 529 |
| 128 | 3300031241 | Ga0265325_10002896 | Ga0265325_100028968 | 529 |
| 129 | 3300005331 | Ga0070670_100017353 | Ga0070670_1000173534 | 530 |
| 130 | 3300025303 | Ga0209051_1007350 | Ga0209051_10073503 | 531 |
| 131 | 3300050511 | nmdc:mga08y16_125842_c1 | nmdc:mga08y16_125842_c1_367_2247 | 531 |
| 132 | 3300005985 | Ga0081539_10004392 | Ga0081539_100043924 | 532 |
| 133 | 3300005985 | Ga0081539_10027315 | Ga0081539_100273153 | 532 |
| 134 | 3300025923 | Ga0207681_10060735 | Ga0207681_100607352 | 532 |
| 135 | 3300036401 | Ga0373937_0103756 | Ga0373937_0103756_568_2436 | 532 |
| 136 | 3300049572 | Ga0501036_0055465 | Ga0501036_0055465_817_2796 | 532 |
| 137 | 3300061734 | Ga0530510_0019591 | Ga0530510_0019591_1891_3870 | 532 |
| 138 | 3300005331 | Ga0070670_100093816 | Ga0070670_1000938161 | 533 |
| 139 | 3300005364 | Ga0070673_100050061 | Ga0070673_1000500612 | 533 |
| 140 | 3300005456 | Ga0070678_100019298 | Ga0070678_1000192981 | 533 |
| 141 | 3300005543 | Ga0070672_100017060 | Ga0070672_1000170603 | 533 |
| 142 | 3300005617 | Ga0068859_100031914 | Ga0068859_1000319143 | 533 |
| 143 | 3300005618 | Ga0068864_100013488 | Ga0068864_1000134885 | 533 |
| 144 | 3300006178 | Ga0075367_10046031 | Ga0075367_100460312 | 533 |
| 145 | 3300006931 | Ga0097620_100031914 | Ga0097620_1000319143 | 533 |
| 146 | 3300009545 | Ga0105237_10004886 | Ga0105237_100048868 | 533 |
| 147 | 3300010375 | Ga0105239_10016888 | Ga0105239_100168885 | 533 |
| 148 | 3300025898 | Ga0207692_10045290 | Ga0207692_100452902 | 533 |
| 149 | 3300025914 | Ga0207671_10012628 | Ga0207671_100126283 | 533 |
| 150 | 3300025933 | Ga0207706_10028017 | Ga0207706_100280174 | 533 |
| 151 | 3300025940 | Ga0207691_10025838 | Ga0207691_100258383 | 533 |
| 152 | 3300026121 | Ga0207683_10036564 | Ga0207683_100365642 | 533 |
| 153 | 3300038443 | Ga0395901_0131342 | Ga0395901_0131342_566_2440 | 533 |
| 154 | 3300050493 | nmdc:mga0k408_19023_c1 | nmdc:mga0k408_19023_c1_191_2068 | 533 |
| 155 | 3300050496 | nmdc:mga07m45_13544_c1 | nmdc:mga07m45_13544_c1_906_2783 | 533 |
| 156 | 3300005334 | Ga0068869_100003935 | Ga0068869_1000039357 | 534 |
| 157 | 3300005338 | Ga0068868_100024412 | Ga0068868_1000244124 | 534 |
| 158 | 3300005340 | Ga0070689_100014581 | Ga0070689_1000145812 | 534 |
| 159 | 3300005543 | Ga0070672_100017477 | Ga0070672_1000174773 | 534 |
| 160 | 3300005548 | Ga0070665_100013258 | Ga0070665_1000132585 | 534 |
| 161 | 3300005614 | Ga0068856_100034496 | Ga0068856_1000344963 | 534 |
| 162 | 3300005842 | Ga0068858_100022251 | Ga0068858_1000222514 | 534 |
| 163 | 3300005844 | Ga0068862_100048026 | Ga0068862_1000480263 | 534 |
| 164 | 3300006186 | Ga0075369_10005721 | Ga0075369_100057213 | 534 |
| 165 | 3300009094 | Ga0111539_10097380 | Ga0111539_100973802 | 534 |
| 166 | 3300025295 | Ga0209564_1001504 | Ga0209564_100150412 | 534 |
| 167 | 3300025907 | Ga0207645_10025420 | Ga0207645_100254204 | 534 |
| 168 | 3300025933 | Ga0207706_10033719 | Ga0207706_100337193 | 534 |
| 169 | 3300025936 | Ga0207670_10038227 | Ga0207670_100382272 | 534 |
| 170 | 3300025940 | Ga0207691_10020845 | Ga0207691_100208453 | 534 |
| 171 | 3300026116 | Ga0207674_10025674 | Ga0207674_100256744 | 534 |
| 172 | 3300028379 | Ga0268266_10010351 | Ga0268266_100103515 | 534 |
| 173 | 3300035086 | Ga0373934_0001121 | Ga0373934_0001121_2329_4206 | 534 |
| 174 | 3300035119 | Ga0373956_0000103 | Ga0373956_0000103_25002_26879 | 534 |
| 175 | 3300035724 | Ga0373933_0000811 | Ga0373933_0000811_8290_10167 | 534 |
| 176 | 3300036401 | Ga0373937_0000769 | Ga0373937_0000769_10890_12767 | 534 |
| 177 | 3300046462 | Ga0495651_0006045 | Ga0495651_0006045_2007_3884 | 534 |
| 178 | 3300026067 | Ga0207678_10062852 | Ga0207678_100628523 | 535 |
| 179 | 3300003781 | Ga0055536_1000891 | Ga0055536_100089113 | 536 |
| 180 | 3300003792 | Ga0055540_1001142 | Ga0055540_100114211 | 536 |
| 181 | 3300006051 | Ga0075364_10010428 | Ga0075364_100104285 | 536 |
| 182 | 3300006177 | Ga0075362_10002395 | Ga0075362_100023952 | 536 |
| 183 | 3300006195 | Ga0075366_10002532 | Ga0075366_100025323 | 536 |
| 184 | 3300006914 | Ga0075436_100002869 | Ga0075436_1000028695 | 536 |
| 185 | 3300025292 | Ga0209676_1000873 | Ga0209676_100087313 | 536 |
| 186 | 3300025303 | Ga0209051_1000773 | Ga0209051_100077312 | 536 |
| 187 | 3300048927 | Ga0496124_0045825 | Ga0496124_0045825_602_2350 | 536 |
| 188 | 3300048928 | Ga0496125_0064200 | Ga0496125_0064200_131_1879 | 536 |
| 189 | 3300048929 | Ga0496126_0107306 | Ga0496126_0107306_96_1844 | 536 |
| 190 | 3300050489 | nmdc:mga03683_994_c1 | nmdc:mga03683_994_c1_1180_2946 | 536 |
| 191 | 3300050507 | nmdc:mga05p37_220131_c1 | nmdc:mga05p37_220131_c1_365_2215 | 536 |
| 192 | 3300053094 | Ga0500566_0000135 | Ga0500566_0000135_32812_34674 | 536 |
| 193 | 3300053177 | Ga0500636_0000525 | Ga0500636_0000525_3274_5136 | 536 |
| 194 | 3300006944 | Ga0099823_1022458 | Ga0099823_10224582 | 537 |
| 195 | 3300027296 | Ga0209389_1000062 | Ga0209389_100006218 | 537 |
| 196 | 3300027361 | Ga0209489_100160 | Ga0209489_10016018 | 537 |
| 197 | 3300027363 | Ga0209700_102603 | Ga0209700_10260322 | 537 |
| 198 | 3300030522 | Ga0307512_10038502 | Ga0307512_100385023 | 537 |
| 199 | 3300033442 | Ga0315911_1000017 | Ga0315911_1000017141 | 537 |
| 200 | 3300037471 | Ga0395905_0011762 | Ga0395905_0011762_2313_4280 | 537 |
| 201 | 3300046692 | Ga0495671_0009334 | Ga0495671_0009334_1432_3363 | 537 |
| 202 | iso_pu_bacteria | 2643221544 | 2643744825 | 537 |
| 203 | iso_pu_bacteria | 2643221639 | 2644219549 | 537 |
| 204 | iso_pu_bacteria | 2643221646 | 2644255979 | 537 |
| 205 | 3300005356 | Ga0070674_100028198 | Ga0070674_1000281981 | 538 |
| 206 | 3300005439 | Ga0070711_100059328 | Ga0070711_1000593282 | 538 |
| 207 | 3300006353 | Ga0075370_10024557 | Ga0075370_100245572 | 538 |
| 208 | 3300006881 | Ga0068865_100083388 | Ga0068865_1000833881 | 538 |
| 209 | 3300009148 | Ga0105243_10014028 | Ga0105243_100140286 | 538 |
| 210 | 3300022739 | Ga0228711_1002116 | Ga0228711_100211636 | 538 |
| 211 | 3300022740 | Ga0228710_1011349 | Ga0228710_10113499 | 538 |
| 212 | 3300025916 | Ga0207663_10090076 | Ga0207663_100900762 | 538 |
| 213 | 3300025935 | Ga0207709_10000497 | Ga0207709_100004976 | 538 |
| 214 | 3300025940 | Ga0207691_10001616 | Ga0207691_100016164 | 538 |
| 215 | 3300026089 | Ga0207648_10049421 | Ga0207648_100494212 | 538 |
| 216 | 3300027111 | Ga0209281_1000106 | Ga0209281_100010642 | 538 |
| 217 | 3300027666 | Ga0209282_1000083 | Ga0209282_100008329 | 538 |
| 218 | 3300028794 | Ga0307515_10014764 | Ga0307515_100147645 | 538 |
| 219 | 3300031730 | Ga0307516_10000348 | Ga0307516_1000034811 | 538 |
| 220 | 3300031967 | Ga0315914_1002550 | Ga0315914_100255029 | 538 |
| 221 | 3300033430 | Ga0315913_1001274 | Ga0315913_100127428 | 538 |
| 222 | 3300033464 | Ga0315915_1000010 | Ga0315915_100001075 | 538 |
| 223 | 3300035118 | Ga0373954_0000001 | Ga0373954_0000001_119623_121521 | 538 |
| 224 | 3300036401 | Ga0373937_0005181 | Ga0373937_0005181_1962_3860 | 538 |
| 225 | 3300053117 | Ga0500593_001328 | Ga0500593_001328_3509_5257 | 538 |
| 226 | iso_pu_bacteria | 2551306091 | 2551730641 | 538 |
| 227 | 3300005983 | Ga0081540_1000922 | Ga0081540_100092223 | 539 |
| 228 | 3300006028 | Ga0070717_10088575 | Ga0070717_100885752 | 539 |
| 229 | 3300006871 | Ga0075434_100092148 | Ga0075434_1000921482 | 539 |
| 230 | 3300025910 | Ga0207684_10038233 | Ga0207684_100382332 | 539 |
| 231 | 3300025922 | Ga0207646_10043993 | Ga0207646_100439932 | 539 |
| 232 | 3300048915 | Ga0496112_0057848 | Ga0496112_0057848_1259_3007 | 539 |
| 233 | 3300005353 | Ga0070669_100021219 | Ga0070669_1000212194 | 540 |
| 234 | 3300005367 | Ga0070667_100056670 | Ga0070667_1000566704 | 540 |
| 235 | 3300005441 | Ga0070700_100059602 | Ga0070700_1000596021 | 540 |
| 236 | 3300005719 | Ga0068861_100073057 | Ga0068861_1000730571 | 540 |
| 237 | 3300005937 | Ga0081455_10018535 | Ga0081455_100185353 | 540 |
| 238 | 3300005983 | Ga0081540_1001425 | Ga0081540_100142523 | 540 |
| 239 | 3300006195 | Ga0075366_10017650 | Ga0075366_100176502 | 540 |
| 240 | 3300006871 | Ga0075434_100073983 | Ga0075434_1000739833 | 540 |
| 241 | 3300006914 | Ga0075436_100017707 | Ga0075436_1000177074 | 540 |
| 242 | 3300026075 | Ga0207708_10020468 | Ga0207708_100204684 | 540 |
| 243 | 3300049823 | Ga0501044_0115365 | Ga0501044_0115365_206_1954 | 540 |
| 244 | 3300050515 | nmdc:mga0a205_48710_c1 | nmdc:mga0a205_48710_c1_2038_3786 | 540 |
| 245 | 3300002987 | JGI25159J45721_1000004 | JGI25159J45721_1000004130 | 541 |
| 246 | 3300003354 | JGI25160J50197_1000021 | JGI25160J50197_100002180 | 541 |
| 247 | 3300003374 | JGI25161J50226_1000218 | JGI25161J50226_100021829 | 541 |
| 248 | 3300003771 | Ga0055526_1001422 | Ga0055526_10014228 | 541 |
| 249 | 3300003781 | Ga0055536_1000269 | Ga0055536_100026927 | 541 |
| 250 | 3300003794 | Ga0055531_10000586 | Ga0055531_100005864 | 541 |
| 251 | 3300004625 | Ga0055543_1000164 | Ga0055543_100016422 | 541 |
| 252 | 3300005262 | Ga0065165_1000033 | Ga0065165_100003380 | 541 |
| 253 | 3300005618 | Ga0068864_100013717 | Ga0068864_1000137174 | 541 |
| 254 | 3300006038 | Ga0075365_10010896 | Ga0075365_100108964 | 541 |
| 255 | 3300006042 | Ga0075368_10013178 | Ga0075368_100131782 | 541 |
| 256 | 3300006178 | Ga0075367_10000458 | Ga0075367_100004589 | 541 |
| 257 | 3300006846 | Ga0075430_100000192 | Ga0075430_1000001922 | 541 |
| 258 | 3300009098 | Ga0105245_10128425 | Ga0105245_101284252 | 541 |
| 259 | 3300025298 | Ga0209050_1000759 | Ga0209050_100075955 | 541 |
| 260 | 3300025303 | Ga0209051_1003896 | Ga0209051_10038962 | 541 |
| 261 | 3300025304 | Ga0209257_1000061 | Ga0209257_1000061187 | 541 |
| 262 | 3300025927 | Ga0207687_10087839 | Ga0207687_100878391 | 541 |
| 263 | 3300026118 | Ga0207675_100060081 | Ga0207675_1000600812 | 541 |
| 264 | 3300027866 | Ga0209813_10000917 | Ga0209813_100009172 | 541 |
| 265 | 3300031548 | Ga0307408_100000012 | Ga0307408_10000001252 | 541 |
| 266 | 3300048907 | Ga0496104_0047774 | Ga0496104_0047774_1477_3192 | 541 |
| 267 | 3300050494 | nmdc:mga06z11_4933_c1 | nmdc:mga06z11_4933_c1_1621_3366 | 541 |
| 268 | 3300050495 | nmdc:mga04h51_1465_c1 | nmdc:mga04h51_1465_c1_1930_3675 | 541 |
| 269 | 3300050509 | nmdc:mga0qj67_52_c1 | nmdc:mga0qj67_52_c1_7039_8784 | 541 |
| 270 | 3300053153 | Ga0500616_0002887 | Ga0500616_0002887_8003_9751 | 541 |
| 271 | 3300053154 | Ga0500619_000027 | Ga0500619_000027_14893_16824 | 541 |
| 272 | 3300053161 | Ga0500634_0004846 | Ga0500634_0004846_1714_3645 | 541 |
| 273 | 3300002739 | JGI25158J39367_1001450 | JGI25158J39367_10014502 | 542 |
| 274 | 3300003791 | Ga0055530_10002560 | Ga0055530_1000256012 | 542 |
| 275 | 3300003794 | Ga0055531_10008595 | Ga0055531_100085952 | 542 |
| 276 | 3300025208 | Ga0209436_103264 | Ga0209436_1032643 | 542 |
| 277 | 3300025284 | Ga0209130_1000017 | Ga0209130_1000017302 | 542 |
| 278 | 3300025292 | Ga0209676_1000876 | Ga0209676_100087615 | 542 |
| 279 | 3300025294 | Ga0209025_1000161 | Ga0209025_1000161128 | 542 |
| 280 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013750 | 542 |
| 281 | 3300025298 | Ga0209050_1002190 | Ga0209050_100219011 | 542 |
| 282 | 3300025299 | Ga0209256_1002058 | Ga0209256_100205818 | 542 |
| 283 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006301 | 542 |
| 284 | 3300025303 | Ga0209051_1006359 | Ga0209051_10063596 | 542 |
| 285 | 3300025304 | Ga0209257_1006709 | Ga0209257_10067096 | 542 |
| 286 | 3300035113 | Ga0373936_0038125 | Ga0373936_0038125_55_1809 | 542 |
| 287 | 3300045051 | Ga0451576_0005540 | Ga0451576_0005540_7357_9240 | 542 |
| 288 | 3300048913 | Ga0496110_0083061 | Ga0496110_0083061_1042_2757 | 542 |
| 289 | 3300048927 | Ga0496124_0040798 | Ga0496124_0040798_1382_3097 | 542 |
| 290 | 3300048928 | Ga0496125_0011403 | Ga0496125_0011403_5907_7622 | 542 |
| 291 | 3300005455 | Ga0070663_100000390 | Ga0070663_1000003905 | 543 |
| 292 | 3300005548 | Ga0070665_100002577 | Ga0070665_1000025777 | 543 |
| 293 | 3300006038 | Ga0075365_10005063 | Ga0075365_100050635 | 543 |
| 294 | 3300006048 | Ga0075363_100001360 | Ga0075363_1000013608 | 543 |
| 295 | 3300006178 | Ga0075367_10001100 | Ga0075367_100011002 | 543 |
| 296 | 3300006353 | Ga0075370_10014550 | Ga0075370_100145503 | 543 |
| 297 | 3300007788 | Ga0099795_10004985 | Ga0099795_100049853 | 543 |
| 298 | 3300009766 | Ga0123342_1003939 | Ga0123342_100393922 | 543 |
| 299 | 3300014325 | Ga0163163_10090922 | Ga0163163_100909223 | 543 |
| 300 | 3300025294 | Ga0209025_1014259 | Ga0209025_10142592 | 543 |
| 301 | 3300025297 | Ga0209758_1000628 | Ga0209758_10006281 | 543 |
| 302 | 3300025297 | Ga0209758_1011107 | Ga0209758_10111073 | 543 |
| 303 | 3300026067 | Ga0207678_10003222 | Ga0207678_100032227 | 543 |
| 304 | 3300028379 | Ga0268266_10000680 | Ga0268266_1000068012 | 543 |
| 305 | 3300031507 | Ga0307509_10022123 | Ga0307509_100221232 | 543 |
| 306 | 3300050490 | nmdc:mga03n38_17384_c1 | nmdc:mga03n38_17384_c1_290_2035 | 543 |
| 307 | 3300050494 | nmdc:mga06z11_1676_c1 | nmdc:mga06z11_1676_c1_1757_3502 | 543 |
| 308 | 3300050496 | nmdc:mga07m45_995_c1 | nmdc:mga07m45_995_c1_5501_7246 | 543 |
| 309 | 3300014326 | Ga0157380_10010872 | Ga0157380_100108723 | 544 |
| 310 | 3300035118 | Ga0373954_0026273 | Ga0373954_0026273_139_1986 | 544 |
| 311 | 3300046516 | Ga0495628_0078737 | Ga0495628_0078737_657_2504 | 544 |
| 312 | iso_pu_bacteria | 2599185214 | 2599627086 | 544 |
| 313 | iso_pu_bacteria | 2599185226 | 2599676553 | 544 |
| 314 | iso_pu_bacteria | 2599185227 | 2599684821 | 544 |
| 315 | iso_pu_bacteria | 2599185229 | 2599696743 | 544 |
| 316 | iso_pu_bacteria | 2928070936 | 2928072674 | 544 |
| 317 | 3300003203 | JGI25406J46586_10000160 | JGI25406J46586_100001606 | 545 |
| 318 | 3300005435 | Ga0070714_100133451 | Ga0070714_1001334512 | 545 |
| 319 | 3300005617 | Ga0068859_100049927 | Ga0068859_1000499273 | 545 |
| 320 | 3300005937 | Ga0081455_10061387 | Ga0081455_100613871 | 545 |
| 321 | 3300005985 | Ga0081539_10000040 | Ga0081539_10000040112 | 545 |
| 322 | 3300006042 | Ga0075368_10004400 | Ga0075368_100044004 | 545 |
| 323 | 3300006051 | Ga0075364_10004279 | Ga0075364_100042793 | 545 |
| 324 | 3300006175 | Ga0070712_100060996 | Ga0070712_1000609962 | 545 |
| 325 | 3300006178 | Ga0075367_10005385 | Ga0075367_100053855 | 545 |
| 326 | 3300006871 | Ga0075434_100067360 | Ga0075434_1000673603 | 545 |
| 327 | 3300006931 | Ga0097620_100049926 | Ga0097620_1000499263 | 545 |
| 328 | 3300009147 | Ga0114129_10035914 | Ga0114129_100359142 | 545 |
| 329 | 3300013297 | Ga0157378_10056200 | Ga0157378_100562002 | 545 |
| 330 | 3300025915 | Ga0207693_10037698 | Ga0207693_100376982 | 545 |
| 331 | 3300031456 | Ga0307513_10000034 | Ga0307513_10000034140 | 545 |
| 332 | 3300046615 | Ga0495656_0000081 | Ga0495656_0000081_17827_19704 | 545 |
| 333 | 3300048909 | Ga0496106_0110020 | Ga0496106_0110020_183_2060 | 545 |
| 334 | 3300048918 | Ga0496115_0166726 | Ga0496115_0166726_15_1742 | 545 |
| 335 | 3300049822 | Ga0501035_0031856 | Ga0501035_0031856_3068_4789 | 545 |
| 336 | 3300050490 | nmdc:mga03n38_7023_c1 | nmdc:mga03n38_7023_c1_913_2655 | 545 |
| 337 | 3300050491 | nmdc:mga00v17_14927_c1 | nmdc:mga00v17_14927_c1_1518_3260 | 545 |
| 338 | 3300050492 | nmdc:mga0yw44_1051_c1 | nmdc:mga0yw44_1051_c1_933_2675 | 545 |
| 339 | 3300050494 | nmdc:mga06z11_26802_c1 | nmdc:mga06z11_26802_c1_39_1781 | 545 |
| 340 | 3300050495 | nmdc:mga04h51_971_c1 | nmdc:mga04h51_971_c1_3684_5426 | 545 |
| 341 | 3300003215 | JGI25153J46596_10001104 | JGI25153J46596_1000110413 | 546 |
| 342 | 3300005458 | Ga0070681_10069587 | Ga0070681_100695872 | 546 |
| 343 | 3300005563 | Ga0068855_100025032 | Ga0068855_1000250327 | 546 |
| 344 | 3300005842 | Ga0068858_100036326 | Ga0068858_1000363263 | 546 |
| 345 | 3300006058 | Ga0075432_10006475 | Ga0075432_100064753 | 546 |
| 346 | 3300006195 | Ga0075366_10029899 | Ga0075366_100298992 | 546 |
| 347 | 3300013104 | Ga0157370_10147726 | Ga0157370_101477261 | 546 |
| 348 | 3300025297 | Ga0209758_1006011 | Ga0209758_10060115 | 546 |
| 349 | 3300028379 | Ga0268266_10001248 | Ga0268266_1000124822 | 546 |
| 350 | 3300033180 | Ga0307510_10025874 | Ga0307510_100258742 | 546 |
| 351 | 3300046674 | Ga0495588_0003613 | Ga0495588_0003613_337_2085 | 546 |
| 352 | 3300048913 | Ga0496110_0036657 | Ga0496110_0036657_672_2555 | 546 |
| 353 | iso_pu_bacteria | 2996887358 | 2996887698 | 546 |
| 354 | iso_pu_bacteria | 8005321885 | 8005322225 | 546 |
| 355 | 3300005471 | Ga0070698_100001905 | Ga0070698_10000190523 | 547 |
| 356 | 3300005614 | Ga0068856_100022824 | Ga0068856_1000228243 | 547 |
| 357 | 3300025924 | Ga0207694_10082520 | Ga0207694_100825202 | 547 |
| 358 | 3300025937 | Ga0207669_10025556 | Ga0207669_100255562 | 547 |
| 359 | 3300026041 | Ga0207639_10062849 | Ga0207639_100628492 | 547 |
| 360 | 3300031730 | Ga0307516_10005411 | Ga0307516_100054113 | 547 |
| 361 | 3300031730 | Ga0307516_10008644 | Ga0307516_100086449 | 547 |
| 362 | 3300037466 | Ga0395898_0008307 | Ga0395898_0008307_8685_10448 | 547 |
| 363 | 3300038443 | Ga0395901_0051140 | Ga0395901_0051140_2200_3963 | 547 |
| 364 | 3300053096 | Ga0500641_0002341 | Ga0500641_0002341_701_2449 | 547 |
| 365 | 3300053153 | Ga0500616_0001978 | Ga0500616_0001978_1456_3342 | 547 |
| 366 | iso_pu_bacteria | 2510917028 | 2511184817 | 547 |
| 367 | iso_pu_bacteria | 2513237138 | 2513870290 | 547 |
| 368 | iso_pu_bacteria | 2513237144 | 2513911960 | 547 |
| 369 | iso_pu_bacteria | 2513237146 | 2513923719 | 547 |
| 370 | iso_pu_bacteria | 2582581294 | 2585203458 | 547 |
| 371 | iso_pu_bacteria | 2582581867 | 2585398475 | 547 |
| 372 | iso_pu_bacteria | 2585427590 | 2585819378 | 547 |
| 373 | iso_pu_bacteria | 2599185170 | 2599415749 | 547 |
| 374 | iso_pu_bacteria | 2599185352 | 2600194783 | 547 |
| 375 | iso_pu_bacteria | 2643221618 | 2644104598 | 547 |
| 376 | iso_pu_bacteria | 2643221655 | 2644307986 | 547 |
| 377 | iso_pu_bacteria | 2643221659 | 2644333713 | 547 |
| 378 | iso_pu_bacteria | 2643221712 | 2644614140 | 547 |
| 379 | iso_pu_bacteria | 2643221723 | 2644675885 | 547 |
| 380 | iso_pu_bacteria | 2838035591 | 2838035867 | 547 |
| 381 | iso_pu_bacteria | 2838074704 | 2838077050 | 547 |
| 382 | iso_pu_bacteria | 2838661181 | 2838665099 | 547 |
| 383 | iso_pu_bacteria | 2896384573 | 2896385852 | 547 |
| 384 | iso_pu_bacteria | 2920760137 | 2920761785 | 547 |
| 385 | iso_pu_bacteria | 2923556063 | 2923557270 | 547 |
| 386 | iso_pu_bacteria | 2933016740 | 2933017824 | 547 |
| 387 | iso_pu_bacteria | 8005258706 | 8005259060 | 547 |
| 388 | iso_pu_bacteria | 8006933436 | 8006936134 | 547 |
| 389 | iso_pu_bacteria | 8006973647 | 8006976060 | 547 |
| 390 | 3300005330 | Ga0070690_100019176 | Ga0070690_1000191762 | 548 |
| 391 | 3300005356 | Ga0070674_100095080 | Ga0070674_1000950801 | 548 |
| 392 | 3300006844 | Ga0075428_100002073 | Ga0075428_10000207318 | 548 |
| 393 | 3300006880 | Ga0075429_100041037 | Ga0075429_1000410372 | 548 |
| 394 | 3300009094 | Ga0111539_10011469 | Ga0111539_100114692 | 548 |
| 395 | 3300025907 | Ga0207645_10017396 | Ga0207645_100173962 | 548 |
| 396 | 3300028794 | Ga0307515_10000013 | Ga0307515_1000001312 | 548 |
| 397 | 3300028794 | Ga0307515_10000037 | Ga0307515_10000037272 | 548 |
| 398 | 3300028794 | Ga0307515_10008845 | Ga0307515_100088458 | 548 |
| 399 | 3300031456 | Ga0307513_10015642 | Ga0307513_100156428 | 548 |
| 400 | 3300035691 | Ga0373931_0005744 | Ga0373931_0005744_2268_4016 | 548 |
| 401 | 3300048905 | Ga0496102_0001355 | Ga0496102_0001355_5945_7900 | 548 |
| 402 | 3300048912 | Ga0496109_0033573 | Ga0496109_0033573_1859_3607 | 548 |
| 403 | 3300048924 | Ga0496121_0000214 | Ga0496121_0000214_31607_33490 | 548 |
| 404 | 3300050508 | nmdc:mga09592_15617_c1 | nmdc:mga09592_15617_c1_1599_3686 | 548 |
| 405 | 3300050511 | nmdc:mga08y16_9940_c1 | nmdc:mga08y16_9940_c1_3617_5704 | 548 |
| 406 | 3300053117 | Ga0500593_000043 | Ga0500593_000043_33675_35633 | 548 |
| 407 | iso_pu_bacteria | 2513237092 | 2513628439 | 548 |
| 408 | iso_pu_bacteria | 2513237096 | 2513656372 | 548 |
| 409 | iso_pu_bacteria | 2513237137 | 2513857058 | 548 |
| 410 | iso_pu_bacteria | 2513237145 | 2513917449 | 548 |
| 411 | iso_pu_bacteria | 2765235802 | 2765468962 | 548 |
| 412 | iso_pu_bacteria | 2767802442 | 2770195103 | 548 |
| 413 | iso_pu_bacteria | 2775506902 | 2776270844 | 548 |
| 414 | iso_pu_bacteria | 2775506904 | 2776280333 | 548 |
| 415 | iso_pu_bacteria | 2839993093 | 2839996940 | 548 |
| 416 | iso_pu_bacteria | 2840764183 | 2840765997 | 548 |
| 417 | iso_pu_bacteria | 2841957949 | 2841963890 | 548 |
| 418 | iso_pu_bacteria | 2847930680 | 2847931857 | 548 |
| 419 | iso_pu_bacteria | 2874612657 | 2874620064 | 548 |
| 420 | iso_pu_bacteria | 2879083081 | 2879091233 | 548 |
| 421 | iso_pu_bacteria | 2906643746 | 2906647879 | 548 |
| 422 | iso_pu_bacteria | 2920822456 | 2920825426 | 548 |
| 423 | iso_pu_bacteria | 2922386360 | 2922392516 | 548 |
| 424 | iso_pu_bacteria | 3005483717 | 3005490365 | 548 |
| 425 | 3300005331 | Ga0070670_100002410 | Ga0070670_10000241014 | 549 |
| 426 | 3300005458 | Ga0070681_10004989 | Ga0070681_1000498914 | 549 |
| 427 | 3300005530 | Ga0070679_100004826 | Ga0070679_1000048263 | 549 |
| 428 | 3300005618 | Ga0068864_100004280 | Ga0068864_1000042806 | 549 |
| 429 | 3300005618 | Ga0068864_100025475 | Ga0068864_1000254754 | 549 |
| 430 | 3300005841 | Ga0068863_100008635 | Ga0068863_1000086355 | 549 |
| 431 | 3300006178 | Ga0075367_10001562 | Ga0075367_100015622 | 549 |
| 432 | 3300006186 | Ga0075369_10003922 | Ga0075369_100039224 | 549 |
| 433 | 3300009177 | Ga0105248_10003122 | Ga0105248_100031228 | 549 |
| 434 | 3300015683 | Ga0183362_10005 | Ga0183362_1000523 | 549 |
| 435 | 3300025921 | Ga0207652_10016979 | Ga0207652_100169794 | 549 |
| 436 | 3300025931 | Ga0207644_10014326 | Ga0207644_100143263 | 549 |
| 437 | 3300026095 | Ga0207676_10004233 | Ga0207676_1000423310 | 549 |
| 438 | 3300026095 | Ga0207676_10039058 | Ga0207676_100390582 | 549 |
| 439 | 3300026142 | Ga0207698_10075114 | Ga0207698_100751142 | 549 |
| 440 | 3300027907 | Ga0207428_10002133 | Ga0207428_1000213317 | 549 |
| 441 | 3300031456 | Ga0307513_10012252 | Ga0307513_100122523 | 549 |
| 442 | 3300048915 | Ga0496112_0132541 | Ga0496112_0132541_545_2437 | 549 |
| 443 | 3300048916 | Ga0496113_0010705 | Ga0496113_0010705_1769_3664 | 549 |
| 444 | iso_pu_bacteria | 2602042107 | 2603859703 | 549 |
| 445 | iso_pu_bacteria | 2643221733 | 2644729946 | 549 |
| 446 | iso_pu_bacteria | 2775506901 | 2776262110 | 549 |
| 447 | iso_pu_bacteria | 2857524615 | 2857530714 | 549 |
| 448 | iso_pu_bacteria | 2893066018 | 2893070335 | 549 |
| 449 | iso_pu_bacteria | 2919073203 | 2919076291 | 549 |
| 450 | iso_pu_bacteria | 8019648815 | 8019653373 | 549 |
| 451 | 3300014326 | Ga0157380_10035779 | Ga0157380_100357792 | 550 |
| 452 | 3300025913 | Ga0207695_10004829 | Ga0207695_100048294 | 550 |
| 453 | 3300037312 | Ga0395899_0012066 | Ga0395899_0012066_98_1846 | 550 |
| 454 | 3300037418 | Ga0395900_0049257 | Ga0395900_0049257_492_2240 | 550 |
| 455 | 3300038443 | Ga0395901_0001587 | Ga0395901_0001587_9315_11063 | 550 |
| 456 | iso_pu_bacteria | 2844533157 | 2844535131 | 550 |
| 457 | 3300050508 | nmdc:mga09592_138974_c1 | nmdc:mga09592_138974_c1_153_1898 | 551 |
| 458 | 3300050510 | nmdc:mga06r32_13686_c2 | nmdc:mga06r32_13686_c2_104_1849 | 551 |
| 459 | 3300053093 | Ga0500651_0084312 | Ga0500651_0084312_57_1796 | 551 |
| 460 | 3300005983 | Ga0081540_1003997 | Ga0081540_10039974 | 552 |
| 461 | 3300006847 | Ga0075431_100019202 | Ga0075431_1000192025 | 552 |
| 462 | 3300009147 | Ga0114129_10010074 | Ga0114129_100100744 | 552 |
| 463 | 3300046491 | Ga0495584_0006643 | Ga0495584_0006643_3760_5505 | 552 |
| 464 | 3300046519 | Ga0495632_0031101 | Ga0495632_0031101_931_2679 | 552 |
| 465 | 3300048907 | Ga0496104_0000175 | Ga0496104_0000175_1289_3031 | 552 |
| 466 | 3300048908 | Ga0496105_0002850 | Ga0496105_0002850_1739_3481 | 552 |
| 467 | 3300048911 | Ga0496108_0003952 | Ga0496108_0003952_2776_4518 | 552 |
| 468 | 3300048912 | Ga0496109_0004749 | Ga0496109_0004749_3726_5468 | 552 |
| 469 | 3300048913 | Ga0496110_0007879 | Ga0496110_0007879_5386_7128 | 552 |
| 470 | 3300048914 | Ga0496111_0000718 | Ga0496111_0000718_1251_2993 | 552 |
| 471 | 3300048915 | Ga0496112_0109029 | Ga0496112_0109029_970_2712 | 552 |
| 472 | 3300049571 | Ga0501034_0021593 | Ga0501034_0021593_3454_5193 | 552 |
| 473 | 3300049574 | Ga0501038_0019980 | Ga0501038_0019980_2478_4217 | 552 |
| 474 | 3300049581 | Ga0501047_0021515 | Ga0501047_0021515_2597_4336 | 552 |
| 475 | 3300049589 | Ga0501073_0023082 | Ga0501073_0023082_755_2494 | 552 |
| 476 | 3300049744 | Ga0501083_0013082 | Ga0501083_0013082_718_2457 | 552 |
| 477 | 3300049823 | Ga0501044_0069528 | Ga0501044_0069528_1290_3029 | 552 |
| 478 | 3300050507 | nmdc:mga05p37_4947_c1 | nmdc:mga05p37_4947_c1_9707_11452 | 552 |
| 479 | 3300050510 | nmdc:mga06r32_27161_c1 | nmdc:mga06r32_27161_c1_2275_4020 | 552 |
| 480 | 3300006048 | Ga0075363_100040709 | Ga0075363_1000407092 | 553 |
| 481 | 3300006178 | Ga0075367_10026557 | Ga0075367_100265573 | 553 |
| 482 | 3300006178 | Ga0075367_10050199 | Ga0075367_100501992 | 553 |
| 483 | 3300006353 | Ga0075370_10022157 | Ga0075370_100221573 | 553 |
| 484 | 3300031901 | Ga0307406_10023282 | Ga0307406_100232822 | 553 |
| 485 | 3300034819 | Ga0373958_0000988 | Ga0373958_0000988_1697_3442 | 553 |
| 486 | 3300035691 | Ga0373931_0000387 | Ga0373931_0000387_10914_12659 | 553 |
| 487 | 3300050492 | nmdc:mga0yw44_22282_c2 | nmdc:mga0yw44_22282_c2_159_1907 | 553 |
| 488 | 3300053119 | Ga0500595_000055 | Ga0500595_000055_75153_76904 | 553 |
| 489 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_157983_159734 | 553 |
| 490 | 3300053730 | Ga0500645_000458 | Ga0500645_000458_8343_10094 | 553 |
| 491 | 2162886007 | SwRhRL2b_contig_531915 | SwRhRL2b_0786.00004900 | 554 |
| 492 | 2209111006 | 2214828545 | 2213866913 | 554 |
| 493 | 3300000041 | ARcpr5oldR_c001419 | ARcpr5oldR_0014192 | 554 |
| 494 | 3300000042 | ARSoilYngRDRAFT_c00204 | ARSoilYngRDRAFT_002042 | 554 |
| 495 | 3300000043 | ARcpr5yngRDRAFT_c001717 | ARcpr5yngRDRAFT_0017172 | 554 |
| 496 | 3300000044 | ARSoilOldRDRAFT_c000097 | ARSoilOldRDRAFT_00009717 | 554 |
| 497 | 3300000045 | ARCol0oldRDRAFT_c00920 | ARCol0oldRDRAFT_009202 | 554 |
| 498 | 3300000652 | ARCol0yngRDRAFT_1000138 | ARCol0yngRDRAFT_100013813 | 554 |
| 499 | 3300002070 | JGI24750J21931_1000071 | JGI24750J21931_10000718 | 554 |
| 500 | 3300002076 | JGI24749J21850_1000123 | JGI24749J21850_10001232 | 554 |
| 501 | 3300002459 | JGI24751J29686_10006799 | JGI24751J29686_100067992 | 554 |
| 502 | 3300003187 | JGI25151J46595_10000246 | JGI25151J46595_100002469 | 554 |
| 503 | 3300005277 | Ga0065716_1001798 | Ga0065716_10017983 | 554 |
| 504 | 3300005289 | Ga0065704_10090917 | Ga0065704_100909172 | 554 |
| 505 | 3300005329 | Ga0070683_100079642 | Ga0070683_1000796422 | 554 |
| 506 | 3300005336 | Ga0070680_100040428 | Ga0070680_1000404281 | 554 |
| 507 | 3300005337 | Ga0070682_100000567 | Ga0070682_10000056711 | 554 |
| 508 | 3300005338 | Ga0068868_100043264 | Ga0068868_1000432645 | 554 |
| 509 | 3300005340 | Ga0070689_100041356 | Ga0070689_1000413562 | 554 |
| 510 | 3300005355 | Ga0070671_100020002 | Ga0070671_1000200025 | 554 |
| 511 | 3300005365 | Ga0070688_100011433 | Ga0070688_1000114332 | 554 |
| 512 | 3300005366 | Ga0070659_100102796 | Ga0070659_1001027962 | 554 |
| 513 | 3300005367 | Ga0070667_100115840 | Ga0070667_1001158402 | 554 |
| 514 | 3300005436 | Ga0070713_100014064 | Ga0070713_1000140643 | 554 |
| 515 | 3300005445 | Ga0070708_100000133 | Ga0070708_10000013338 | 554 |
| 516 | 3300005456 | Ga0070678_100035561 | Ga0070678_1000355612 | 554 |
| 517 | 3300005458 | Ga0070681_10004361 | Ga0070681_1000436111 | 554 |
| 518 | 3300005458 | Ga0070681_10080534 | Ga0070681_100805341 | 554 |
| 519 | 3300005459 | Ga0068867_100062697 | Ga0068867_1000626972 | 554 |
| 520 | 3300005466 | Ga0070685_10007824 | Ga0070685_100078245 | 554 |
| 521 | 3300005530 | Ga0070679_100001064 | Ga0070679_10000106414 | 554 |
| 522 | 3300005539 | Ga0068853_100042938 | Ga0068853_1000429383 | 554 |
| 523 | 3300005539 | Ga0068853_100060831 | Ga0068853_1000608313 | 554 |
| 524 | 3300005563 | Ga0068855_100113648 | Ga0068855_1001136482 | 554 |
| 525 | 3300005577 | Ga0068857_100029996 | Ga0068857_1000299963 | 554 |
| 526 | 3300005615 | Ga0070702_100007354 | Ga0070702_1000073545 | 554 |
| 527 | 3300005617 | Ga0068859_100066070 | Ga0068859_1000660705 | 554 |
| 528 | 3300005618 | Ga0068864_100040947 | Ga0068864_1000409472 | 554 |
| 529 | 3300005718 | Ga0068866_10042525 | Ga0068866_100425252 | 554 |
| 530 | 3300005843 | Ga0068860_100028824 | Ga0068860_1000288243 | 554 |
| 531 | 3300006931 | Ga0097620_100066069 | Ga0097620_1000660695 | 554 |
| 532 | 3300009101 | Ga0105247_10010927 | Ga0105247_100109273 | 554 |
| 533 | 3300009147 | Ga0114129_10035342 | Ga0114129_100353421 | 554 |
| 534 | 3300009176 | Ga0105242_10001652 | Ga0105242_1000165210 | 554 |
| 535 | 3300013100 | Ga0157373_10015870 | Ga0157373_100158703 | 554 |
| 536 | 3300013104 | Ga0157370_10008445 | Ga0157370_1000844510 | 554 |
| 537 | 3300013105 | Ga0157369_10002895 | Ga0157369_100028952 | 554 |
| 538 | 3300013296 | Ga0157374_10033492 | Ga0157374_100334923 | 554 |
| 539 | 3300013307 | Ga0157372_10031877 | Ga0157372_100318773 | 554 |
| 540 | 3300013307 | Ga0157372_10060311 | Ga0157372_100603111 | 554 |
| 541 | 3300013308 | Ga0157375_10037213 | Ga0157375_100372134 | 554 |
| 542 | 3300025294 | Ga0209025_1000265 | Ga0209025_100026566 | 554 |
| 543 | 3300025297 | Ga0209758_1002358 | Ga0209758_10023585 | 554 |
| 544 | 3300025901 | Ga0207688_10042184 | Ga0207688_100421842 | 554 |
| 545 | 3300025904 | Ga0207647_10015046 | Ga0207647_100150465 | 554 |
| 546 | 3300025904 | Ga0207647_10057132 | Ga0207647_100571323 | 554 |
| 547 | 3300025908 | Ga0207643_10036424 | Ga0207643_100364241 | 554 |
| 548 | 3300025916 | Ga0207663_10020266 | Ga0207663_100202663 | 554 |
| 549 | 3300025918 | Ga0207662_10015709 | Ga0207662_100157092 | 554 |
| 550 | 3300025921 | Ga0207652_10050807 | Ga0207652_100508072 | 554 |
| 551 | 3300025923 | Ga0207681_10021524 | Ga0207681_100215242 | 554 |
| 552 | 3300025931 | Ga0207644_10006370 | Ga0207644_100063702 | 554 |
| 553 | 3300025932 | Ga0207690_10052614 | Ga0207690_100526142 | 554 |
| 554 | 3300025938 | Ga0207704_10038696 | Ga0207704_100386962 | 554 |
| 555 | 3300025939 | Ga0207665_10050882 | Ga0207665_100508821 | 554 |
| 556 | 3300026041 | Ga0207639_10013959 | Ga0207639_100139593 | 554 |
| 557 | 3300026088 | Ga0207641_10028618 | Ga0207641_100286184 | 554 |
| 558 | 3300026089 | Ga0207648_10011919 | Ga0207648_100119194 | 554 |
| 559 | 3300026089 | Ga0207648_10029742 | Ga0207648_100297423 | 554 |
| 560 | 3300026116 | Ga0207674_10073574 | Ga0207674_100735742 | 554 |
| 561 | 3300027695 | Ga0209966_1004075 | Ga0209966_10040752 | 554 |
| 562 | 3300027717 | Ga0209998_10002323 | Ga0209998_100023232 | 554 |
| 563 | 3300028381 | Ga0268264_10032869 | Ga0268264_100328692 | 554 |
| 564 | 3300034816 | Ga0373930_0000038 | Ga0373930_0000038_928_2673 | 554 |
| 565 | 3300034816 | Ga0373930_0001662 | Ga0373930_0001662_1540_3288 | 554 |
| 566 | 3300034819 | Ga0373958_0001557 | Ga0373958_0001557_1145_2890 | 554 |
| 567 | 3300035085 | Ga0373929_0000817 | Ga0373929_0000817_1321_3066 | 554 |
| 568 | 3300035090 | Ga0373949_0004740 | Ga0373949_0004740_1161_2906 | 554 |
| 569 | 3300035091 | Ga0373951_0000716 | Ga0373951_0000716_831_2576 | 554 |
| 570 | 3300035092 | Ga0373952_0000990 | Ga0373952_0000990_2194_3939 | 554 |
| 571 | 3300035111 | Ga0373923_0009454 | Ga0373923_0009454_741_2492 | 554 |
| 572 | 3300035112 | Ga0373932_0001709 | Ga0373932_0001709_3087_4832 | 554 |
| 573 | 3300035115 | Ga0373941_0000068 | Ga0373941_0000068_4020_5765 | 554 |
| 574 | 3300035116 | Ga0373945_0018842 | Ga0373945_0018842_555_2306 | 554 |
| 575 | 3300035241 | Ga0373961_0002126 | Ga0373961_0002126_1341_3086 | 554 |
| 576 | 3300035691 | Ga0373931_0005344 | Ga0373931_0005344_1852_3597 | 554 |
| 577 | 3300037466 | Ga0395898_0098670 | Ga0395898_0098670_642_2393 | 554 |
| 578 | 3300042876 | Ga0451577_0092380 | Ga0451577_0092380_40_1785 | 554 |
| 579 | 3300044712 | Ga0453684_0040132 | Ga0453684_0040132_4181_5926 | 554 |
| 580 | 3300046683 | Ga0495658_0027228 | Ga0495658_0027228_436_2190 | 554 |
| 581 | 3300047673 | Ga0495593_0048226 | Ga0495593_0048226_53_1807 | 554 |
| 582 | 3300048903 | Ga0496100_0013789 | Ga0496100_0013789_2369_4120 | 554 |
| 583 | 3300048904 | Ga0496101_0020557 | Ga0496101_0020557_2125_3876 | 554 |
| 584 | 3300048905 | Ga0496102_0002271 | Ga0496102_0002271_10362_12113 | 554 |
| 585 | 3300048906 | Ga0496103_0017655 | Ga0496103_0017655_196_1947 | 554 |
| 586 | 3300048907 | Ga0496104_0012436 | Ga0496104_0012436_193_1944 | 554 |
| 587 | 3300048907 | Ga0496104_0015322 | Ga0496104_0015322_2566_4317 | 554 |
| 588 | 3300048908 | Ga0496105_0003826 | Ga0496105_0003826_3660_5411 | 554 |
| 589 | 3300048908 | Ga0496105_0009918 | Ga0496105_0009918_3180_4931 | 554 |
| 590 | 3300048909 | Ga0496106_0005133 | Ga0496106_0005133_3074_4825 | 554 |
| 591 | 3300048909 | Ga0496106_0012771 | Ga0496106_0012771_1005_2756 | 554 |
| 592 | 3300048911 | Ga0496108_0001839 | Ga0496108_0001839_4526_6277 | 554 |
| 593 | 3300048912 | Ga0496109_0002227 | Ga0496109_0002227_9948_11699 | 554 |
| 594 | 3300048912 | Ga0496109_0007062 | Ga0496109_0007062_2329_4080 | 554 |
| 595 | 3300048913 | Ga0496110_0015136 | Ga0496110_0015136_2801_4552 | 554 |
| 596 | 3300048914 | Ga0496111_0001439 | Ga0496111_0001439_10937_12688 | 554 |
| 597 | 3300048915 | Ga0496112_0003174 | Ga0496112_0003174_8253_10004 | 554 |
| 598 | 3300048915 | Ga0496112_0031932 | Ga0496112_0031932_806_2557 | 554 |
| 599 | 3300048916 | Ga0496113_0000771 | Ga0496113_0000771_4526_6277 | 554 |
| 600 | 3300048916 | Ga0496113_0003775 | Ga0496113_0003775_1715_3466 | 554 |
| 601 | 3300048917 | Ga0496114_0011776 | Ga0496114_0011776_4401_6152 | 554 |
| 602 | 3300048918 | Ga0496115_0011186 | Ga0496115_0011186_3312_5063 | 554 |
| 603 | 3300049571 | Ga0501034_0017969 | Ga0501034_0017969_802_2550 | 554 |
| 604 | 3300049572 | Ga0501036_0022350 | Ga0501036_0022350_3068_4816 | 554 |
| 605 | 3300049579 | Ga0501043_0089856 | Ga0501043_0089856_524_2272 | 554 |
| 606 | 3300049580 | Ga0501046_0005718 | Ga0501046_0005718_5178_6926 | 554 |
| 607 | 3300049585 | Ga0501069_0003111 | Ga0501069_0003111_902_2650 | 554 |
| 608 | 3300049586 | Ga0501070_0069791 | Ga0501070_0069791_321_2069 | 554 |
| 609 | 3300049823 | Ga0501044_0000255 | Ga0501044_0000255_13850_15598 | 554 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qha-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.8008 | 8 | 554 |
| 7qha-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7973 | 8 | 554 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.7887 | 4 | 549 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.6133 | 4 | 549 |
| 4r1i-assembly1.cif.gz_B | structure and function of neisseria gonorrhoeae mtrf illuminates a class of antimetabolite efflux pumps | 0.5424 | 28 | 540 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5M826_5_184_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3987 | 445 | 541 | 1.20.140.150 |
| af_I1JGF3_289_398_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3799 | 109 | 211 | 1.25.40.10 |
| af_I1JGF3_289_398_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3497 | 109 | 211 | 1.25.40.10 |
| af_A0A178VGS0_23_184_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3218 | 440 | 554 | 1.20.140.150 |
| af_A0A1D6JII9_349_496_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.2911 | 410 | 525 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A455U2G7-F1-model_v4 | TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein | 0.9434 | 57 | 217 |
GO:0005886
GO:0022857 |
| AF-A0A355U8U4-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.919 | 1 | 219 |
GO:0005886
GO:0022857 |
| AF-A0A7Y2Z9L8-F1-model_v4 | TRAP transporter large permease subunit | 0.9009 | 68 | 217 |
GO:0005886
GO:0022857 |
| AF-A0A3M1KBV6-F1-model_v4 | TRAP transporter large permease subunit | 0.897 | 6 | 221 |
GO:0005886
GO:0022857 |
| AF-A0A2N3CJI4-F1-model_v4 | C4-dicarboxylate ABC transporter permease | 0.8831 | 54 | 221 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar