F468878

General Info

Members Datasets Scaffolds Average Seq Length
609 384 548 574

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10002133|Ga0207428_1000213317
Length 689
Sequence MSDPLLGLSMLALIVAAIMMGFPTAFTMMGLGMFFGYLAFWDPASHHWLDNQIFDLMVQRTYGVMNNDTLLSIPLFVFMGYIIERAALVDKMFFSVQLAFRRLPASLAVTTLLVCAFWGIASGIVGAVVVLMGVIAMRPMLKAGYDVRLASGVITAGGTLGILIPPSVMIIVYAAVAGQSIVKLYAAAMLPGFFLTFLYLVYIIGWAMLNPKIAPKLGEDEFRITVPAWLTKVERGPSRRVFVGLLQALFRPGMLKATIRPDGLAVDYPFILKNVFSLLVPAGLVVALFHNAAPVDVQPGSAISERTAQAPQSTESTKPALPEAQPQAPGGSAEQPELSSSEASTPDPAVKEEGPPEQVGMEVQERNEALGRIPENFYAWFWGLALLSAIVVFIYYWRLDGEHFEILKLLESSVVPLGVLTFIVLAVILFGITTATESAGVGALGAMYLAGYSKYPHRVLWSSLVGVIDVATLIVSGSLGGVFLGTFVPWLWDFATRRQLLQNLKESTFLTAKTTAMVCWLFVGSALFSAVFALHGGQGIIERWVLSLNMTPVQFLLLSQAIIFFLGWPLEWTEIIVIFIPXXXXLLAHFNVDPVLFGTMVAVNLQAAFLSPPVAMSAFYLKGVSPPHVTLNQIFAGMMPYMLIVILCLVCMYIWPGMTLWLPNFLVWELMPLRDPVREFRSSRWLLFS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
8 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
9 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
10 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
11 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
12 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
13 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
14 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
15 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
16 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
17 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
18 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
19 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
20 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
21 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
22 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
23 2643221618 Ensifer sp. Root231 Isolate Unclassified
24 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
25 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
26 2643221655 Ensifer sp. Root1252 Isolate Unclassified
27 2643221659 Ensifer sp. Root127 Isolate Unclassified
28 2643221712 Ensifer sp. Root258 Isolate Unclassified
29 2643221723 Ensifer sp. Root278 Isolate Unclassified
30 2643221733 Bosea sp. Root381 Isolate Unclassified
31 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
32 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
33 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
34 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
35 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
36 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
37 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
38 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
39 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
40 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
41 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
42 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
43 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
44 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
45 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
46 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
47 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
48 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
49 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
50 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
51 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
52 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
53 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
54 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
55 2928070936 Variovorax gossypii 1167 Isolate Unclassified
56 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
57 2996887358 Rhizobium sp. R711 Isolate Nodule
58 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
59 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
60 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
61 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
62 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
63 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
64 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
65 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
66 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
67 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
68 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
69 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
70 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
71 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
75 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
76 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
77 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
78 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
79 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
80 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
81 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
84 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
85 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
86 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
87 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
88 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
89 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
90 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
91 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
92 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
93 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
94 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
95 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
96 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
97 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
98 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
99 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
100 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
101 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
102 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
103 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
104 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
112 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
113 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
116 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
117 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
118 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
119 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
140 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
141 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
142 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
143 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
144 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
145 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
147 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
148 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
149 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
150 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
151 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
152 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
153 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
154 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
156 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
157 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
158 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
160 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
161 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
168 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
176 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
177 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
178 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
179 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
182 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
183 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
190 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
235 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
236 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
237 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
238 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
239 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
247 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
248 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
255 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
256 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
257 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
258 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
259 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
260 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
261 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
262 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
263 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
264 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
267 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
268 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
269 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
271 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
273 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
274 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
275 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
298 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
299 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
349 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
350 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
351 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
352 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
353 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
354 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
358 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
364 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
365 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
368 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
369 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
370 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
371 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
372 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
373 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
374 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
375 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
376 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
377 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
378 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
380 8005258706 Rhizobium sp. R693 Isolate Nodule
381 8005321885 Rhizobium sp. R72 Isolate Nodule
382 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
383 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
384 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.98
Metatranscriptomes 0
Isolates 10.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.88
Nodule 5.42
Rhizoplane 7.55
Rhizosphere 58.13
Stem 0
Stem Tuber 0
Unclassified 10.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_531915 2162886007 Bacteria 2322
2 2214828545 2209111006 Bacteria 9090
3 ARcpr5oldR_c001419 3300000041 Bacteria 2416
4 ARSoilYngRDRAFT_c00204 3300000042 Bacteria 9917
5 ARcpr5yngRDRAFT_c001717 3300000043 Bacteria 2360
6 ARSoilOldRDRAFT_c000097 3300000044 Bacteria 16585
7 ARCol0oldRDRAFT_c00920 3300000045 Bacteria 2296
8 ARCol0yngRDRAFT_1000138 3300000652 Bacteria 12930
9 JGI24750J21931_1000071 3300002070 Bacteria 14849
10 JGI24749J21850_1000123 3300002076 Bacteria 13152
11 JGI24751J29686_10006799 3300002459 Bacteria 2331
12 JGI25158J39367_1001450 3300002739 Bacteria 4148
13 JGI25159J45721_1000004 3300002987 Bacteria 215789
14 JGI25151J46595_10000246 3300003187 Bacteria 63372
15 JGI25406J46586_10000160 3300003203 Bacteria 30150
16 JGI25153J46596_10001104 3300003215 Bacteria 16391
17 JGI25160J50197_1000021 3300003354 Bacteria 215789
18 JGI25161J50226_1000218 3300003374 Bacteria 36216
19 Ga0055526_1001422 3300003771 Bacteria 17040
20 Ga0055536_1000269 3300003781 Bacteria 39889
21 Ga0055536_1000891 3300003781 Bacteria 19442
22 Ga0055528_1001600 3300003790 Bacteria 13383
23 Ga0055530_10002560 3300003791 Bacteria 11547
24 Ga0055540_1001142 3300003792 Bacteria 16576
25 Ga0055540_1003959 3300003792 Bacteria 6912
26 Ga0055531_10000158 3300003794 Bacteria 77918
27 Ga0055531_10000586 3300003794 Bacteria 31786
28 Ga0055531_10008595 3300003794 Bacteria 5354
29 Ga0055543_1000164 3300004625 Bacteria 55304
30 Ga0065165_1000033 3300005262 Bacteria 215827
31 Ga0065716_1001798 3300005277 Bacteria 3364
32 Ga0065704_10090917 3300005289 Bacteria 2755
33 Ga0070683_100041220 3300005329 Bacteria 4246
34 Ga0070683_100079642 3300005329 Bacteria 3066
35 Ga0070690_100019176 3300005330 Bacteria 4146
36 Ga0070670_100002410 3300005331 Bacteria 15422
37 Ga0070670_100017353 3300005331 Bacteria 6174
38 Ga0070670_100093816 3300005331 Bacteria 2581
39 Ga0068869_100003935 3300005334 Bacteria 9173
40 Ga0070680_100040428 3300005336 Bacteria 3776
41 Ga0070682_100000567 3300005337 Bacteria 22786
42 Ga0068868_100024412 3300005338 Bacteria 4586
43 Ga0068868_100043264 3300005338 Bacteria 3517
44 Ga0070689_100014581 3300005340 Bacteria 5712
45 Ga0070689_100041356 3300005340 Bacteria 3538
46 Ga0070669_100021219 3300005353 Bacteria 4641
47 Ga0070671_100006687 3300005355 Bacteria 9221
48 Ga0070671_100020002 3300005355 Bacteria 5454
49 Ga0070674_100028198 3300005356 Bacteria 3686
50 Ga0070674_100095080 3300005356 Bacteria 2159
51 Ga0070673_100050061 3300005364 Bacteria 3264
52 Ga0070688_100011433 3300005365 Bacteria 4931
53 Ga0070659_100102796 3300005366 Bacteria 2301
54 Ga0070667_100056670 3300005367 Bacteria 3311
55 Ga0070667_100115840 3300005367 Bacteria 2328
56 Ga0070667_100144311 3300005367 Bacteria 2087
57 Ga0070714_100007553 3300005435 Bacteria 8464
58 Ga0070714_100019726 3300005435 Bacteria 5498
59 Ga0070714_100133451 3300005435 Bacteria 2221
60 Ga0070713_100014064 3300005436 Bacteria 5927
61 Ga0070713_100034469 3300005436 Bacteria 4067
62 Ga0070711_100059328 3300005439 Bacteria 2656
63 Ga0070700_100005882 3300005441 Bacteria 6518
64 Ga0070700_100059602 3300005441 Bacteria 2403
65 Ga0070708_100000133 3300005445 Bacteria 50894
66 Ga0070663_100000390 3300005455 Bacteria 23042
67 Ga0070678_100019298 3300005456 Bacteria 4441
68 Ga0070678_100035561 3300005456 Bacteria 3479
69 Ga0070681_10004361 3300005458 Bacteria 13455
70 Ga0070681_10004989 3300005458 Bacteria 12780
71 Ga0070681_10069587 3300005458 Bacteria 3486
72 Ga0070681_10077642 3300005458 Bacteria 3278
73 Ga0070681_10080534 3300005458 Bacteria 3212
74 Ga0068867_100062697 3300005459 Bacteria 2762
75 Ga0070685_10007824 3300005466 Bacteria 5470
76 Ga0070698_100001905 3300005471 Bacteria 23252
77 Ga0070698_100016038 3300005471 Bacteria 7912
78 Ga0070698_100125871 3300005471 Bacteria 2520
79 Ga0070679_100001064 3300005530 Bacteria 23969
80 Ga0070679_100004826 3300005530 Bacteria 12433
81 Ga0070679_100029327 3300005530 Bacteria 5429
82 Ga0070679_100033406 3300005530 Bacteria 5094
83 Ga0070684_100045196 3300005535 Bacteria 3813
84 Ga0070697_100009294 3300005536 Bacteria 7683
85 Ga0068853_100004009 3300005539 Bacteria 11323
86 Ga0068853_100042938 3300005539 Bacteria 3867
87 Ga0068853_100060831 3300005539 Bacteria 3264
88 Ga0070672_100015332 3300005543 Bacteria 5454
89 Ga0070672_100017060 3300005543 Bacteria 5216
90 Ga0070672_100017477 3300005543 Bacteria 5164
91 Ga0070695_100005491 3300005545 Bacteria 7468
92 Ga0070696_100017960 3300005546 Bacteria 4777
93 Ga0070665_100002577 3300005548 Bacteria 19865
94 Ga0070665_100013258 3300005548 Bacteria 8301
95 Ga0068855_100025032 3300005563 Bacteria 7144
96 Ga0068855_100045298 3300005563 Bacteria 5202
97 Ga0068855_100113648 3300005563 Bacteria 3106
98 Ga0068855_100146993 3300005563 Bacteria 2682
99 Ga0068857_100029996 3300005577 Bacteria 4799
100 Ga0068856_100022824 3300005614 Bacteria 6085
101 Ga0068856_100030872 3300005614 Bacteria 5240
102 Ga0068856_100034496 3300005614 Bacteria 4956
103 Ga0070702_100007354 3300005615 Bacteria 5269
104 Ga0068859_100031914 3300005617 Bacteria 5291
105 Ga0068859_100049927 3300005617 Bacteria 4203
106 Ga0068859_100066070 3300005617 Bacteria 3651
107 Ga0068864_100004280 3300005618 Bacteria 11735
108 Ga0068864_100013488 3300005618 Bacteria 6775
109 Ga0068864_100013717 3300005618 Bacteria 6722
110 Ga0068864_100025475 3300005618 Bacteria 4982
111 Ga0068864_100040947 3300005618 Bacteria 3962
112 Ga0068866_10042525 3300005718 Bacteria 2261
113 Ga0068861_100073057 3300005719 Bacteria 2663
114 Ga0068863_100008635 3300005841 Bacteria 9954
115 Ga0068858_100022251 3300005842 Bacteria 5919
116 Ga0068858_100036326 3300005842 Bacteria 4568
117 Ga0068858_100081487 3300005842 Bacteria 3008
118 Ga0068860_100028824 3300005843 Bacteria 5342
119 Ga0068860_100030330 3300005843 Bacteria 5202
120 Ga0068862_100048026 3300005844 Bacteria 3643
121 Ga0081455_10018535 3300005937 Bacteria 6625
122 Ga0081455_10061387 3300005937 Bacteria 3163
123 Ga0081540_1000922 3300005983 Bacteria 26453
124 Ga0081540_1001425 3300005983 Bacteria 20682
125 Ga0081540_1003997 3300005983 Bacteria 11434
126 Ga0081539_10000040 3300005985 Bacteria 292753
127 Ga0081539_10004392 3300005985 Bacteria 15647
128 Ga0081539_10027315 3300005985 Bacteria 3618
129 Ga0070717_10047682 3300006028 Bacteria 3511
130 Ga0070717_10088575 3300006028 Bacteria 2609
131 Ga0075365_10005063 3300006038 Bacteria 7072
132 Ga0075365_10010896 3300006038 Bacteria 5323
133 Ga0075368_10004400 3300006042 Bacteria 4775
134 Ga0075368_10013178 3300006042 Bacteria 3033
135 Ga0075363_100001360 3300006048 Bacteria 9194
136 Ga0075363_100040709 3300006048 Bacteria 2449
137 Ga0075364_10004279 3300006051 Bacteria 8197
138 Ga0075364_10010428 3300006051 Bacteria 5613
139 Ga0075432_10006475 3300006058 Bacteria 3984
140 Ga0070712_100060996 3300006175 Bacteria 2663
141 Ga0075362_10002395 3300006177 Bacteria 6279
142 Ga0075367_10000458 3300006178 Bacteria 15161
143 Ga0075367_10001100 3300006178 Bacteria 11173
144 Ga0075367_10001562 3300006178 Bacteria 9899
145 Ga0075367_10005385 3300006178 Bacteria 6347
146 Ga0075367_10026557 3300006178 Bacteria 3285
147 Ga0075367_10046031 3300006178 Bacteria 2562
148 Ga0075367_10050199 3300006178 Bacteria 2462
149 Ga0075369_10003922 3300006186 Bacteria 5455
150 Ga0075369_10005721 3300006186 Bacteria 4665
151 Ga0075366_10002532 3300006195 Bacteria 9394
152 Ga0075366_10017650 3300006195 Bacteria 4110
153 Ga0075366_10029899 3300006195 Bacteria 3201
154 Ga0097621_100003286 3300006237 Bacteria 11119
155 Ga0097621_100047178 3300006237 Bacteria 3490
156 Ga0075370_10013050 3300006353 Bacteria 4408
157 Ga0075370_10014550 3300006353 Bacteria 4200
158 Ga0075370_10022157 3300006353 Bacteria 3485
159 Ga0075370_10024557 3300006353 Bacteria 3330
160 Ga0075428_100002073 3300006844 Bacteria 21627
161 Ga0075430_100000192 3300006846 Bacteria 41250
162 Ga0075431_100019202 3300006847 Bacteria 6966
163 Ga0075434_100038462 3300006871 Bacteria 4739
164 Ga0075434_100067360 3300006871 Bacteria 3567
165 Ga0075434_100073983 3300006871 Bacteria 3400
166 Ga0075434_100092148 3300006871 Bacteria 3032
167 Ga0075429_100041037 3300006880 Bacteria 4030
168 Ga0068865_100016167 3300006881 Bacteria 4768
169 Ga0068865_100083388 3300006881 Bacteria 2301
170 Ga0075436_100002869 3300006914 Bacteria 11811
171 Ga0075436_100006942 3300006914 Bacteria 7748
172 Ga0075436_100017707 3300006914 Bacteria 4877
173 Ga0097620_100031914 3300006931 Bacteria 5291
174 Ga0097620_100049926 3300006931 Bacteria 4203
175 Ga0097620_100066069 3300006931 Bacteria 3651
176 Ga0099823_1022458 3300006944 Bacteria 5837
177 Ga0099795_10004985 3300007788 Bacteria 3485
178 Ga0105240_10011902 3300009093 Bacteria 12070
179 Ga0111539_10011469 3300009094 Bacteria 11123
180 Ga0111539_10021244 3300009094 Bacteria 7992
181 Ga0111539_10097380 3300009094 Bacteria 3456
182 Ga0105245_10128425 3300009098 Bacteria 2375
183 Ga0105247_10010927 3300009101 Bacteria 5484
184 Ga0114129_10010074 3300009147 Bacteria 13473
185 Ga0114129_10035342 3300009147 Bacteria 7059
186 Ga0114129_10035914 3300009147 Bacteria 6998
187 Ga0105243_10014028 3300009148 Bacteria 6065
188 Ga0105243_10018411 3300009148 Bacteria 5290
189 Ga0105242_10001652 3300009176 Bacteria 17627
190 Ga0105242_10035792 3300009176 Bacteria 3981
191 Ga0105248_10003122 3300009177 Bacteria 18333
192 Ga0105248_10060607 3300009177 Bacteria 4248
193 Ga0105237_10004886 3300009545 Bacteria 15354
194 Ga0105238_10005134 3300009551 Bacteria 12941
195 Ga0105238_10007610 3300009551 Bacteria 10852
196 Ga0105249_10022878 3300009553 Bacteria 5602
197 Ga0123342_1003939 3300009766 Bacteria 23272
198 Ga0105239_10008583 3300010375 Bacteria 11589
199 Ga0105239_10016888 3300010375 Bacteria 8066
200 Ga0157373_10015870 3300013100 Bacteria 5499
201 Ga0157370_10008445 3300013104 Bacteria 11109
202 Ga0157370_10147726 3300013104 Bacteria 2188
203 Ga0157369_10002895 3300013105 Bacteria 20503
204 Ga0157369_10008444 3300013105 Bacteria 11815
205 Ga0157369_10065123 3300013105 Bacteria 3924
206 Ga0157374_10016908 3300013296 Bacteria 6420
207 Ga0157374_10033492 3300013296 Bacteria 4687
208 Ga0157378_10056200 3300013297 Bacteria 3507
209 Ga0157372_10031877 3300013307 Bacteria 5776
210 Ga0157372_10060311 3300013307 Bacteria 4245
211 Ga0157375_10037213 3300013308 Bacteria 4660
212 Ga0157375_10061079 3300013308 Bacteria 3740
213 Ga0157375_10116382 3300013308 Bacteria 2777
214 Ga0163163_10090922 3300014325 Bacteria 3066
215 Ga0157380_10010872 3300014326 Bacteria 6563
216 Ga0157380_10035779 3300014326 Bacteria 3837
217 Ga0183362_10005 3300015683 Bacteria 437616
218 Ga0163161_10002473 3300017792 Bacteria 13182
219 Ga0228711_1002116 3300022739 Bacteria 30198
220 Ga0228710_1011349 3300022740 Bacteria 11539
221 Ga0209436_103264 3300025208 Bacteria 4385
222 Ga0209673_1001841 3300025273 Bacteria 17324
223 Ga0209130_1000017 3300025284 Bacteria 388431
224 Ga0209130_1000591 3300025284 Bacteria 35327
225 Ga0209676_1000873 3300025292 Bacteria 38608
226 Ga0209676_1000876 3300025292 Bacteria 38530
227 Ga0209025_1000161 3300025294 Bacteria 166506
228 Ga0209025_1000265 3300025294 Bacteria 123182
229 Ga0209025_1014259 3300025294 Bacteria 4909
230 Ga0209025_1016031 3300025294 Bacteria 4461
231 Ga0209564_1000013 3300025295 Bacteria 775755
232 Ga0209564_1001504 3300025295 Bacteria 23379
233 Ga0209564_1002751 3300025295 Bacteria 13218
234 Ga0209758_1000628 3300025297 Bacteria 54130
235 Ga0209758_1002358 3300025297 Bacteria 19467
236 Ga0209758_1006011 3300025297 Bacteria 8968
237 Ga0209758_1011107 3300025297 Bacteria 5265
238 Ga0209050_1000759 3300025298 Bacteria 46447
239 Ga0209050_1002190 3300025298 Bacteria 17613
240 Ga0209256_1002058 3300025299 Bacteria 17780
241 Ga0209256_1004740 3300025299 Bacteria 8313
242 Ga0207426_1000006 3300025302 Bacteria 1025969
243 Ga0207426_1000287 3300025302 Bacteria 100566
244 Ga0209051_1000315 3300025303 Bacteria 73579
245 Ga0209051_1000773 3300025303 Bacteria 33955
246 Ga0209051_1003896 3300025303 Bacteria 9525
247 Ga0209051_1006359 3300025303 Bacteria 6683
248 Ga0209051_1007350 3300025303 Bacteria 6041
249 Ga0209257_1000061 3300025304 Bacteria 367698
250 Ga0209257_1000309 3300025304 Bacteria 104166
251 Ga0209257_1006709 3300025304 Bacteria 7278
252 Ga0207692_10045290 3300025898 Bacteria 2200
253 Ga0207688_10042184 3300025901 Bacteria 2540
254 Ga0207647_10015046 3300025904 Bacteria 5318
255 Ga0207647_10057132 3300025904 Bacteria 2393
256 Ga0207645_10017396 3300025907 Bacteria 4746
257 Ga0207645_10025420 3300025907 Bacteria 3831
258 Ga0207643_10030254 3300025908 Bacteria 3012
259 Ga0207643_10036424 3300025908 Bacteria 2759
260 Ga0207684_10038233 3300025910 Bacteria 4072
261 Ga0207684_10042982 3300025910 Bacteria 3831
262 Ga0207707_10002780 3300025912 Bacteria 15612
263 Ga0207707_10016874 3300025912 Bacteria 6360
264 Ga0207695_10004829 3300025913 Bacteria 18197
265 Ga0207671_10012628 3300025914 Bacteria 6784
266 Ga0207671_10036566 3300025914 Bacteria 3642
267 Ga0207693_10037698 3300025915 Bacteria 3810
268 Ga0207663_10020266 3300025916 Bacteria 3763
269 Ga0207663_10090076 3300025916 Bacteria 2033
270 Ga0207662_10015709 3300025918 Bacteria 4263
271 Ga0207652_10012067 3300025921 Bacteria 6975
272 Ga0207652_10016979 3300025921 Bacteria 5954
273 Ga0207652_10050807 3300025921 Bacteria 3553
274 Ga0207646_10043993 3300025922 Bacteria 4008
275 Ga0207681_10021524 3300025923 Bacteria 4100
276 Ga0207681_10060735 3300025923 Bacteria 2596
277 Ga0207694_10082520 3300025924 Bacteria 2527
278 Ga0207687_10087839 3300025927 Bacteria 2260
279 Ga0207700_10024746 3300025928 Bacteria 4160
280 Ga0207644_10006370 3300025931 Bacteria 7687
281 Ga0207644_10014326 3300025931 Bacteria 5305
282 Ga0207690_10052614 3300025932 Bacteria 2728
283 Ga0207706_10028017 3300025933 Bacteria 5033
284 Ga0207706_10033719 3300025933 Bacteria 4555
285 Ga0207709_10000497 3300025935 Bacteria 35233
286 Ga0207670_10038227 3300025936 Bacteria 3134
287 Ga0207669_10025556 3300025937 Bacteria 3194
288 Ga0207704_10038696 3300025938 Bacteria 2769
289 Ga0207665_10050882 3300025939 Bacteria 2787
290 Ga0207691_10001616 3300025940 Bacteria 22379
291 Ga0207691_10007860 3300025940 Bacteria 10272
292 Ga0207691_10020845 3300025940 Bacteria 6194
293 Ga0207691_10025838 3300025940 Bacteria 5511
294 Ga0207711_10041464 3300025941 Bacteria 3920
295 Ga0207667_10012495 3300025949 Bacteria 9776
296 Ga0207639_10013959 3300026041 Bacteria 5637
297 Ga0207639_10062849 3300026041 Bacteria 2873
298 Ga0207678_10003222 3300026067 Bacteria 14749
299 Ga0207678_10062852 3300026067 Bacteria 3191
300 Ga0207708_10004713 3300026075 Bacteria 10029
301 Ga0207708_10020468 3300026075 Bacteria 4989
302 Ga0207641_10028618 3300026088 Bacteria 4605
303 Ga0207648_10011919 3300026089 Bacteria 8164
304 Ga0207648_10029742 3300026089 Bacteria 4844
305 Ga0207648_10049421 3300026089 Bacteria 3680
306 Ga0207648_10085947 3300026089 Bacteria 2744
307 Ga0207676_10004233 3300026095 Bacteria 10135
308 Ga0207676_10039058 3300026095 Bacteria 3628
309 Ga0207674_10025674 3300026116 Bacteria 6274
310 Ga0207674_10060152 3300026116 Bacteria 3843
311 Ga0207674_10073574 3300026116 Bacteria 3430
312 Ga0207675_100016991 3300026118 Bacteria 6798
313 Ga0207675_100060081 3300026118 Bacteria 3548
314 Ga0207683_10036564 3300026121 Bacteria 4277
315 Ga0207698_10075114 3300026142 Bacteria 2699
316 Ga0207698_10086126 3300026142 Bacteria 2554
317 Ga0209281_1000106 3300027111 Bacteria 219666
318 Ga0209389_1000062 3300027296 Bacteria 102842
319 Ga0209489_100160 3300027361 Bacteria 102842
320 Ga0209700_102603 3300027363 Bacteria 36098
321 Ga0209282_1000083 3300027666 Bacteria 70247
322 Ga0209966_1004075 3300027695 Bacteria 2469
323 Ga0209998_10002323 3300027717 Bacteria 4395
324 Ga0209813_10000917 3300027866 Bacteria 6637
325 Ga0207428_10002133 3300027907 Bacteria 19893
326 Ga0207428_10022909 3300027907 Bacteria 5262
327 Ga0268266_10000680 3300028379 Bacteria 45937
328 Ga0268266_10001248 3300028379 Bacteria 31070
329 Ga0268266_10010351 3300028379 Bacteria 8158
330 Ga0268264_10027442 3300028381 Bacteria 4652
331 Ga0268264_10032869 3300028381 Bacteria 4258
332 Ga0307515_10000013 3300028794 Bacteria 568456
333 Ga0307515_10000037 3300028794 Bacteria 331970
334 Ga0307515_10008845 3300028794 Bacteria 19552
335 Ga0307515_10014764 3300028794 Bacteria 14449
336 Ga0307511_10000948 3300030521 Bacteria 30775
337 Ga0307512_10038502 3300030522 Bacteria 4021
338 Ga0265325_10002896 3300031241 Bacteria 11436
339 Ga0307513_10000034 3300031456 Bacteria 185012
340 Ga0307513_10012252 3300031456 Bacteria 10601
341 Ga0307513_10015642 3300031456 Bacteria 9184
342 Ga0307509_10022123 3300031507 Bacteria 7177
343 Ga0307408_100000012 3300031548 Bacteria 408153
344 Ga0307516_10000348 3300031730 Bacteria 60054
345 Ga0307516_10005411 3300031730 Bacteria 15306
346 Ga0307516_10008644 3300031730 Bacteria 11485
347 Ga0307516_10061229 3300031730 Bacteria 3653
348 Ga0307406_10023282 3300031901 Bacteria 3683
349 Ga0315914_1002550 3300031967 Bacteria 27863
350 Ga0307510_10025874 3300033180 Bacteria 6760
351 Ga0315913_1001274 3300033430 Bacteria 27225
352 Ga0315911_1000017 3300033442 Bacteria 161609
353 Ga0315915_1000010 3300033464 Bacteria 240214
354 Ga0373930_0000038 3300034816 Bacteria 11756
355 Ga0373930_0001662 3300034816 Bacteria 3364
356 Ga0373948_0000018 3300034817 Bacteria 21496
357 Ga0373958_0000988 3300034819 Bacteria 3708
358 Ga0373958_0001557 3300034819 Bacteria 3102
359 Ga0373938_0000127 3300034957 Bacteria 10712
360 Ga0373928_0000406 3300035084 Bacteria 8570
361 Ga0373929_0000817 3300035085 Bacteria 6064
362 Ga0373934_0001121 3300035086 Bacteria 9730
363 Ga0373949_0004740 3300035090 Bacteria 3085
364 Ga0373951_0000716 3300035091 Bacteria 9106
365 Ga0373952_0000990 3300035092 Bacteria 5180
366 Ga0373952_0010616 3300035092 Bacteria 1783
367 Ga0373923_0009454 3300035111 Bacteria 3518
368 Ga0373932_0001709 3300035112 Bacteria 5971
369 Ga0373936_0038125 3300035113 Bacteria 1921
370 Ga0373941_0000068 3300035115 Bacteria 16268
371 Ga0373945_0018842 3300035116 Bacteria 2351
372 Ga0373954_0000001 3300035118 Bacteria 158201
373 Ga0373954_0026273 3300035118 Bacteria 2668
374 Ga0373956_0000103 3300035119 Bacteria 29146
375 Ga0373942_0008604 3300035207 Bacteria 2381
376 Ga0373961_0002126 3300035241 Bacteria 5252
377 Ga0373931_0000387 3300035691 Bacteria 18089
378 Ga0373931_0005344 3300035691 Bacteria 5928
379 Ga0373931_0005744 3300035691 Bacteria 5763
380 Ga0373933_0000811 3300035724 Bacteria 19056
381 Ga0373937_0000769 3300036401 Bacteria 27707
382 Ga0373937_0005181 3300036401 Bacteria 11122
383 Ga0373937_0018405 3300036401 Bacteria 6239
384 Ga0373937_0103756 3300036401 Bacteria 2641
385 Ga0395899_0007150 3300037312 Bacteria 8637
386 Ga0395899_0012066 3300037312 Bacteria 6619
387 Ga0395899_0071757 3300037312 Bacteria 2534
388 Ga0395900_0049257 3300037418 Bacteria 4340
389 Ga0395900_0067255 3300037418 Bacteria 3681
390 Ga0395898_0008307 3300037466 Bacteria 10976
391 Ga0395898_0018064 3300037466 Bacteria 7194
392 Ga0395898_0098670 3300037466 Bacteria 2805
393 Ga0395905_0011762 3300037471 Bacteria 8448
394 Ga0395901_0001587 3300038443 Bacteria 23512
395 Ga0395901_0004166 3300038443 Bacteria 14593
396 Ga0395901_0051140 3300038443 Bacteria 4294
397 Ga0395901_0131342 3300038443 Bacteria 2631
398 Ga0451577_0092380 3300042876 Bacteria 2702
399 Ga0453683_0020949 3300044673 Bacteria 4175
400 Ga0453684_0040132 3300044712 Bacteria 6365
401 Ga0451576_0005540 3300045051 Bacteria 15773
402 Ga0495617_016482 3300046452 Bacteria 2499
403 Ga0495638_0024553 3300046460 Bacteria 3928
404 Ga0495651_0006045 3300046462 Bacteria 9240
405 Ga0495582_0028029 3300046473 Bacteria 3089
406 Ga0495584_0006643 3300046491 Bacteria 6047
407 Ga0495606_0006516 3300046507 Bacteria 10744
408 Ga0495608_0009334 3300046511 Bacteria 6860
409 Ga0495616_0019335 3300046513 Bacteria 3718
410 Ga0495628_0078737 3300046516 Bacteria 2563
411 Ga0495632_0031101 3300046519 Bacteria 2764
412 Ga0495645_0021487 3300046543 Bacteria 4662
413 Ga0495667_0009010 3300046559 Bacteria 6780
414 Ga0495656_0000081 3300046615 Bacteria 42254
415 Ga0495625_0008887 3300046660 Bacteria 8498
416 Ga0495661_0072885 3300046665 Bacteria 2002
417 Ga0495588_0003613 3300046674 Bacteria 6761
418 Ga0495599_0014731 3300046678 Bacteria 4842
419 Ga0495623_0023795 3300046679 Bacteria 3952
420 Ga0495658_0027228 3300046683 Bacteria 3073
421 Ga0495670_0006538 3300046691 Bacteria 5728
422 Ga0495671_0009334 3300046692 Bacteria 5480
423 Ga0495687_000606 3300047443 Bacteria 41890
424 Ga0495593_0048226 3300047673 Bacteria 2264
425 Ga0496100_0013789 3300048903 Bacteria 4675
426 Ga0496101_0020557 3300048904 Bacteria 4521
427 Ga0496102_0001355 3300048905 Bacteria 21922
428 Ga0496102_0002271 3300048905 Bacteria 16435
429 Ga0496103_0017655 3300048906 Bacteria 4271
430 Ga0496104_0000175 3300048907 Bacteria 56916
431 Ga0496104_0012436 3300048907 Bacteria 7653
432 Ga0496104_0015322 3300048907 Bacteria 6942
433 Ga0496104_0047774 3300048907 Bacteria 4034
434 Ga0496105_0002850 3300048908 Bacteria 12652
435 Ga0496105_0003826 3300048908 Bacteria 11229
436 Ga0496105_0009918 3300048908 Bacteria 7470
437 Ga0496106_0005133 3300048909 Bacteria 9702
438 Ga0496106_0012771 3300048909 Bacteria 6201
439 Ga0496106_0110020 3300048909 Bacteria 2144
440 Ga0496108_0001839 3300048911 Bacteria 16957
441 Ga0496108_0003952 3300048911 Bacteria 11907
442 Ga0496109_0002227 3300048912 Bacteria 16096
443 Ga0496109_0004749 3300048912 Bacteria 11355
444 Ga0496109_0007062 3300048912 Bacteria 9475
445 Ga0496109_0033573 3300048912 Bacteria 4617
446 Ga0496110_0007879 3300048913 Bacteria 8532
447 Ga0496110_0015136 3300048913 Bacteria 6413
448 Ga0496110_0036657 3300048913 Bacteria 4260
449 Ga0496110_0083061 3300048913 Bacteria 2857
450 Ga0496111_0000718 3300048914 Bacteria 17646
451 Ga0496111_0001439 3300048914 Bacteria 13586
452 Ga0496112_0003174 3300048915 Bacteria 13504
453 Ga0496112_0031932 3300048915 Bacteria 5110
454 Ga0496112_0057848 3300048915 Bacteria 3818
455 Ga0496112_0109029 3300048915 Bacteria 2739
456 Ga0496112_0132541 3300048915 Bacteria 2463
457 Ga0496113_0000771 3300048916 Bacteria 16510
458 Ga0496113_0003775 3300048916 Bacteria 9147
459 Ga0496113_0010705 3300048916 Bacteria 6076
460 Ga0496113_0099867 3300048916 Bacteria 2248
461 Ga0496114_0011776 3300048917 Bacteria 6998
462 Ga0496115_0011186 3300048918 Bacteria 6721
463 Ga0496115_0166726 3300048918 Bacteria 1821
464 Ga0496116_0001272 3300048919 Bacteria 29014
465 Ga0496117_0013319 3300048920 Bacteria 7185
466 Ga0496118_0035700 3300048921 Bacteria 4032
467 Ga0496121_0000214 3300048924 Bacteria 127349
468 Ga0496121_0000694 3300048924 Bacteria 62818
469 Ga0496121_0012225 3300048924 Bacteria 9404
470 Ga0496121_0013875 3300048924 Bacteria 8618
471 Ga0496123_0016827 3300048926 Bacteria 5911
472 Ga0496123_0048415 3300048926 Bacteria 2860
473 Ga0496124_0040798 3300048927 Bacteria 4011
474 Ga0496124_0045825 3300048927 Bacteria 3748
475 Ga0496125_0001342 3300048928 Bacteria 36252
476 Ga0496125_0011403 3300048928 Bacteria 8892
477 Ga0496125_0064200 3300048928 Bacteria 2920
478 Ga0496126_0007271 3300048929 Bacteria 12173
479 Ga0496126_0018999 3300048929 Bacteria 6787
480 Ga0496126_0107306 3300048929 Bacteria 2435
481 Ga0501034_0017969 3300049571 Bacteria 7254
482 Ga0501034_0021593 3300049571 Bacteria 6558
483 Ga0501036_0022350 3300049572 Bacteria 5319
484 Ga0501036_0055465 3300049572 Bacteria 3357
485 Ga0501038_0019980 3300049574 Bacteria 6030
486 Ga0501043_0089856 3300049579 Bacteria 2414
487 Ga0501046_0005718 3300049580 Bacteria 11095
488 Ga0501047_0021515 3300049581 Bacteria 6194
489 Ga0501069_0003111 3300049585 Bacteria 8504
490 Ga0501070_0069791 3300049586 Bacteria 2909
491 Ga0501073_0023082 3300049589 Bacteria 4472
492 Ga0501083_0013082 3300049744 Bacteria 5797
493 Ga0501035_0031856 3300049822 Bacteria 4801
494 Ga0501044_0000255 3300049823 Bacteria 67530
495 Ga0501044_0069528 3300049823 Bacteria 3584
496 Ga0501044_0115365 3300049823 Bacteria 2691
497 nmdc:mga03683_994_c1 3300050489 Bacteria 8286
498 nmdc:mga03n38_17384_c1 3300050490 Bacteria 2816
499 nmdc:mga03n38_7023_c1 3300050490 Bacteria 3958
500 nmdc:mga00v17_14927_c1 3300050491 Bacteria 4349
501 nmdc:mga0yw44_1051_c1 3300050492 Bacteria 10615
502 nmdc:mga0yw44_22282_c2 3300050492 Bacteria 2110
503 nmdc:mga0yw44_49384_c1 3300050492 Bacteria 2539
504 nmdc:mga0k408_19023_c1 3300050493 Bacteria 3835
505 nmdc:mga06z11_1676_c1 3300050494 Bacteria 8308
506 nmdc:mga06z11_26802_c1 3300050494 Bacteria 2748
507 nmdc:mga06z11_4933_c1 3300050494 Bacteria 5296
508 nmdc:mga04h51_1465_c1 3300050495 Bacteria 5465
509 nmdc:mga04h51_971_c1 3300050495 Bacteria 6630
510 nmdc:mga07m45_13544_c1 3300050496 Bacteria 4331
511 nmdc:mga07m45_995_c1 3300050496 Bacteria 12514
512 nmdc:mga05p37_220131_c1 3300050507 Bacteria 2291
513 nmdc:mga05p37_4947_c1 3300050507 Bacteria 15612
514 nmdc:mga09592_138974_c1 3300050508 Bacteria 2093
515 nmdc:mga09592_15617_c1 3300050508 Bacteria 6203
516 nmdc:mga0qj67_52_c1 3300050509 Bacteria 84067
517 nmdc:mga06r32_13686_c2 3300050510 Bacteria 2282
518 nmdc:mga06r32_27161_c1 3300050510 Bacteria 5344
519 nmdc:mga08y16_122515_c1 3300050511 Bacteria 2706
520 nmdc:mga08y16_125842_c1 3300050511 Bacteria 2666
521 nmdc:mga08y16_9940_c1 3300050511 Bacteria 9985
522 nmdc:mga0n895_34877_c1 3300050512 Bacteria 4846
523 nmdc:mga0a205_48710_c1 3300050515 Bacteria 4090
524 Ga0500643_013577 3300053087 Bacteria 2871
525 Ga0500651_0030124 3300053093 Bacteria 3413
526 Ga0500651_0084312 3300053093 Bacteria 1965
527 Ga0500566_0000135 3300053094 Bacteria 37782
528 Ga0500641_0002341 3300053096 Bacteria 6709
529 Ga0500556_0000030 3300053104 Bacteria 165098
530 Ga0500569_008121 3300053109 Bacteria 2389
531 Ga0500593_000043 3300053117 Bacteria 45165
532 Ga0500593_001328 3300053117 Bacteria 8915
533 Ga0500595_000055 3300053119 Bacteria 84205
534 Ga0500595_007441 3300053119 Bacteria 4544
535 Ga0500595_019836 3300053119 Bacteria 2432
536 Ga0500642_0000028 3300053130 Bacteria 117281
537 Ga0500652_000106 3300053131 Bacteria 32646
538 Ga0500616_0000001 3300053153 Bacteria 1986011
539 Ga0500616_0000252 3300053153 Bacteria 83060
540 Ga0500616_0001978 3300053153 Bacteria 18207
541 Ga0500616_0002887 3300053153 Bacteria 13778
542 Ga0500619_000027 3300053154 Bacteria 48298
543 Ga0500622_0000810 3300053156 Bacteria 26795
544 Ga0500634_0004846 3300053161 Bacteria 6300
545 Ga0500636_0000525 3300053177 Bacteria 20813
546 Ga0500645_000458 3300053730 Bacteria 27970
547 Ga0500645_008943 3300053730 Bacteria 3387
548 Ga0530510_0019591 3300061734 Bacteria 4803

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046678 Ga0495599_0014731 Ga0495599_0014731_3132_4832 458
2 3300035092 Ga0373952_0010616 Ga0373952_0010616_21_1499 463
3 3300025294 Ga0209025_1016031 Ga0209025_10160315 470
4 3300003790 Ga0055528_1001600 Ga0055528_100160014 471
5 3300025273 Ga0209673_1001841 Ga0209673_100184112 471
6 3300025295 Ga0209564_1002751 Ga0209564_100275113 471
7 3300025299 Ga0209256_1004740 Ga0209256_10047406 471
8 3300048916 Ga0496113_0099867 Ga0496113_0099867_711_2228 471
9 3300013308 Ga0157375_10116382 Ga0157375_101163822 477
10 3300034817 Ga0373948_0000018 Ga0373948_0000018_19947_21461 477
11 3300034957 Ga0373938_0000127 Ga0373938_0000127_9157_10671 477
12 3300035207 Ga0373942_0008604 Ga0373942_0008604_12_1526 477
13 3300048924 Ga0496121_0013875 Ga0496121_0013875_1717_3600 485
14 3300053087 Ga0500643_013577 Ga0500643_013577_12_1784 487
15 3300027907 Ga0207428_10022909 Ga0207428_100229093 488
16 3300005471 Ga0070698_100016038 Ga0070698_1000160382 489
17 3300005530 Ga0070679_100033406 Ga0070679_1000334063 489
18 3300006028 Ga0070717_10047682 Ga0070717_100476822 489
19 3300025912 Ga0207707_10016874 Ga0207707_100168744 489
20 3300050492 nmdc:mga0yw44_49384_c1 nmdc:mga0yw44_49384_c1_19_1578 490
21 3300005458 Ga0070681_10077642 Ga0070681_100776422 491
22 3300035084 Ga0373928_0000406 Ga0373928_0000406_18_1574 491
23 3300050511 nmdc:mga08y16_122515_c1 nmdc:mga08y16_122515_c1_1140_2696 491
24 3300046473 Ga0495582_0028029 Ga0495582_0028029_1451_3037 499
25 3300048929 Ga0496126_0018999 Ga0496126_0018999_2422_4299 499
26 3300053156 Ga0500622_0000810 Ga0500622_0000810_23210_25039 505
27 3300005441 Ga0070700_100005882 Ga0070700_1000058826 506
28 3300006881 Ga0068865_100016167 Ga0068865_1000161674 506
29 3300009094 Ga0111539_10021244 Ga0111539_100212444 506
30 3300009148 Ga0105243_10018411 Ga0105243_100184111 506
31 3300009553 Ga0105249_10022878 Ga0105249_100228785 506
32 3300025908 Ga0207643_10030254 Ga0207643_100302542 506
33 3300026075 Ga0207708_10004713 Ga0207708_100047136 506
34 3300026118 Ga0207675_100016991 Ga0207675_1000169916 506
35 3300048924 Ga0496121_0000694 Ga0496121_0000694_56554_58422 510
36 3300048929 Ga0496126_0007271 Ga0496126_0007271_2681_4549 510
37 3300048920 Ga0496117_0013319 Ga0496117_0013319_4145_6007 511
38 3300048919 Ga0496116_0001272 Ga0496116_0001272_10013_11875 512
39 3300048926 Ga0496123_0048415 Ga0496123_0048415_177_2033 514
40 3300048928 Ga0496125_0001342 Ga0496125_0001342_11687_13543 514
41 3300046460 Ga0495638_0024553 Ga0495638_0024553_202_2058 515
42 3300046665 Ga0495661_0072885 Ga0495661_0072885_11_1867 515
43 3300048926 Ga0496123_0016827 Ga0496123_0016827_2470_4326 515
44 3300053093 Ga0500651_0030124 Ga0500651_0030124_604_2460 515
45 3300005530 Ga0070679_100029327 Ga0070679_1000293273 517
46 3300005539 Ga0068853_100004009 Ga0068853_1000040094 517
47 3300005545 Ga0070695_100005491 Ga0070695_1000054913 517
48 3300005563 Ga0068855_100146993 Ga0068855_1001469932 517
49 3300005842 Ga0068858_100081487 Ga0068858_1000814872 517
50 3300005843 Ga0068860_100030330 Ga0068860_1000303304 517
51 3300009093 Ga0105240_10011902 Ga0105240_100119025 517
52 3300009551 Ga0105238_10005134 Ga0105238_100051343 517
53 3300009551 Ga0105238_10007610 Ga0105238_100076106 517
54 3300010375 Ga0105239_10008583 Ga0105239_100085834 517
55 3300013105 Ga0157369_10008444 Ga0157369_100084444 517
56 3300013296 Ga0157374_10016908 Ga0157374_100169086 517
57 3300025912 Ga0207707_10002780 Ga0207707_100027804 517
58 3300025914 Ga0207671_10036566 Ga0207671_100365661 517
59 3300025921 Ga0207652_10012067 Ga0207652_100120673 517
60 3300025949 Ga0207667_10012495 Ga0207667_100124952 517
61 3300028381 Ga0268264_10027442 Ga0268264_100274423 517
62 3300030521 Ga0307511_10000948 Ga0307511_1000094819 517
63 3300050512 nmdc:mga0n895_34877_c1 nmdc:mga0n895_34877_c1_1187_3016 518
64 3300046691 Ga0495670_0006538 Ga0495670_0006538_2923_4779 519
65 3300006237 Ga0097621_100047178 Ga0097621_1000471783 521
66 3300026089 Ga0207648_10085947 Ga0207648_100859472 521
67 3300036401 Ga0373937_0018405 Ga0373937_0018405_1174_3063 521
68 3300046511 Ga0495608_0009334 Ga0495608_0009334_2847_4736 521
69 3300046543 Ga0495645_0021487 Ga0495645_0021487_1585_3474 521
70 3300046559 Ga0495667_0009010 Ga0495667_0009010_1752_3641 521
71 3300046679 Ga0495623_0023795 Ga0495623_0023795_162_2051 521
72 3300048924 Ga0496121_0012225 Ga0496121_0012225_5832_7688 521
73 3300053104 Ga0500556_0000030 Ga0500556_0000030_46015_47871 521
74 3300005355 Ga0070671_100006687 Ga0070671_1000066876 522
75 3300005367 Ga0070667_100144311 Ga0070667_1001443111 522
76 3300005543 Ga0070672_100015332 Ga0070672_1000153326 522
77 3300009177 Ga0105248_10060607 Ga0105248_100606073 522
78 3300013308 Ga0157375_10061079 Ga0157375_100610792 522
79 3300025940 Ga0207691_10007860 Ga0207691_1000786012 522
80 3300025941 Ga0207711_10041464 Ga0207711_100414642 522
81 3300026142 Ga0207698_10086126 Ga0207698_100861262 522
82 3300048921 Ga0496118_0035700 Ga0496118_0035700_916_2778 522
83 3300053109 Ga0500569_008121 Ga0500569_008121_71_2002 522
84 3300046513 Ga0495616_0019335 Ga0495616_0019335_331_2193 523
85 3300046660 Ga0495625_0008887 Ga0495625_0008887_1846_3708 523
86 3300047443 Ga0495687_000606 Ga0495687_000606_12112_14013 523
87 3300053130 Ga0500642_0000028 Ga0500642_0000028_97134_98996 523
88 3300053131 Ga0500652_000106 Ga0500652_000106_21377_23239 523
89 3300053153 Ga0500616_0000252 Ga0500616_0000252_40073_41935 523
90 3300053730 Ga0500645_008943 Ga0500645_008943_479_2341 523
91 3300037312 Ga0395899_0007150 Ga0395899_0007150_5562_7511 524
92 3300037466 Ga0395898_0018064 Ga0395898_0018064_2429_4378 524
93 3300005471 Ga0070698_100125871 Ga0070698_1001258711 525
94 3300031730 Ga0307516_10061229 Ga0307516_100612292 525
95 3300046452 Ga0495617_016482 Ga0495617_016482_429_2177 526
96 3300003792 Ga0055540_1003959 Ga0055540_10039593 527
97 3300003794 Ga0055531_10000158 Ga0055531_1000015836 527
98 3300005435 Ga0070714_100007553 Ga0070714_1000075534 527
99 3300005435 Ga0070714_100019726 Ga0070714_1000197262 527
100 3300005436 Ga0070713_100034469 Ga0070713_1000344693 527
101 3300006871 Ga0075434_100038462 Ga0075434_1000384624 527
102 3300017792 Ga0163161_10002473 Ga0163161_100024738 527
103 3300025303 Ga0209051_1000315 Ga0209051_100031558 527
104 3300025304 Ga0209257_1000309 Ga0209257_100030970 527
105 3300025910 Ga0207684_10042982 Ga0207684_100429823 527
106 3300025928 Ga0207700_10024746 Ga0207700_100247464 527
107 3300044673 Ga0453683_0020949 Ga0453683_0020949_2148_4106 527
108 3300046507 Ga0495606_0006516 Ga0495606_0006516_6625_8373 527
109 3300053119 Ga0500595_007441 Ga0500595_007441_2595_4478 527
110 3300053119 Ga0500595_019836 Ga0500595_019836_331_2076 527
111 3300005535 Ga0070684_100045196 Ga0070684_1000451963 528
112 3300005536 Ga0070697_100009294 Ga0070697_1000092946 528
113 3300005546 Ga0070696_100017960 Ga0070696_1000179603 528
114 3300005563 Ga0068855_100045298 Ga0068855_1000452986 528
115 3300005614 Ga0068856_100030872 Ga0068856_1000308724 528
116 3300006353 Ga0075370_10013050 Ga0075370_100130502 528
117 3300006914 Ga0075436_100006942 Ga0075436_1000069424 528
118 3300026116 Ga0207674_10060152 Ga0207674_100601523 528
119 3300037312 Ga0395899_0071757 Ga0395899_0071757_601_2364 528
120 3300037418 Ga0395900_0067255 Ga0395900_0067255_1835_3598 528
121 3300038443 Ga0395901_0004166 Ga0395901_0004166_332_2095 528
122 3300005329 Ga0070683_100041220 Ga0070683_1000412202 529
123 3300006237 Ga0097621_100003286 Ga0097621_1000032868 529
124 3300009176 Ga0105242_10035792 Ga0105242_100357922 529
125 3300013105 Ga0157369_10065123 Ga0157369_100651232 529
126 3300025284 Ga0209130_1000591 Ga0209130_100059122 529
127 3300025302 Ga0207426_1000287 Ga0207426_10002873 529
128 3300031241 Ga0265325_10002896 Ga0265325_100028968 529
129 3300005331 Ga0070670_100017353 Ga0070670_1000173534 530
130 3300025303 Ga0209051_1007350 Ga0209051_10073503 531
131 3300050511 nmdc:mga08y16_125842_c1 nmdc:mga08y16_125842_c1_367_2247 531
132 3300005985 Ga0081539_10004392 Ga0081539_100043924 532
133 3300005985 Ga0081539_10027315 Ga0081539_100273153 532
134 3300025923 Ga0207681_10060735 Ga0207681_100607352 532
135 3300036401 Ga0373937_0103756 Ga0373937_0103756_568_2436 532
136 3300049572 Ga0501036_0055465 Ga0501036_0055465_817_2796 532
137 3300061734 Ga0530510_0019591 Ga0530510_0019591_1891_3870 532
138 3300005331 Ga0070670_100093816 Ga0070670_1000938161 533
139 3300005364 Ga0070673_100050061 Ga0070673_1000500612 533
140 3300005456 Ga0070678_100019298 Ga0070678_1000192981 533
141 3300005543 Ga0070672_100017060 Ga0070672_1000170603 533
142 3300005617 Ga0068859_100031914 Ga0068859_1000319143 533
143 3300005618 Ga0068864_100013488 Ga0068864_1000134885 533
144 3300006178 Ga0075367_10046031 Ga0075367_100460312 533
145 3300006931 Ga0097620_100031914 Ga0097620_1000319143 533
146 3300009545 Ga0105237_10004886 Ga0105237_100048868 533
147 3300010375 Ga0105239_10016888 Ga0105239_100168885 533
148 3300025898 Ga0207692_10045290 Ga0207692_100452902 533
149 3300025914 Ga0207671_10012628 Ga0207671_100126283 533
150 3300025933 Ga0207706_10028017 Ga0207706_100280174 533
151 3300025940 Ga0207691_10025838 Ga0207691_100258383 533
152 3300026121 Ga0207683_10036564 Ga0207683_100365642 533
153 3300038443 Ga0395901_0131342 Ga0395901_0131342_566_2440 533
154 3300050493 nmdc:mga0k408_19023_c1 nmdc:mga0k408_19023_c1_191_2068 533
155 3300050496 nmdc:mga07m45_13544_c1 nmdc:mga07m45_13544_c1_906_2783 533
156 3300005334 Ga0068869_100003935 Ga0068869_1000039357 534
157 3300005338 Ga0068868_100024412 Ga0068868_1000244124 534
158 3300005340 Ga0070689_100014581 Ga0070689_1000145812 534
159 3300005543 Ga0070672_100017477 Ga0070672_1000174773 534
160 3300005548 Ga0070665_100013258 Ga0070665_1000132585 534
161 3300005614 Ga0068856_100034496 Ga0068856_1000344963 534
162 3300005842 Ga0068858_100022251 Ga0068858_1000222514 534
163 3300005844 Ga0068862_100048026 Ga0068862_1000480263 534
164 3300006186 Ga0075369_10005721 Ga0075369_100057213 534
165 3300009094 Ga0111539_10097380 Ga0111539_100973802 534
166 3300025295 Ga0209564_1001504 Ga0209564_100150412 534
167 3300025907 Ga0207645_10025420 Ga0207645_100254204 534
168 3300025933 Ga0207706_10033719 Ga0207706_100337193 534
169 3300025936 Ga0207670_10038227 Ga0207670_100382272 534
170 3300025940 Ga0207691_10020845 Ga0207691_100208453 534
171 3300026116 Ga0207674_10025674 Ga0207674_100256744 534
172 3300028379 Ga0268266_10010351 Ga0268266_100103515 534
173 3300035086 Ga0373934_0001121 Ga0373934_0001121_2329_4206 534
174 3300035119 Ga0373956_0000103 Ga0373956_0000103_25002_26879 534
175 3300035724 Ga0373933_0000811 Ga0373933_0000811_8290_10167 534
176 3300036401 Ga0373937_0000769 Ga0373937_0000769_10890_12767 534
177 3300046462 Ga0495651_0006045 Ga0495651_0006045_2007_3884 534
178 3300026067 Ga0207678_10062852 Ga0207678_100628523 535
179 3300003781 Ga0055536_1000891 Ga0055536_100089113 536
180 3300003792 Ga0055540_1001142 Ga0055540_100114211 536
181 3300006051 Ga0075364_10010428 Ga0075364_100104285 536
182 3300006177 Ga0075362_10002395 Ga0075362_100023952 536
183 3300006195 Ga0075366_10002532 Ga0075366_100025323 536
184 3300006914 Ga0075436_100002869 Ga0075436_1000028695 536
185 3300025292 Ga0209676_1000873 Ga0209676_100087313 536
186 3300025303 Ga0209051_1000773 Ga0209051_100077312 536
187 3300048927 Ga0496124_0045825 Ga0496124_0045825_602_2350 536
188 3300048928 Ga0496125_0064200 Ga0496125_0064200_131_1879 536
189 3300048929 Ga0496126_0107306 Ga0496126_0107306_96_1844 536
190 3300050489 nmdc:mga03683_994_c1 nmdc:mga03683_994_c1_1180_2946 536
191 3300050507 nmdc:mga05p37_220131_c1 nmdc:mga05p37_220131_c1_365_2215 536
192 3300053094 Ga0500566_0000135 Ga0500566_0000135_32812_34674 536
193 3300053177 Ga0500636_0000525 Ga0500636_0000525_3274_5136 536
194 3300006944 Ga0099823_1022458 Ga0099823_10224582 537
195 3300027296 Ga0209389_1000062 Ga0209389_100006218 537
196 3300027361 Ga0209489_100160 Ga0209489_10016018 537
197 3300027363 Ga0209700_102603 Ga0209700_10260322 537
198 3300030522 Ga0307512_10038502 Ga0307512_100385023 537
199 3300033442 Ga0315911_1000017 Ga0315911_1000017141 537
200 3300037471 Ga0395905_0011762 Ga0395905_0011762_2313_4280 537
201 3300046692 Ga0495671_0009334 Ga0495671_0009334_1432_3363 537
202 iso_pu_bacteria 2643221544 2643744825 537
203 iso_pu_bacteria 2643221639 2644219549 537
204 iso_pu_bacteria 2643221646 2644255979 537
205 3300005356 Ga0070674_100028198 Ga0070674_1000281981 538
206 3300005439 Ga0070711_100059328 Ga0070711_1000593282 538
207 3300006353 Ga0075370_10024557 Ga0075370_100245572 538
208 3300006881 Ga0068865_100083388 Ga0068865_1000833881 538
209 3300009148 Ga0105243_10014028 Ga0105243_100140286 538
210 3300022739 Ga0228711_1002116 Ga0228711_100211636 538
211 3300022740 Ga0228710_1011349 Ga0228710_10113499 538
212 3300025916 Ga0207663_10090076 Ga0207663_100900762 538
213 3300025935 Ga0207709_10000497 Ga0207709_100004976 538
214 3300025940 Ga0207691_10001616 Ga0207691_100016164 538
215 3300026089 Ga0207648_10049421 Ga0207648_100494212 538
216 3300027111 Ga0209281_1000106 Ga0209281_100010642 538
217 3300027666 Ga0209282_1000083 Ga0209282_100008329 538
218 3300028794 Ga0307515_10014764 Ga0307515_100147645 538
219 3300031730 Ga0307516_10000348 Ga0307516_1000034811 538
220 3300031967 Ga0315914_1002550 Ga0315914_100255029 538
221 3300033430 Ga0315913_1001274 Ga0315913_100127428 538
222 3300033464 Ga0315915_1000010 Ga0315915_100001075 538
223 3300035118 Ga0373954_0000001 Ga0373954_0000001_119623_121521 538
224 3300036401 Ga0373937_0005181 Ga0373937_0005181_1962_3860 538
225 3300053117 Ga0500593_001328 Ga0500593_001328_3509_5257 538
226 iso_pu_bacteria 2551306091 2551730641 538
227 3300005983 Ga0081540_1000922 Ga0081540_100092223 539
228 3300006028 Ga0070717_10088575 Ga0070717_100885752 539
229 3300006871 Ga0075434_100092148 Ga0075434_1000921482 539
230 3300025910 Ga0207684_10038233 Ga0207684_100382332 539
231 3300025922 Ga0207646_10043993 Ga0207646_100439932 539
232 3300048915 Ga0496112_0057848 Ga0496112_0057848_1259_3007 539
233 3300005353 Ga0070669_100021219 Ga0070669_1000212194 540
234 3300005367 Ga0070667_100056670 Ga0070667_1000566704 540
235 3300005441 Ga0070700_100059602 Ga0070700_1000596021 540
236 3300005719 Ga0068861_100073057 Ga0068861_1000730571 540
237 3300005937 Ga0081455_10018535 Ga0081455_100185353 540
238 3300005983 Ga0081540_1001425 Ga0081540_100142523 540
239 3300006195 Ga0075366_10017650 Ga0075366_100176502 540
240 3300006871 Ga0075434_100073983 Ga0075434_1000739833 540
241 3300006914 Ga0075436_100017707 Ga0075436_1000177074 540
242 3300026075 Ga0207708_10020468 Ga0207708_100204684 540
243 3300049823 Ga0501044_0115365 Ga0501044_0115365_206_1954 540
244 3300050515 nmdc:mga0a205_48710_c1 nmdc:mga0a205_48710_c1_2038_3786 540
245 3300002987 JGI25159J45721_1000004 JGI25159J45721_1000004130 541
246 3300003354 JGI25160J50197_1000021 JGI25160J50197_100002180 541
247 3300003374 JGI25161J50226_1000218 JGI25161J50226_100021829 541
248 3300003771 Ga0055526_1001422 Ga0055526_10014228 541
249 3300003781 Ga0055536_1000269 Ga0055536_100026927 541
250 3300003794 Ga0055531_10000586 Ga0055531_100005864 541
251 3300004625 Ga0055543_1000164 Ga0055543_100016422 541
252 3300005262 Ga0065165_1000033 Ga0065165_100003380 541
253 3300005618 Ga0068864_100013717 Ga0068864_1000137174 541
254 3300006038 Ga0075365_10010896 Ga0075365_100108964 541
255 3300006042 Ga0075368_10013178 Ga0075368_100131782 541
256 3300006178 Ga0075367_10000458 Ga0075367_100004589 541
257 3300006846 Ga0075430_100000192 Ga0075430_1000001922 541
258 3300009098 Ga0105245_10128425 Ga0105245_101284252 541
259 3300025298 Ga0209050_1000759 Ga0209050_100075955 541
260 3300025303 Ga0209051_1003896 Ga0209051_10038962 541
261 3300025304 Ga0209257_1000061 Ga0209257_1000061187 541
262 3300025927 Ga0207687_10087839 Ga0207687_100878391 541
263 3300026118 Ga0207675_100060081 Ga0207675_1000600812 541
264 3300027866 Ga0209813_10000917 Ga0209813_100009172 541
265 3300031548 Ga0307408_100000012 Ga0307408_10000001252 541
266 3300048907 Ga0496104_0047774 Ga0496104_0047774_1477_3192 541
267 3300050494 nmdc:mga06z11_4933_c1 nmdc:mga06z11_4933_c1_1621_3366 541
268 3300050495 nmdc:mga04h51_1465_c1 nmdc:mga04h51_1465_c1_1930_3675 541
269 3300050509 nmdc:mga0qj67_52_c1 nmdc:mga0qj67_52_c1_7039_8784 541
270 3300053153 Ga0500616_0002887 Ga0500616_0002887_8003_9751 541
271 3300053154 Ga0500619_000027 Ga0500619_000027_14893_16824 541
272 3300053161 Ga0500634_0004846 Ga0500634_0004846_1714_3645 541
273 3300002739 JGI25158J39367_1001450 JGI25158J39367_10014502 542
274 3300003791 Ga0055530_10002560 Ga0055530_1000256012 542
275 3300003794 Ga0055531_10008595 Ga0055531_100085952 542
276 3300025208 Ga0209436_103264 Ga0209436_1032643 542
277 3300025284 Ga0209130_1000017 Ga0209130_1000017302 542
278 3300025292 Ga0209676_1000876 Ga0209676_100087615 542
279 3300025294 Ga0209025_1000161 Ga0209025_1000161128 542
280 3300025295 Ga0209564_1000013 Ga0209564_1000013750 542
281 3300025298 Ga0209050_1002190 Ga0209050_100219011 542
282 3300025299 Ga0209256_1002058 Ga0209256_100205818 542
283 3300025302 Ga0207426_1000006 Ga0207426_1000006301 542
284 3300025303 Ga0209051_1006359 Ga0209051_10063596 542
285 3300025304 Ga0209257_1006709 Ga0209257_10067096 542
286 3300035113 Ga0373936_0038125 Ga0373936_0038125_55_1809 542
287 3300045051 Ga0451576_0005540 Ga0451576_0005540_7357_9240 542
288 3300048913 Ga0496110_0083061 Ga0496110_0083061_1042_2757 542
289 3300048927 Ga0496124_0040798 Ga0496124_0040798_1382_3097 542
290 3300048928 Ga0496125_0011403 Ga0496125_0011403_5907_7622 542
291 3300005455 Ga0070663_100000390 Ga0070663_1000003905 543
292 3300005548 Ga0070665_100002577 Ga0070665_1000025777 543
293 3300006038 Ga0075365_10005063 Ga0075365_100050635 543
294 3300006048 Ga0075363_100001360 Ga0075363_1000013608 543
295 3300006178 Ga0075367_10001100 Ga0075367_100011002 543
296 3300006353 Ga0075370_10014550 Ga0075370_100145503 543
297 3300007788 Ga0099795_10004985 Ga0099795_100049853 543
298 3300009766 Ga0123342_1003939 Ga0123342_100393922 543
299 3300014325 Ga0163163_10090922 Ga0163163_100909223 543
300 3300025294 Ga0209025_1014259 Ga0209025_10142592 543
301 3300025297 Ga0209758_1000628 Ga0209758_10006281 543
302 3300025297 Ga0209758_1011107 Ga0209758_10111073 543
303 3300026067 Ga0207678_10003222 Ga0207678_100032227 543
304 3300028379 Ga0268266_10000680 Ga0268266_1000068012 543
305 3300031507 Ga0307509_10022123 Ga0307509_100221232 543
306 3300050490 nmdc:mga03n38_17384_c1 nmdc:mga03n38_17384_c1_290_2035 543
307 3300050494 nmdc:mga06z11_1676_c1 nmdc:mga06z11_1676_c1_1757_3502 543
308 3300050496 nmdc:mga07m45_995_c1 nmdc:mga07m45_995_c1_5501_7246 543
309 3300014326 Ga0157380_10010872 Ga0157380_100108723 544
310 3300035118 Ga0373954_0026273 Ga0373954_0026273_139_1986 544
311 3300046516 Ga0495628_0078737 Ga0495628_0078737_657_2504 544
312 iso_pu_bacteria 2599185214 2599627086 544
313 iso_pu_bacteria 2599185226 2599676553 544
314 iso_pu_bacteria 2599185227 2599684821 544
315 iso_pu_bacteria 2599185229 2599696743 544
316 iso_pu_bacteria 2928070936 2928072674 544
317 3300003203 JGI25406J46586_10000160 JGI25406J46586_100001606 545
318 3300005435 Ga0070714_100133451 Ga0070714_1001334512 545
319 3300005617 Ga0068859_100049927 Ga0068859_1000499273 545
320 3300005937 Ga0081455_10061387 Ga0081455_100613871 545
321 3300005985 Ga0081539_10000040 Ga0081539_10000040112 545
322 3300006042 Ga0075368_10004400 Ga0075368_100044004 545
323 3300006051 Ga0075364_10004279 Ga0075364_100042793 545
324 3300006175 Ga0070712_100060996 Ga0070712_1000609962 545
325 3300006178 Ga0075367_10005385 Ga0075367_100053855 545
326 3300006871 Ga0075434_100067360 Ga0075434_1000673603 545
327 3300006931 Ga0097620_100049926 Ga0097620_1000499263 545
328 3300009147 Ga0114129_10035914 Ga0114129_100359142 545
329 3300013297 Ga0157378_10056200 Ga0157378_100562002 545
330 3300025915 Ga0207693_10037698 Ga0207693_100376982 545
331 3300031456 Ga0307513_10000034 Ga0307513_10000034140 545
332 3300046615 Ga0495656_0000081 Ga0495656_0000081_17827_19704 545
333 3300048909 Ga0496106_0110020 Ga0496106_0110020_183_2060 545
334 3300048918 Ga0496115_0166726 Ga0496115_0166726_15_1742 545
335 3300049822 Ga0501035_0031856 Ga0501035_0031856_3068_4789 545
336 3300050490 nmdc:mga03n38_7023_c1 nmdc:mga03n38_7023_c1_913_2655 545
337 3300050491 nmdc:mga00v17_14927_c1 nmdc:mga00v17_14927_c1_1518_3260 545
338 3300050492 nmdc:mga0yw44_1051_c1 nmdc:mga0yw44_1051_c1_933_2675 545
339 3300050494 nmdc:mga06z11_26802_c1 nmdc:mga06z11_26802_c1_39_1781 545
340 3300050495 nmdc:mga04h51_971_c1 nmdc:mga04h51_971_c1_3684_5426 545
341 3300003215 JGI25153J46596_10001104 JGI25153J46596_1000110413 546
342 3300005458 Ga0070681_10069587 Ga0070681_100695872 546
343 3300005563 Ga0068855_100025032 Ga0068855_1000250327 546
344 3300005842 Ga0068858_100036326 Ga0068858_1000363263 546
345 3300006058 Ga0075432_10006475 Ga0075432_100064753 546
346 3300006195 Ga0075366_10029899 Ga0075366_100298992 546
347 3300013104 Ga0157370_10147726 Ga0157370_101477261 546
348 3300025297 Ga0209758_1006011 Ga0209758_10060115 546
349 3300028379 Ga0268266_10001248 Ga0268266_1000124822 546
350 3300033180 Ga0307510_10025874 Ga0307510_100258742 546
351 3300046674 Ga0495588_0003613 Ga0495588_0003613_337_2085 546
352 3300048913 Ga0496110_0036657 Ga0496110_0036657_672_2555 546
353 iso_pu_bacteria 2996887358 2996887698 546
354 iso_pu_bacteria 8005321885 8005322225 546
355 3300005471 Ga0070698_100001905 Ga0070698_10000190523 547
356 3300005614 Ga0068856_100022824 Ga0068856_1000228243 547
357 3300025924 Ga0207694_10082520 Ga0207694_100825202 547
358 3300025937 Ga0207669_10025556 Ga0207669_100255562 547
359 3300026041 Ga0207639_10062849 Ga0207639_100628492 547
360 3300031730 Ga0307516_10005411 Ga0307516_100054113 547
361 3300031730 Ga0307516_10008644 Ga0307516_100086449 547
362 3300037466 Ga0395898_0008307 Ga0395898_0008307_8685_10448 547
363 3300038443 Ga0395901_0051140 Ga0395901_0051140_2200_3963 547
364 3300053096 Ga0500641_0002341 Ga0500641_0002341_701_2449 547
365 3300053153 Ga0500616_0001978 Ga0500616_0001978_1456_3342 547
366 iso_pu_bacteria 2510917028 2511184817 547
367 iso_pu_bacteria 2513237138 2513870290 547
368 iso_pu_bacteria 2513237144 2513911960 547
369 iso_pu_bacteria 2513237146 2513923719 547
370 iso_pu_bacteria 2582581294 2585203458 547
371 iso_pu_bacteria 2582581867 2585398475 547
372 iso_pu_bacteria 2585427590 2585819378 547
373 iso_pu_bacteria 2599185170 2599415749 547
374 iso_pu_bacteria 2599185352 2600194783 547
375 iso_pu_bacteria 2643221618 2644104598 547
376 iso_pu_bacteria 2643221655 2644307986 547
377 iso_pu_bacteria 2643221659 2644333713 547
378 iso_pu_bacteria 2643221712 2644614140 547
379 iso_pu_bacteria 2643221723 2644675885 547
380 iso_pu_bacteria 2838035591 2838035867 547
381 iso_pu_bacteria 2838074704 2838077050 547
382 iso_pu_bacteria 2838661181 2838665099 547
383 iso_pu_bacteria 2896384573 2896385852 547
384 iso_pu_bacteria 2920760137 2920761785 547
385 iso_pu_bacteria 2923556063 2923557270 547
386 iso_pu_bacteria 2933016740 2933017824 547
387 iso_pu_bacteria 8005258706 8005259060 547
388 iso_pu_bacteria 8006933436 8006936134 547
389 iso_pu_bacteria 8006973647 8006976060 547
390 3300005330 Ga0070690_100019176 Ga0070690_1000191762 548
391 3300005356 Ga0070674_100095080 Ga0070674_1000950801 548
392 3300006844 Ga0075428_100002073 Ga0075428_10000207318 548
393 3300006880 Ga0075429_100041037 Ga0075429_1000410372 548
394 3300009094 Ga0111539_10011469 Ga0111539_100114692 548
395 3300025907 Ga0207645_10017396 Ga0207645_100173962 548
396 3300028794 Ga0307515_10000013 Ga0307515_1000001312 548
397 3300028794 Ga0307515_10000037 Ga0307515_10000037272 548
398 3300028794 Ga0307515_10008845 Ga0307515_100088458 548
399 3300031456 Ga0307513_10015642 Ga0307513_100156428 548
400 3300035691 Ga0373931_0005744 Ga0373931_0005744_2268_4016 548
401 3300048905 Ga0496102_0001355 Ga0496102_0001355_5945_7900 548
402 3300048912 Ga0496109_0033573 Ga0496109_0033573_1859_3607 548
403 3300048924 Ga0496121_0000214 Ga0496121_0000214_31607_33490 548
404 3300050508 nmdc:mga09592_15617_c1 nmdc:mga09592_15617_c1_1599_3686 548
405 3300050511 nmdc:mga08y16_9940_c1 nmdc:mga08y16_9940_c1_3617_5704 548
406 3300053117 Ga0500593_000043 Ga0500593_000043_33675_35633 548
407 iso_pu_bacteria 2513237092 2513628439 548
408 iso_pu_bacteria 2513237096 2513656372 548
409 iso_pu_bacteria 2513237137 2513857058 548
410 iso_pu_bacteria 2513237145 2513917449 548
411 iso_pu_bacteria 2765235802 2765468962 548
412 iso_pu_bacteria 2767802442 2770195103 548
413 iso_pu_bacteria 2775506902 2776270844 548
414 iso_pu_bacteria 2775506904 2776280333 548
415 iso_pu_bacteria 2839993093 2839996940 548
416 iso_pu_bacteria 2840764183 2840765997 548
417 iso_pu_bacteria 2841957949 2841963890 548
418 iso_pu_bacteria 2847930680 2847931857 548
419 iso_pu_bacteria 2874612657 2874620064 548
420 iso_pu_bacteria 2879083081 2879091233 548
421 iso_pu_bacteria 2906643746 2906647879 548
422 iso_pu_bacteria 2920822456 2920825426 548
423 iso_pu_bacteria 2922386360 2922392516 548
424 iso_pu_bacteria 3005483717 3005490365 548
425 3300005331 Ga0070670_100002410 Ga0070670_10000241014 549
426 3300005458 Ga0070681_10004989 Ga0070681_1000498914 549
427 3300005530 Ga0070679_100004826 Ga0070679_1000048263 549
428 3300005618 Ga0068864_100004280 Ga0068864_1000042806 549
429 3300005618 Ga0068864_100025475 Ga0068864_1000254754 549
430 3300005841 Ga0068863_100008635 Ga0068863_1000086355 549
431 3300006178 Ga0075367_10001562 Ga0075367_100015622 549
432 3300006186 Ga0075369_10003922 Ga0075369_100039224 549
433 3300009177 Ga0105248_10003122 Ga0105248_100031228 549
434 3300015683 Ga0183362_10005 Ga0183362_1000523 549
435 3300025921 Ga0207652_10016979 Ga0207652_100169794 549
436 3300025931 Ga0207644_10014326 Ga0207644_100143263 549
437 3300026095 Ga0207676_10004233 Ga0207676_1000423310 549
438 3300026095 Ga0207676_10039058 Ga0207676_100390582 549
439 3300026142 Ga0207698_10075114 Ga0207698_100751142 549
440 3300027907 Ga0207428_10002133 Ga0207428_1000213317 549
441 3300031456 Ga0307513_10012252 Ga0307513_100122523 549
442 3300048915 Ga0496112_0132541 Ga0496112_0132541_545_2437 549
443 3300048916 Ga0496113_0010705 Ga0496113_0010705_1769_3664 549
444 iso_pu_bacteria 2602042107 2603859703 549
445 iso_pu_bacteria 2643221733 2644729946 549
446 iso_pu_bacteria 2775506901 2776262110 549
447 iso_pu_bacteria 2857524615 2857530714 549
448 iso_pu_bacteria 2893066018 2893070335 549
449 iso_pu_bacteria 2919073203 2919076291 549
450 iso_pu_bacteria 8019648815 8019653373 549
451 3300014326 Ga0157380_10035779 Ga0157380_100357792 550
452 3300025913 Ga0207695_10004829 Ga0207695_100048294 550
453 3300037312 Ga0395899_0012066 Ga0395899_0012066_98_1846 550
454 3300037418 Ga0395900_0049257 Ga0395900_0049257_492_2240 550
455 3300038443 Ga0395901_0001587 Ga0395901_0001587_9315_11063 550
456 iso_pu_bacteria 2844533157 2844535131 550
457 3300050508 nmdc:mga09592_138974_c1 nmdc:mga09592_138974_c1_153_1898 551
458 3300050510 nmdc:mga06r32_13686_c2 nmdc:mga06r32_13686_c2_104_1849 551
459 3300053093 Ga0500651_0084312 Ga0500651_0084312_57_1796 551
460 3300005983 Ga0081540_1003997 Ga0081540_10039974 552
461 3300006847 Ga0075431_100019202 Ga0075431_1000192025 552
462 3300009147 Ga0114129_10010074 Ga0114129_100100744 552
463 3300046491 Ga0495584_0006643 Ga0495584_0006643_3760_5505 552
464 3300046519 Ga0495632_0031101 Ga0495632_0031101_931_2679 552
465 3300048907 Ga0496104_0000175 Ga0496104_0000175_1289_3031 552
466 3300048908 Ga0496105_0002850 Ga0496105_0002850_1739_3481 552
467 3300048911 Ga0496108_0003952 Ga0496108_0003952_2776_4518 552
468 3300048912 Ga0496109_0004749 Ga0496109_0004749_3726_5468 552
469 3300048913 Ga0496110_0007879 Ga0496110_0007879_5386_7128 552
470 3300048914 Ga0496111_0000718 Ga0496111_0000718_1251_2993 552
471 3300048915 Ga0496112_0109029 Ga0496112_0109029_970_2712 552
472 3300049571 Ga0501034_0021593 Ga0501034_0021593_3454_5193 552
473 3300049574 Ga0501038_0019980 Ga0501038_0019980_2478_4217 552
474 3300049581 Ga0501047_0021515 Ga0501047_0021515_2597_4336 552
475 3300049589 Ga0501073_0023082 Ga0501073_0023082_755_2494 552
476 3300049744 Ga0501083_0013082 Ga0501083_0013082_718_2457 552
477 3300049823 Ga0501044_0069528 Ga0501044_0069528_1290_3029 552
478 3300050507 nmdc:mga05p37_4947_c1 nmdc:mga05p37_4947_c1_9707_11452 552
479 3300050510 nmdc:mga06r32_27161_c1 nmdc:mga06r32_27161_c1_2275_4020 552
480 3300006048 Ga0075363_100040709 Ga0075363_1000407092 553
481 3300006178 Ga0075367_10026557 Ga0075367_100265573 553
482 3300006178 Ga0075367_10050199 Ga0075367_100501992 553
483 3300006353 Ga0075370_10022157 Ga0075370_100221573 553
484 3300031901 Ga0307406_10023282 Ga0307406_100232822 553
485 3300034819 Ga0373958_0000988 Ga0373958_0000988_1697_3442 553
486 3300035691 Ga0373931_0000387 Ga0373931_0000387_10914_12659 553
487 3300050492 nmdc:mga0yw44_22282_c2 nmdc:mga0yw44_22282_c2_159_1907 553
488 3300053119 Ga0500595_000055 Ga0500595_000055_75153_76904 553
489 3300053153 Ga0500616_0000001 Ga0500616_0000001_157983_159734 553
490 3300053730 Ga0500645_000458 Ga0500645_000458_8343_10094 553
491 2162886007 SwRhRL2b_contig_531915 SwRhRL2b_0786.00004900 554
492 2209111006 2214828545 2213866913 554
493 3300000041 ARcpr5oldR_c001419 ARcpr5oldR_0014192 554
494 3300000042 ARSoilYngRDRAFT_c00204 ARSoilYngRDRAFT_002042 554
495 3300000043 ARcpr5yngRDRAFT_c001717 ARcpr5yngRDRAFT_0017172 554
496 3300000044 ARSoilOldRDRAFT_c000097 ARSoilOldRDRAFT_00009717 554
497 3300000045 ARCol0oldRDRAFT_c00920 ARCol0oldRDRAFT_009202 554
498 3300000652 ARCol0yngRDRAFT_1000138 ARCol0yngRDRAFT_100013813 554
499 3300002070 JGI24750J21931_1000071 JGI24750J21931_10000718 554
500 3300002076 JGI24749J21850_1000123 JGI24749J21850_10001232 554
501 3300002459 JGI24751J29686_10006799 JGI24751J29686_100067992 554
502 3300003187 JGI25151J46595_10000246 JGI25151J46595_100002469 554
503 3300005277 Ga0065716_1001798 Ga0065716_10017983 554
504 3300005289 Ga0065704_10090917 Ga0065704_100909172 554
505 3300005329 Ga0070683_100079642 Ga0070683_1000796422 554
506 3300005336 Ga0070680_100040428 Ga0070680_1000404281 554
507 3300005337 Ga0070682_100000567 Ga0070682_10000056711 554
508 3300005338 Ga0068868_100043264 Ga0068868_1000432645 554
509 3300005340 Ga0070689_100041356 Ga0070689_1000413562 554
510 3300005355 Ga0070671_100020002 Ga0070671_1000200025 554
511 3300005365 Ga0070688_100011433 Ga0070688_1000114332 554
512 3300005366 Ga0070659_100102796 Ga0070659_1001027962 554
513 3300005367 Ga0070667_100115840 Ga0070667_1001158402 554
514 3300005436 Ga0070713_100014064 Ga0070713_1000140643 554
515 3300005445 Ga0070708_100000133 Ga0070708_10000013338 554
516 3300005456 Ga0070678_100035561 Ga0070678_1000355612 554
517 3300005458 Ga0070681_10004361 Ga0070681_1000436111 554
518 3300005458 Ga0070681_10080534 Ga0070681_100805341 554
519 3300005459 Ga0068867_100062697 Ga0068867_1000626972 554
520 3300005466 Ga0070685_10007824 Ga0070685_100078245 554
521 3300005530 Ga0070679_100001064 Ga0070679_10000106414 554
522 3300005539 Ga0068853_100042938 Ga0068853_1000429383 554
523 3300005539 Ga0068853_100060831 Ga0068853_1000608313 554
524 3300005563 Ga0068855_100113648 Ga0068855_1001136482 554
525 3300005577 Ga0068857_100029996 Ga0068857_1000299963 554
526 3300005615 Ga0070702_100007354 Ga0070702_1000073545 554
527 3300005617 Ga0068859_100066070 Ga0068859_1000660705 554
528 3300005618 Ga0068864_100040947 Ga0068864_1000409472 554
529 3300005718 Ga0068866_10042525 Ga0068866_100425252 554
530 3300005843 Ga0068860_100028824 Ga0068860_1000288243 554
531 3300006931 Ga0097620_100066069 Ga0097620_1000660695 554
532 3300009101 Ga0105247_10010927 Ga0105247_100109273 554
533 3300009147 Ga0114129_10035342 Ga0114129_100353421 554
534 3300009176 Ga0105242_10001652 Ga0105242_1000165210 554
535 3300013100 Ga0157373_10015870 Ga0157373_100158703 554
536 3300013104 Ga0157370_10008445 Ga0157370_1000844510 554
537 3300013105 Ga0157369_10002895 Ga0157369_100028952 554
538 3300013296 Ga0157374_10033492 Ga0157374_100334923 554
539 3300013307 Ga0157372_10031877 Ga0157372_100318773 554
540 3300013307 Ga0157372_10060311 Ga0157372_100603111 554
541 3300013308 Ga0157375_10037213 Ga0157375_100372134 554
542 3300025294 Ga0209025_1000265 Ga0209025_100026566 554
543 3300025297 Ga0209758_1002358 Ga0209758_10023585 554
544 3300025901 Ga0207688_10042184 Ga0207688_100421842 554
545 3300025904 Ga0207647_10015046 Ga0207647_100150465 554
546 3300025904 Ga0207647_10057132 Ga0207647_100571323 554
547 3300025908 Ga0207643_10036424 Ga0207643_100364241 554
548 3300025916 Ga0207663_10020266 Ga0207663_100202663 554
549 3300025918 Ga0207662_10015709 Ga0207662_100157092 554
550 3300025921 Ga0207652_10050807 Ga0207652_100508072 554
551 3300025923 Ga0207681_10021524 Ga0207681_100215242 554
552 3300025931 Ga0207644_10006370 Ga0207644_100063702 554
553 3300025932 Ga0207690_10052614 Ga0207690_100526142 554
554 3300025938 Ga0207704_10038696 Ga0207704_100386962 554
555 3300025939 Ga0207665_10050882 Ga0207665_100508821 554
556 3300026041 Ga0207639_10013959 Ga0207639_100139593 554
557 3300026088 Ga0207641_10028618 Ga0207641_100286184 554
558 3300026089 Ga0207648_10011919 Ga0207648_100119194 554
559 3300026089 Ga0207648_10029742 Ga0207648_100297423 554
560 3300026116 Ga0207674_10073574 Ga0207674_100735742 554
561 3300027695 Ga0209966_1004075 Ga0209966_10040752 554
562 3300027717 Ga0209998_10002323 Ga0209998_100023232 554
563 3300028381 Ga0268264_10032869 Ga0268264_100328692 554
564 3300034816 Ga0373930_0000038 Ga0373930_0000038_928_2673 554
565 3300034816 Ga0373930_0001662 Ga0373930_0001662_1540_3288 554
566 3300034819 Ga0373958_0001557 Ga0373958_0001557_1145_2890 554
567 3300035085 Ga0373929_0000817 Ga0373929_0000817_1321_3066 554
568 3300035090 Ga0373949_0004740 Ga0373949_0004740_1161_2906 554
569 3300035091 Ga0373951_0000716 Ga0373951_0000716_831_2576 554
570 3300035092 Ga0373952_0000990 Ga0373952_0000990_2194_3939 554
571 3300035111 Ga0373923_0009454 Ga0373923_0009454_741_2492 554
572 3300035112 Ga0373932_0001709 Ga0373932_0001709_3087_4832 554
573 3300035115 Ga0373941_0000068 Ga0373941_0000068_4020_5765 554
574 3300035116 Ga0373945_0018842 Ga0373945_0018842_555_2306 554
575 3300035241 Ga0373961_0002126 Ga0373961_0002126_1341_3086 554
576 3300035691 Ga0373931_0005344 Ga0373931_0005344_1852_3597 554
577 3300037466 Ga0395898_0098670 Ga0395898_0098670_642_2393 554
578 3300042876 Ga0451577_0092380 Ga0451577_0092380_40_1785 554
579 3300044712 Ga0453684_0040132 Ga0453684_0040132_4181_5926 554
580 3300046683 Ga0495658_0027228 Ga0495658_0027228_436_2190 554
581 3300047673 Ga0495593_0048226 Ga0495593_0048226_53_1807 554
582 3300048903 Ga0496100_0013789 Ga0496100_0013789_2369_4120 554
583 3300048904 Ga0496101_0020557 Ga0496101_0020557_2125_3876 554
584 3300048905 Ga0496102_0002271 Ga0496102_0002271_10362_12113 554
585 3300048906 Ga0496103_0017655 Ga0496103_0017655_196_1947 554
586 3300048907 Ga0496104_0012436 Ga0496104_0012436_193_1944 554
587 3300048907 Ga0496104_0015322 Ga0496104_0015322_2566_4317 554
588 3300048908 Ga0496105_0003826 Ga0496105_0003826_3660_5411 554
589 3300048908 Ga0496105_0009918 Ga0496105_0009918_3180_4931 554
590 3300048909 Ga0496106_0005133 Ga0496106_0005133_3074_4825 554
591 3300048909 Ga0496106_0012771 Ga0496106_0012771_1005_2756 554
592 3300048911 Ga0496108_0001839 Ga0496108_0001839_4526_6277 554
593 3300048912 Ga0496109_0002227 Ga0496109_0002227_9948_11699 554
594 3300048912 Ga0496109_0007062 Ga0496109_0007062_2329_4080 554
595 3300048913 Ga0496110_0015136 Ga0496110_0015136_2801_4552 554
596 3300048914 Ga0496111_0001439 Ga0496111_0001439_10937_12688 554
597 3300048915 Ga0496112_0003174 Ga0496112_0003174_8253_10004 554
598 3300048915 Ga0496112_0031932 Ga0496112_0031932_806_2557 554
599 3300048916 Ga0496113_0000771 Ga0496113_0000771_4526_6277 554
600 3300048916 Ga0496113_0003775 Ga0496113_0003775_1715_3466 554
601 3300048917 Ga0496114_0011776 Ga0496114_0011776_4401_6152 554
602 3300048918 Ga0496115_0011186 Ga0496115_0011186_3312_5063 554
603 3300049571 Ga0501034_0017969 Ga0501034_0017969_802_2550 554
604 3300049572 Ga0501036_0022350 Ga0501036_0022350_3068_4816 554
605 3300049579 Ga0501043_0089856 Ga0501043_0089856_524_2272 554
606 3300049580 Ga0501046_0005718 Ga0501046_0005718_5178_6926 554
607 3300049585 Ga0501069_0003111 Ga0501069_0003111_902_2650 554
608 3300049586 Ga0501070_0069791 Ga0501070_0069791_321_2069 554
609 3300049823 Ga0501044_0000255 Ga0501044_0000255_13850_15598 554

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06808

DctM

Tripartite ATP-independent periplasmic transporter, DctM component

11

233

0.94

PF06808

DctM

Tripartite ATP-independent periplasmic transporter, DctM component

378

658

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8008 8 554
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7973 8 554
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.7887 4 549
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.6133 4 549
4r1i-assembly1.cif.gz_B structure and function of neisseria gonorrhoeae mtrf illuminates a class of antimetabolite efflux pumps 0.5424 28 540
ID Description Score Start End Superfamily
af_Q5M826_5_184_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3987 445 541 1.20.140.150
af_I1JGF3_289_398_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3799 109 211 1.25.40.10
af_I1JGF3_289_398_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3497 109 211 1.25.40.10
af_A0A178VGS0_23_184_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3218 440 554 1.20.140.150
af_A0A1D6JII9_349_496_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2911 410 525 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A455U2G7-F1-model_v4 TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein 0.9434 57 217 GO:0005886
GO:0022857
AF-A0A355U8U4-F1-model_v4 C4-dicarboxylate ABC transporter 0.919 1 219 GO:0005886
GO:0022857
AF-A0A7Y2Z9L8-F1-model_v4 TRAP transporter large permease subunit 0.9009 68 217 GO:0005886
GO:0022857
AF-A0A3M1KBV6-F1-model_v4 TRAP transporter large permease subunit 0.897 6 221 GO:0005886
GO:0022857
AF-A0A2N3CJI4-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.8831 54 221 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
76.47 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map