F468859

General Info

Members Datasets Scaffolds Average Seq Length
609 291 1218 287

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10054153|Ga0081455_100541533
Length 329
Sequence MVVSTSPRETWQRFDCITQRLALAPDTPLQSNGLFLEVGSIMNYGVVFPQTEFGNDVQAIKDYAQTAEALGYDYLLVYDHVLGAHPNREPKLTGPYTYEHPFHEPMVFFGFLAAITTRLELVTGILILPQRQTALVAKQTAEVDVLSGGRLRLGIGIGWNYVEYDALGEKFQTRGRRAEEQIEVLRKLWTQPLVTHKTAHHVIDNAGLNPLPMQRPIPIWFGGAAEPVLKRAARLGDGWMPGGRAPDDRVKAYIEQLHGYLEEAGRDRKNFGIDPWISMQGLNKDEWHRRVEAWRTLGASHVAVNTMGAGFTSPRAHIDAIRSFREVLT

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
286 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
287 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
288 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.6
Nodule 0
Rhizoplane 6.24
Rhizosphere 87.85
Stem 0
Stem Tuber 0
Unclassified 15.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10054153 3300005937 Bacteria 3422
2 JGI25405J52794_10002580 3300003911 Bacteria 3134
3 Ga0065712_10000192 3300005290 Bacteria 34231
4 Ga0065712_10068833 3300005290 Bacteria 8852
5 Ga0065707_10001258 3300005295 Bacteria 7630
6 Ga0065707_10103559 3300005295 Bacteria 2716
7 Ga0070658_10014471 3300005327 Bacteria 6330
8 Ga0070658_10144020 3300005327 Bacteria 1992
9 Ga0070676_10145876 3300005328 Bacteria 1511
10 Ga0070683_100042874 3300005329 Bacteria 4168
11 Ga0070690_100008194 3300005330 Bacteria 6012
12 Ga0070670_100002869 3300005331 Bacteria 14264
13 Ga0070670_100054294 3300005331 Bacteria 3439
14 Ga0070666_10012449 3300005335 Bacteria 5366
15 Ga0070666_10245935 3300005335 Unclassified 1265
16 Ga0070680_100000963 3300005336 Bacteria 20383
17 Ga0070680_100018605 3300005336 Bacteria 5493
18 Ga0070682_100157311 3300005337 Bacteria 1566
19 Ga0070660_100099480 3300005339 Bacteria 2303
20 Ga0070689_100068070 3300005340 Bacteria 2777
21 Ga0070689_100154556 3300005340 Unclassified 1852
22 Ga0070691_10016508 3300005341 Bacteria 3392
23 Ga0070691_10033215 3300005341 Bacteria 2427
24 Ga0070661_100008331 3300005344 Bacteria 7160
25 Ga0070661_100301781 3300005344 Bacteria 1247
26 Ga0070668_100083216 3300005347 Bacteria 2512
27 Ga0070668_100097614 3300005347 Unclassified 2324
28 Ga0070669_100000083 3300005353 Bacteria 91096
29 Ga0070669_100520662 3300005353 Bacteria 989
30 Ga0070671_100000107 3300005355 Bacteria 52884
31 Ga0070671_100005051 3300005355 Bacteria 10521
32 Ga0070671_100134526 3300005355 Bacteria 2084
33 Ga0070674_100067568 3300005356 Bacteria 2515
34 Ga0070673_100003554 3300005364 Bacteria 9727
35 Ga0070673_100056700 3300005364 Bacteria 3092
36 Ga0070673_100386568 3300005364 Bacteria 1249
37 Ga0070659_100255601 3300005366 Bacteria 1453
38 Ga0070667_100080410 3300005367 Bacteria 2788
39 Ga0070667_100147298 3300005367 Bacteria 2066
40 Ga0070709_10041470 3300005434 Bacteria 2836
41 Ga0070713_100010292 3300005436 Bacteria 6751
42 Ga0070713_100080680 3300005436 Bacteria 2774
43 Ga0070713_100086649 3300005436 Bacteria 2685
44 Ga0070713_100114497 3300005436 Unclassified 2356
45 Ga0070713_100206278 3300005436 Bacteria 1777
46 Ga0070711_100040252 3300005439 Bacteria 3151
47 Ga0070711_100139566 3300005439 Bacteria 1815
48 Ga0070705_100039290 3300005440 Bacteria 2684
49 Ga0070694_100005793 3300005444 Bacteria 7496
50 Ga0070694_100331869 3300005444 Bacteria 1173
51 Ga0070708_100011789 3300005445 Bacteria 7112
52 Ga0070708_100030127 3300005445 Bacteria 4688
53 Ga0070708_100184128 3300005445 Bacteria 1953
54 Ga0070708_100313033 3300005445 Bacteria 1479
55 Ga0070708_100402394 3300005445 Unclassified 1291
56 Ga0070663_100107247 3300005455 Unclassified 2094
57 Ga0070681_10001454 3300005458 Bacteria 20882
58 Ga0070681_10042676 3300005458 Unclassified 4544
59 Ga0070681_10291298 3300005458 Bacteria 1542
60 Ga0070706_100013613 3300005467 Bacteria 7521
61 Ga0070706_100018867 3300005467 Bacteria 6361
62 Ga0070706_100092418 3300005467 Bacteria 2807
63 Ga0070706_100137109 3300005467 Bacteria 2284
64 Ga0070706_100737672 3300005467 Bacteria 913
65 Ga0070707_100005226 3300005468 Bacteria 12151
66 Ga0070707_100009552 3300005468 Bacteria 9011
67 Ga0070707_100048008 3300005468 Bacteria 4088
68 Ga0070707_100241525 3300005468 Bacteria 1758
69 Ga0070698_100000120 3300005471 Bacteria 67569
70 Ga0070699_100037694 3300005518 Bacteria 4185
71 Ga0070679_100049144 3300005530 Bacteria 4201
72 Ga0070679_100078202 3300005530 Bacteria 3297
73 Ga0070684_100033713 3300005535 Bacteria 4374
74 Ga0070697_100118375 3300005536 Bacteria 2213
75 Ga0070697_100321893 3300005536 Bacteria 1332
76 Ga0070697_100425131 3300005536 Bacteria 1155
77 Ga0070686_100076882 3300005544 Bacteria 2199
78 Ga0070686_100139353 3300005544 Bacteria 1687
79 Ga0070686_100242897 3300005544 Bacteria 1312
80 Ga0070695_100002453 3300005545 Bacteria 10674
81 Ga0070696_100012941 3300005546 Bacteria 5604
82 Ga0070696_100185349 3300005546 Bacteria 1546
83 Ga0070665_100025432 3300005548 Bacteria 5965
84 Ga0070665_100155787 3300005548 Bacteria 2286
85 Ga0070704_100090993 3300005549 Bacteria 2274
86 Ga0070704_100133452 3300005549 Bacteria 1928
87 Ga0068855_100309091 3300005563 Bacteria 1749
88 Ga0068855_100329272 3300005563 Bacteria 1686
89 Ga0070664_100003476 3300005564 Bacteria 12713
90 Ga0070664_100013472 3300005564 Bacteria 6659
91 Ga0070664_100327358 3300005564 Bacteria 1389
92 Ga0068857_100127275 3300005577 Unclassified 2296
93 Ga0068857_100556500 3300005577 Bacteria 1081
94 Ga0068854_100089311 3300005578 Bacteria 2290
95 Ga0068856_100007474 3300005614 Bacteria 10665
96 Ga0068856_100080466 3300005614 Bacteria 3231
97 Ga0068856_100410117 3300005614 Bacteria 1375
98 Ga0068856_100570187 3300005614 Bacteria 1153
99 Ga0068852_100372739 3300005616 Unclassified 1399
100 Ga0068859_100330292 3300005617 Bacteria 1619
101 Ga0068864_100061202 3300005618 Bacteria 3261
102 Ga0068861_100100340 3300005719 Unclassified 2301
103 Ga0068863_100200038 3300005841 Bacteria 1922
104 Ga0068858_100242515 3300005842 Bacteria 1710
105 Ga0068860_100120191 3300005843 Bacteria 2515
106 Ga0081455_10003454 3300005937 Bacteria 18168
107 Ga0081455_10003851 3300005937 Bacteria 17111
108 Ga0081455_10006131 3300005937 Bacteria 12987
109 Ga0081455_10012066 3300005937 Bacteria 8642
110 Ga0081455_10015656 3300005937 Bacteria 7355
111 Ga0081455_10015809 3300005937 Bacteria 7309
112 Ga0081455_10114996 3300005937 Unclassified 2131
113 Ga0081455_10120055 3300005937 Bacteria 2072
114 Ga0081538_10002702 3300005981 Bacteria 17059
115 Ga0081538_10027065 3300005981 Unclassified 3986
116 Ga0081538_10045459 3300005981 Bacteria 2722
117 Ga0081538_10100116 3300005981 Bacteria 1462
118 Ga0081540_1008211 3300005983 Bacteria 7311
119 Ga0081540_1011593 3300005983 Bacteria 5884
120 Ga0081540_1106563 3300005983 Bacteria 1195
121 Ga0081539_10001324 3300005985 Bacteria 43245
122 Ga0081539_10127606 3300005985 Bacteria 1254
123 Ga0070717_10051629 3300006028 Bacteria 3385
124 Ga0070717_10055979 3300006028 Bacteria 3256
125 Ga0075365_10035345 3300006038 Bacteria 3232
126 Ga0075365_10235427 3300006038 Unclassified 1286
127 Ga0070715_10027992 3300006163 Bacteria 2255
128 Ga0070712_100001861 3300006175 Bacteria 12858
129 Ga0070712_100026868 3300006175 Bacteria 3839
130 Ga0070712_100102969 3300006175 Bacteria 2116
131 Ga0070712_100103929 3300006175 Bacteria 2107
132 Ga0070712_100281880 3300006175 Unclassified 1339
133 Ga0075362_10017765 3300006177 Bacteria 2934
134 Ga0075362_10021321 3300006177 Bacteria 2717
135 Ga0075367_10031983 3300006178 Bacteria 3024
136 Ga0075367_10224644 3300006178 Bacteria 1175
137 Ga0075369_10000095 3300006186 Bacteria 23768
138 Ga0075366_10040568 3300006195 Bacteria 2753
139 Ga0075366_10061081 3300006195 Bacteria 2239
140 Ga0068871_100030590 3300006358 Bacteria 4241
141 Ga0075428_100002224 3300006844 Bacteria 21017
142 Ga0075428_100006080 3300006844 Bacteria 13420
143 Ga0075428_100040588 3300006844 Bacteria 5119
144 Ga0075428_100062111 3300006844 Bacteria 4091
145 Ga0075428_100115567 3300006844 Unclassified 2923
146 Ga0075428_100161703 3300006844 Bacteria 2430
147 Ga0075428_100216603 3300006844 Bacteria 2068
148 Ga0075428_100505650 3300006844 Bacteria 1293
149 Ga0075430_100096907 3300006846 Bacteria 2465
150 Ga0075430_100446067 3300006846 Bacteria 1068
151 Ga0075431_100001942 3300006847 Bacteria 19711
152 Ga0075431_100109705 3300006847 Bacteria 2848
153 Ga0075431_100135433 3300006847 Bacteria 2539
154 Ga0075431_100147037 3300006847 Bacteria 2428
155 Ga0075431_100273080 3300006847 Bacteria 1713
156 Ga0075431_100292735 3300006847 Bacteria 1646
157 Ga0075431_100453474 3300006847 Unclassified 1278
158 Ga0075431_100634187 3300006847 Bacteria 1050
159 Ga0075433_10242087 3300006852 Unclassified 1601
160 Ga0075433_10414151 3300006852 Unclassified 1189
161 Ga0075434_100021182 3300006871 Bacteria 6318
162 Ga0075434_100024361 3300006871 Bacteria 5916
163 Ga0075434_100154634 3300006871 Unclassified 2313
164 Ga0075434_100190408 3300006871 Bacteria 2072
165 Ga0075434_100192941 3300006871 Bacteria 2057
166 Ga0075434_100359840 3300006871 Bacteria 1476
167 Ga0075434_100380374 3300006871 Bacteria 1432
168 Ga0075434_100409893 3300006871 Unclassified 1376
169 Ga0075434_100481419 3300006871 Bacteria 1262
170 Ga0075429_100025451 3300006880 Bacteria 5136
171 Ga0075429_100028600 3300006880 Bacteria 4839
172 Ga0075429_100067251 3300006880 Bacteria 3118
173 Ga0075429_100090442 3300006880 Bacteria 2669
174 Ga0075436_100064792 3300006914 Bacteria 2526
175 Ga0075436_100105083 3300006914 Unclassified 1969
176 Ga0075436_100240705 3300006914 Unclassified 1287
177 Ga0075436_100342291 3300006914 Unclassified 1077
178 Ga0097620_100330268 3300006931 Bacteria 1619
179 Ga0075435_100025689 3300007076 Bacteria 4587
180 Ga0075435_100081784 3300007076 Unclassified 2653
181 Ga0075435_100191409 3300007076 Bacteria 1731
182 Ga0075435_100293829 3300007076 Unclassified 1389
183 Ga0075435_100369653 3300007076 Unclassified 1231
184 Ga0075435_100372410 3300007076 Bacteria 1226
185 Ga0075435_100452713 3300007076 Bacteria 1107
186 Ga0099795_10063048 3300007788 Bacteria 1381
187 Ga0111539_10003908 3300009094 Bacteria 19597
188 Ga0111539_10007174 3300009094 Bacteria 14286
189 Ga0111539_10040326 3300009094 Bacteria 5622
190 Ga0111539_10051979 3300009094 Bacteria 4879
191 Ga0111539_10117561 3300009094 Unclassified 3116
192 Ga0111539_10221168 3300009094 Bacteria 2205
193 Ga0111539_10281677 3300009094 Bacteria 1934
194 Ga0111539_10631780 3300009094 Bacteria 1247
195 Ga0111539_10655888 3300009094 Unclassified 1222
196 Ga0105247_10009114 3300009101 Bacteria 6040
197 Ga0114129_10001545 3300009147 Bacteria 31204
198 Ga0114129_10026432 3300009147 Bacteria 8218
199 Ga0114129_10029236 3300009147 Bacteria 7805
200 Ga0114129_10034237 3300009147 Bacteria 7174
201 Ga0114129_10067514 3300009147 Bacteria 4987
202 Ga0114129_10158805 3300009147 Bacteria 3091
203 Ga0114129_10195686 3300009147 Bacteria 2742
204 Ga0114129_10208915 3300009147 Bacteria 2640
205 Ga0114129_10226212 3300009147 Unclassified 2521
206 Ga0114129_10261175 3300009147 Bacteria 2321
207 Ga0114129_10262051 3300009147 Unclassified 2316
208 Ga0114129_10393136 3300009147 Bacteria 1828
209 Ga0114129_10720942 3300009147 Bacteria 1280
210 Ga0105243_10498954 3300009148 Unclassified 1153
211 Ga0105242_10030709 3300009176 Bacteria 4291
212 Ga0105248_10033989 3300009177 Bacteria 5700
213 Ga0105248_10236008 3300009177 Bacteria 2059
214 Ga0105248_10399565 3300009177 Bacteria 1547
215 Ga0105248_10930066 3300009177 Bacteria 982
216 Ga0105237_10720265 3300009545 Bacteria 1004
217 Ga0105238_10115356 3300009551 Bacteria 2665
218 Ga0105249_10032947 3300009553 Bacteria 4689
219 Ga0105249_10118700 3300009553 Unclassified 2511
220 Ga0105249_10125977 3300009553 Bacteria 2439
221 Ga0105239_10053548 3300010375 Bacteria 4427
222 Ga0105239_10275889 3300010375 Bacteria 1892
223 Ga0105246_10020602 3300011119 Unclassified 4232
224 Ga0105246_10495291 3300011119 Bacteria 1037
225 Ga0157371_10128722 3300013102 Bacteria 1801
226 Ga0157371_10179911 3300013102 Unclassified 1512
227 Ga0157374_10056029 3300013296 Bacteria 3680
228 Ga0157374_10747238 3300013296 Bacteria 993
229 Ga0157378_10031302 3300013297 Bacteria 4700
230 Ga0157378_10158419 3300013297 Bacteria 2115
231 Ga0163162_10039741 3300013306 Bacteria 4702
232 Ga0157372_10544629 3300013307 Bacteria 1353
233 Ga0163163_10011699 3300014325 Bacteria 7970
234 Ga0163163_10069702 3300014325 Unclassified 3501
235 Ga0163163_10347981 3300014325 Unclassified 1538
236 Ga0163163_10418164 3300014325 Bacteria 1399
237 Ga0157379_10169626 3300014968 Bacteria 1970
238 Ga0157376_10497773 3300014969 Bacteria 1197
239 Ga0157376_10766308 3300014969 Bacteria 975
240 Ga0206353_10763093 3300020082 Bacteria 1433
241 Ga0213874_10005822 3300021377 Unclassified 2892
242 Ga0213876_10046022 3300021384 Bacteria 2307
243 Ga0213876_10059592 3300021384 Bacteria 2015
244 Ga0213871_10018966 3300021441 Bacteria 1689
245 Ga0228598_1000503 3300024227 Bacteria 8074
246 Ga0207426_1005146 3300025302 Bacteria 6088
247 Ga0207697_10005163 3300025315 Bacteria 6098
248 Ga0207697_10048072 3300025315 Bacteria 1759
249 Ga0207682_10037515 3300025893 Unclassified 1963
250 Ga0207682_10156776 3300025893 Bacteria 1029
251 Ga0207692_10047089 3300025898 Bacteria 2164
252 Ga0207688_10003641 3300025901 Bacteria 8413
253 Ga0207680_10172662 3300025903 Bacteria 1457
254 Ga0207680_10184417 3300025903 Bacteria 1413
255 Ga0207647_10116870 3300025904 Bacteria 1575
256 Ga0207685_10007024 3300025905 Plasmid 3110
257 Ga0207699_10099747 3300025906 Bacteria 1840
258 Ga0207645_10005695 3300025907 Bacteria 9001
259 Ga0207705_10017253 3300025909 Bacteria 5170
260 Ga0207684_10035939 3300025910 Bacteria 4205
261 Ga0207684_10082658 3300025910 Bacteria 2735
262 Ga0207684_10116763 3300025910 Bacteria 2287
263 Ga0207684_10233794 3300025910 Bacteria 1586
264 Ga0207684_10323860 3300025910 Unclassified 1328
265 Ga0207707_10008576 3300025912 Bacteria 8861
266 Ga0207707_10171038 3300025912 Bacteria 1899
267 Ga0207671_10184259 3300025914 Bacteria 1626
268 Ga0207693_10005262 3300025915 Bacteria 10822
269 Ga0207693_10036882 3300025915 Bacteria 3855
270 Ga0207693_10065770 3300025915 Bacteria 2839
271 Ga0207693_10087719 3300025915 Bacteria 2438
272 Ga0207693_10089569 3300025915 Bacteria 2412
273 Ga0207663_10058265 3300025916 Bacteria 2437
274 Ga0207660_10074422 3300025917 Bacteria 2479
275 Ga0207662_10269342 3300025918 Bacteria 1123
276 Ga0207657_10002924 3300025919 Bacteria 18333
277 Ga0207657_10075505 3300025919 Bacteria 2844
278 Ga0207657_10271887 3300025919 Bacteria 1347
279 Ga0207649_10258288 3300025920 Bacteria 1258
280 Ga0207652_10007768 3300025921 Bacteria 8617
281 Ga0207652_10059382 3300025921 Bacteria 3296
282 Ga0207646_10022313 3300025922 Bacteria 5834
283 Ga0207646_10130273 3300025922 Bacteria 2263
284 Ga0207646_10200326 3300025922 Bacteria 1803
285 Ga0207646_10267171 3300025922 Bacteria 1546
286 Ga0207681_10000060 3300025923 Bacteria 102672
287 Ga0207681_10179927 3300025923 Bacteria 1610
288 Ga0207694_10036322 3300025924 Bacteria 3781
289 Ga0207650_10000849 3300025925 Bacteria 23143
290 Ga0207650_10006354 3300025925 Bacteria 8049
291 Ga0207687_10064128 3300025927 Unclassified 2604
292 Ga0207700_10008550 3300025928 Bacteria 6350
293 Ga0207700_10111071 3300025928 Bacteria 2206
294 Ga0207700_10114617 3300025928 Unclassified 2175
295 Ga0207700_10199285 3300025928 Bacteria 1686
296 Ga0207700_10466794 3300025928 Bacteria 1114
297 Ga0207644_10000004 3300025931 Bacteria 566613
298 Ga0207644_10003272 3300025931 Bacteria 10467
299 Ga0207644_10155939 3300025931 Bacteria 1770
300 Ga0207690_10020157 3300025932 Bacteria 4116
301 Ga0207706_10009791 3300025933 Bacteria 8795
302 Ga0207706_10092782 3300025933 Bacteria 2655
303 Ga0207686_10185559 3300025934 Unclassified 1478
304 Ga0207669_10133961 3300025937 Bacteria 1708
305 Ga0207704_10137817 3300025938 Unclassified 1702
306 Ga0207665_10093570 3300025939 Bacteria 2087
307 Ga0207691_10001183 3300025940 Bacteria 25941
308 Ga0207711_10239164 3300025941 Bacteria 1665
309 Ga0207679_10020029 3300025945 Unclassified 4508
310 Ga0207679_10313849 3300025945 Bacteria 1355
311 Ga0207667_10159683 3300025949 Bacteria 2319
312 Ga0207651_10001512 3300025960 Bacteria 10610
313 Ga0207651_10088133 3300025960 Unclassified 2261
314 Ga0207668_10088587 3300025972 Bacteria 2267
315 Ga0207640_10049585 3300025981 Bacteria 2719
316 Ga0207658_10056891 3300025986 Bacteria 2904
317 Ga0207658_10448999 3300025986 Bacteria 1141
318 Ga0207678_10088952 3300026067 Bacteria 2640
319 Ga0207708_10091196 3300026075 Bacteria 2350
320 Ga0207702_10014127 3300026078 Bacteria 6631
321 Ga0207641_10283349 3300026088 Bacteria 1559
322 Ga0207648_10084497 3300026089 Bacteria 2769
323 Ga0207676_10225680 3300026095 Unclassified 1671
324 Ga0207676_10266506 3300026095 Bacteria 1549
325 Ga0207676_10409871 3300026095 Bacteria 1269
326 Ga0207674_10170445 3300026116 Unclassified 2130
327 Ga0207674_10227999 3300026116 Bacteria 1811
328 Ga0207675_100130921 3300026118 Bacteria 2379
329 Ga0207675_100360076 3300026118 Bacteria 1427
330 Ga0207683_10002580 3300026121 Bacteria 15823
331 Ga0207683_10248786 3300026121 Bacteria 1622
332 Ga0209995_1000167 3300027471 Bacteria 10492
333 Ga0209968_1004619 3300027526 Bacteria 2065
334 Ga0209999_1000190 3300027543 Bacteria 8462
335 Ga0209982_1011476 3300027552 Unclassified 1325
336 Ga0209983_1000130 3300027665 Bacteria 13459
337 Ga0209971_1000059 3300027682 Bacteria 35248
338 Ga0209971_1002186 3300027682 Bacteria 4754
339 Ga0209971_1009713 3300027682 Bacteria 2278
340 Ga0209966_1000284 3300027695 Bacteria 17367
341 Ga0209998_10000070 3300027717 Bacteria 40919
342 Ga0209998_10030709 3300027717 Bacteria 1188
343 Ga0209974_10018384 3300027876 Bacteria 2319
344 Ga0209974_10110548 3300027876 Bacteria 967
345 Ga0207428_10022286 3300027907 Bacteria 5348
346 Ga0207428_10230976 3300027907 Unclassified 1384
347 Ga0268266_10020289 3300028379 Bacteria 5667
348 Ga0268266_10113553 3300028379 Bacteria 2402
349 Ga0268264_10153479 3300028381 Bacteria 2067
350 Ga0268264_10368555 3300028381 Bacteria 1372
351 Ga0265334_10004014 3300028573 Bacteria 6605
352 Ga0265327_10000134 3300031251 Bacteria 163243
353 Ga0307405_10027746 3300031731 Bacteria 3288
354 Ga0307405_10240061 3300031731 Bacteria 1342
355 Ga0307406_10117841 3300031901 Unclassified 1840
356 Ga0307407_10092817 3300031903 Bacteria 1855
357 Ga0307412_10235791 3300031911 Bacteria 1412
358 Ga0307412_10408969 3300031911 Unclassified 1107
359 Ga0307409_100141778 3300031995 Bacteria 2072
360 Ga0307416_100018630 3300032002 Bacteria 4898
361 Ga0307416_100383641 3300032002 Unclassified 1436
362 Ga0307415_100081737 3300032126 Unclassified 2309
363 Ga0373953_0040583 3300035117 Bacteria 1849
364 Ga0373954_0073984 3300035118 Bacteria 1622
365 Ga0373943_0063954 3300035170 Bacteria 1846
366 Ga0373955_0084204 3300035172 Bacteria 1803
367 Ga0373931_0031798 3300035691 Bacteria 2727
368 Ga0373935_0183593 3300035692 Unclassified 1437
369 Ga0373935_0306279 3300035692 Unclassified 1124
370 Ga0373927_0014428 3300035695 Bacteria 5230
371 Ga0373927_0037856 3300035695 Bacteria 3134
372 Ga0373927_0268947 3300035695 Unclassified 1121
373 Ga0373933_0112126 3300035724 Bacteria 1702
374 Ga0373947_0578986 3300035725 Unclassified 765
375 Ga0373937_0135271 3300036401 Bacteria 2304
376 Ga0373925_0039792 3300037068 Bacteria 3479
377 Ga0395899_0010368 3300037312 Bacteria 7141
378 Ga0395898_0017464 3300037466 Bacteria 7326
379 Ga0395898_0128047 3300037466 Bacteria 2432
380 Ga0436364_0864180 3300037853 Bacteria 1289
381 Ga0395901_0049005 3300038443 Bacteria 4387
382 Ga0395901_0087304 3300038443 Bacteria 3261
383 Ga0395901_0346152 3300038443 Bacteria 1535
384 Ga0436365_0993424 3300039437 Bacteria 2039
385 Ga0436365_1430786 3300039437 Bacteria 2710
386 Ga0436360_1354875 3300039438 Bacteria 3294
387 Ga0436361_0060090 3300039447 Bacteria 1680
388 Ga0436361_0128756 3300039447 Bacteria 6191
389 Ga0436361_0258133 3300039447 Bacteria 1335
390 Ga0436361_1064100 3300039447 Bacteria 2122
391 Ga0436363_0664890 3300039450 Unclassified 3901
392 Ga0436362_0166311 3300039453 Bacteria 1782
393 Ga0436362_0716707 3300039453 Bacteria 2476
394 Ga0451855_0797931 3300041511 Unclassified 911
395 Ga0439464_0002586 3300042439 Bacteria 4471
396 Ga0439460_0000163 3300042461 Bacteria 12351
397 Ga0466963_0018189 3300044694 Bacteria 4389
398 Ga0453684_0448669 3300044712 Bacteria 1436
399 Ga0451576_0093848 3300045051 Bacteria 3120
400 Ga0451576_0147042 3300045051 Bacteria 2457
401 Ga0466967_0114047 3300045976 Bacteria 2487
402 Ga0466967_0144411 3300045976 Bacteria 2219
403 Ga0495592_0064372 3300046454 Bacteria 2687
404 Ga0495603_0054719 3300046455 Bacteria 2365
405 Ga0495629_0099387 3300046459 Bacteria 2030
406 Ga0495651_0020226 3300046462 Bacteria 5165
407 Ga0495653_0069305 3300046463 Bacteria 2643
408 Ga0495580_0022986 3300046472 Bacteria 4585
409 Ga0495580_0164143 3300046472 Bacteria 1537
410 Ga0495580_0357520 3300046472 Bacteria 989
411 Ga0495664_0176403 3300046477 Unclassified 1296
412 Ga0495608_0065926 3300046511 Bacteria 2371
413 Ga0495618_0078256 3300046514 Bacteria 2108
414 Ga0495630_0134688 3300046517 Bacteria 1877
415 Ga0495652_0048591 3300046529 Bacteria 3634
416 Ga0495640_0028725 3300046533 Bacteria 4001
417 Ga0495586_0131075 3300046535 Unclassified 1404
418 Ga0495587_0091993 3300046536 Bacteria 1751
419 Ga0495645_0133681 3300046543 Bacteria 1736
420 Ga0495667_0198776 3300046559 Bacteria 1283
421 Ga0495634_0140592 3300046642 Bacteria 1533
422 Ga0495623_0045241 3300046679 Bacteria 2796
423 Ga0495613_0214225 3300046689 Bacteria 1354
424 Ga0495624_0075570 3300046690 Bacteria 2092
425 Ga0495600_0141379 3300046809 Unclassified 1562
426 Ga0495604_0085129 3300047317 Bacteria 2359
427 Ga0495674_0055103 3300047319 Bacteria 3488
428 Ga0495675_0029971 3300047444 Bacteria 3471
429 Ga0495684_0202686 3300047471 Bacteria 1462
430 Ga0495602_0040478 3300048088 Bacteria 4272
431 Ga0495602_0165572 3300048088 Unclassified 1721
432 Ga0496100_0073172 3300048903 Bacteria 2293
433 Ga0496100_0355870 3300048903 Unclassified 1107
434 Ga0496101_0014017 3300048904 Bacteria 5384
435 Ga0496101_0060280 3300048904 Bacteria 2753
436 Ga0496101_0061036 3300048904 Unclassified 2737
437 Ga0496102_0088699 3300048905 Bacteria 2860
438 Ga0496103_0052139 3300048906 Bacteria 2534
439 Ga0496103_0157979 3300048906 Unclassified 1454
440 Ga0496104_0049480 3300048907 Unclassified 3964
441 Ga0496104_0056332 3300048907 Bacteria 3717
442 Ga0496104_0086113 3300048907 Bacteria 3000
443 Ga0496104_0147948 3300048907 Bacteria 2255
444 Ga0496104_0391004 3300048907 Unclassified 1303
445 Ga0496106_0014441 3300048909 Bacteria 5835
446 Ga0496107_0204259 3300048910 Unclassified 1469
447 Ga0496107_0357377 3300048910 Bacteria 1087
448 Ga0496108_0000044 3300048911 Bacteria 139925
449 Ga0496108_0008334 3300048911 Bacteria 8407
450 Ga0496108_0141279 3300048911 Bacteria 2074
451 Ga0496108_0253153 3300048911 Bacteria 1532
452 Ga0496108_0273230 3300048911 Bacteria 1471
453 Ga0496109_0028170 3300048912 Bacteria 5023
454 Ga0496109_0271103 3300048912 Bacteria 1599
455 Ga0496110_0010668 3300048913 Bacteria 7481
456 Ga0496110_0126090 3300048913 Bacteria 2310
457 Ga0496110_0203016 3300048913 Bacteria 1801
458 Ga0496111_0004575 3300048914 Bacteria 8759
459 Ga0496111_0050658 3300048914 Bacteria 2996
460 Ga0496111_0319847 3300048914 Bacteria 1149
461 Ga0496112_0015162 3300048915 Bacteria 7182
462 Ga0496112_0023311 3300048915 Bacteria 5912
463 Ga0496112_0108760 3300048915 Unclassified 2743
464 Ga0496112_0145252 3300048915 Bacteria 2340
465 Ga0496112_0172192 3300048915 Unclassified 2130
466 Ga0496112_0181474 3300048915 Unclassified 2069
467 Ga0496113_0005399 3300048916 Bacteria 7965
468 Ga0496113_0013821 3300048916 Bacteria 5484
469 Ga0496115_0125337 3300048918 Bacteria 2115
470 Ga0501033_0090883 3300049570 Bacteria 2233
471 Ga0501033_0374342 3300049570 Unclassified 995
472 Ga0501034_0001028 3300049571 Bacteria 39941
473 Ga0501034_0003390 3300049571 Bacteria 18201
474 Ga0501034_0122213 3300049571 Bacteria 2590
475 Ga0501034_0244902 3300049571 Bacteria 1738
476 Ga0501036_0280807 3300049572 Bacteria 1394
477 Ga0501038_0081061 3300049574 Bacteria 2734
478 Ga0501038_0347453 3300049574 Bacteria 1156
479 Ga0501039_0093227 3300049575 Bacteria 2347
480 Ga0501040_0002645 3300049576 Bacteria 11552
481 Ga0501040_0205339 3300049576 Bacteria 1399
482 Ga0501041_0035120 3300049577 Bacteria 3037
483 Ga0501041_0069752 3300049577 Bacteria 2157
484 Ga0501043_0100981 3300049579 Bacteria 2268
485 Ga0501046_0004847 3300049580 Bacteria 12122
486 Ga0501047_0287517 3300049581 Bacteria 1488
487 Ga0501068_0151094 3300049584 Bacteria 1459
488 Ga0501069_0112419 3300049585 Bacteria 1552
489 Ga0501070_0002135 3300049586 Bacteria 17358
490 Ga0501070_0075484 3300049586 Bacteria 2791
491 Ga0501071_0128347 3300049587 Bacteria 1883
492 Ga0501071_0230995 3300049587 Bacteria 1393
493 Ga0501072_0023084 3300049588 Bacteria 4830
494 Ga0501072_0057884 3300049588 Bacteria 3055
495 Ga0501072_0160089 3300049588 Bacteria 1796
496 Ga0501073_0042236 3300049589 Bacteria 3219
497 Ga0501075_0072200 3300049591 Unclassified 2609
498 Ga0501075_0216834 3300049591 Bacteria 1460
499 Ga0501075_0431235 3300049591 Bacteria 1005
500 Ga0501076_0051314 3300049592 Bacteria 3265
501 Ga0501076_0389169 3300049592 Bacteria 1146
502 Ga0501077_0015535 3300049593 Bacteria 4794
503 Ga0501077_0025396 3300049593 Bacteria 3763
504 Ga0501077_0061580 3300049593 Bacteria 2381
505 Ga0501079_0028390 3300049741 Bacteria 4293
506 Ga0501079_0035882 3300049741 Bacteria 3818
507 Ga0501079_0318969 3300049741 Unclassified 1216
508 Ga0501079_0467753 3300049741 Bacteria 991
509 Ga0501080_0000532 3300049742 Bacteria 29975
510 Ga0501080_0002162 3300049742 Bacteria 17080
511 Ga0501080_0218905 3300049742 Bacteria 1743
512 Ga0501080_0325510 3300049742 Bacteria 1391
513 Ga0501080_0367113 3300049742 Bacteria 1298
514 Ga0501081_0001014 3300049743 Bacteria 16751
515 Ga0501081_0002579 3300049743 Bacteria 11450
516 Ga0501081_0190510 3300049743 Bacteria 1485
517 Ga0501083_0023416 3300049744 Bacteria 4283
518 Ga0501083_0043530 3300049744 Bacteria 3041
519 Ga0501035_0303128 3300049822 Bacteria 1346
520 Ga0501044_0099811 3300049823 Bacteria 2921
521 Ga0501044_0144114 3300049823 Bacteria 2369
522 Ga0501044_0282195 3300049823 Bacteria 1594
523 Ga0501045_0025006 3300049824 Bacteria 4290
524 Ga0501045_0066316 3300049824 Bacteria 2651
525 Ga0501045_0088332 3300049824 Bacteria 2290
526 Ga0501045_0211721 3300049824 Bacteria 1444
527 Ga0501045_0396200 3300049824 Bacteria 1027
528 nmdc:mga03683_4034_c1 3300050489 Bacteria 4817
529 nmdc:mga00v17_159968_c1 3300050491 Bacteria 1449
530 nmdc:mga00v17_333751_c1 3300050491 Bacteria 985
531 nmdc:mga0yw44_148726_c1 3300050492 Bacteria 1527
532 nmdc:mga0yw44_258681_c1 3300050492 Bacteria 1160
533 nmdc:mga0yw44_352367_c1 3300050492 Bacteria 991
534 nmdc:mga0yw44_9269_c1 3300050492 Bacteria 4961
535 nmdc:mga0k408_229281_c1 3300050493 Bacteria 1109
536 nmdc:mga0k408_89093_c1 3300050493 Bacteria 1812
537 nmdc:mga06z11_112641_c1 3300050494 Bacteria 1508
538 nmdc:mga06z11_212884_c1 3300050494 Bacteria 1127
539 nmdc:mga06z11_225723_c1 3300050494 Bacteria 1096
540 nmdc:mga07m45_4096_c2 3300050496 Bacteria 2831
541 nmdc:mga05p37_149998_c1 3300050507 Bacteria 2852
542 nmdc:mga05p37_166872_c1 3300050507 Bacteria 2686
543 nmdc:mga05p37_1833_c1 3300050507 Bacteria 24787
544 nmdc:mga05p37_185608_c1 3300050507 Bacteria 2528
545 nmdc:mga05p37_203139_c1 3300050507 Bacteria 2399
546 nmdc:mga05p37_2151_c1 3300050507 Bacteria 22996
547 nmdc:mga05p37_278664_c1 3300050507 Unclassified 1995
548 nmdc:mga05p37_293964_c1 3300050507 Bacteria 1933
549 nmdc:mga05p37_31085_c1 3300050507 Bacteria 6520
550 nmdc:mga05p37_416463_c1 3300050507 Bacteria 1565
551 nmdc:mga05p37_53652_c1 3300050507 Bacteria 4958
552 nmdc:mga09592_15934_c1 3300050508 Bacteria 6141
553 nmdc:mga09592_24442_c1 3300050508 Bacteria 4997
554 nmdc:mga09592_300166_c1 3300050508 Unclassified 1393
555 nmdc:mga09592_356777_c1 3300050508 Bacteria 1265
556 nmdc:mga09592_93915_c1 3300050508 Unclassified 2565
557 nmdc:mga0qj67_124337_c1 3300050509 Bacteria 2087
558 nmdc:mga0qj67_147086_c1 3300050509 Bacteria 1911
559 nmdc:mga06r32_186040_c1 3300050510 Bacteria 2064
560 nmdc:mga06r32_206871_c1 3300050510 Unclassified 1950
561 nmdc:mga06r32_265843_c1 3300050510 Bacteria 1702
562 nmdc:mga06r32_368102_c1 3300050510 Bacteria 1421
563 nmdc:mga06r32_58221_c1 3300050510 Bacteria 3714
564 nmdc:mga06r32_63501_c1 3300050510 Bacteria 3560
565 nmdc:mga08y16_122127_c1 3300050511 Bacteria 2710
566 nmdc:mga08y16_365464_c1 3300050511 Bacteria 1481
567 nmdc:mga08y16_5512_c1 3300050511 Bacteria 13242
568 nmdc:mga08y16_83079_c1 3300050511 Unclassified 3338
569 nmdc:mga08y16_89309_c1 3300050511 Unclassified 3211
570 nmdc:mga0n895_123406_c1 3300050512 Bacteria 2612
571 nmdc:mga0n895_130519_c1 3300050512 Bacteria 2538
572 nmdc:mga0n895_179324_c1 3300050512 Bacteria 2149
573 nmdc:mga0n895_218_c1 3300050512 Bacteria 36114
574 nmdc:mga0n895_247208_c1 3300050512 Bacteria 1810
575 nmdc:mga0n895_251351_c1 3300050512 Bacteria 1794
576 nmdc:mga0n895_324274_c1 3300050512 Unclassified 1561
577 nmdc:mga0n895_5315_c1 3300050512 Bacteria 10729
578 nmdc:mga0rr50_339320_c1 3300050513 Unclassified 1262
579 nmdc:mga0rr50_365802_c1 3300050513 Bacteria 1214
580 nmdc:mga0rr50_47252_c1 3300050513 Unclassified 3174
581 nmdc:mga0rr50_68735_c1 3300050513 Unclassified 2694
582 nmdc:mga08x19_180415_c1 3300050514 Unclassified 1441
583 nmdc:mga08x19_210306_c1 3300050514 Bacteria 1335
584 nmdc:mga08x19_71360_c1 3300050514 Bacteria 2264
585 nmdc:mga0a205_117590_c1 3300050515 Unclassified 2556
586 nmdc:mga0a205_201525_c1 3300050515 Bacteria 1880
587 nmdc:mga0a205_217973_c1 3300050515 Unclassified 1795
588 nmdc:mga0a205_283645_c1 3300050515 Bacteria 1531
589 nmdc:mga0a205_294847_c1 3300050515 Bacteria 1496
590 nmdc:mga0a205_7820_c1 3300050515 Bacteria 9710
591 nmdc:mga0sz30_2099_c1 3300050516 Bacteria 7119
592 Ga0495612_0096246 3300053078 Unclassified 1258
593 Ga0495619_0098243 3300053085 Unclassified 1990
594 Ga0495619_0169516 3300053085 Unclassified 1509
595 Ga0495619_0435810 3300053085 Unclassified 904
596 Ga0500647_0032829 3300053091 Bacteria 2474
597 Ga0500641_0001537 3300053096 Bacteria 8243
598 Ga0500616_0003334 3300053153 Bacteria 12368
599 Ga0500552_000026 3300053733 Bacteria 15022
600 Ga0501084_0009170 3300054114 Bacteria 8184
601 Ga0501084_0157712 3300054114 Bacteria 1914
602 Ga0501084_0210197 3300054114 Bacteria 1642
603 Ga0501082_0034360 3300060353 Bacteria 4372
604 Ga0501082_0121822 3300060353 Bacteria 2261
605 Ga0501082_0268180 3300060353 Bacteria 1485
606 Ga0501082_0299144 3300060353 Bacteria 1401
607 Ga0530510_0017394 3300061734 Bacteria 5096
608 Ga0530510_0050448 3300061734 Bacteria 3006
609 Ga0530510_0153059 3300061734 Bacteria 1704
610 Ga0081455_10054153
611 JGI25405J52794_10002580
612 Ga0065712_10000192
613 Ga0065712_10068833
614 Ga0065707_10001258
615 Ga0065707_10103559
616 Ga0070658_10014471
617 Ga0070658_10144020
618 Ga0070676_10145876
619 Ga0070683_100042874
620 Ga0070690_100008194
621 Ga0070670_100002869
622 Ga0070670_100054294
623 Ga0070666_10012449
624 Ga0070666_10245935
625 Ga0070680_100000963
626 Ga0070680_100018605
627 Ga0070682_100157311
628 Ga0070660_100099480
629 Ga0070689_100068070
630 Ga0070689_100154556
631 Ga0070691_10016508
632 Ga0070691_10033215
633 Ga0070661_100008331
634 Ga0070661_100301781
635 Ga0070668_100083216
636 Ga0070668_100097614
637 Ga0070669_100000083
638 Ga0070669_100520662
639 Ga0070671_100000107
640 Ga0070671_100005051
641 Ga0070671_100134526
642 Ga0070674_100067568
643 Ga0070673_100003554
644 Ga0070673_100056700
645 Ga0070673_100386568
646 Ga0070659_100255601
647 Ga0070667_100080410
648 Ga0070667_100147298
649 Ga0070709_10041470
650 Ga0070713_100010292
651 Ga0070713_100080680
652 Ga0070713_100086649
653 Ga0070713_100114497
654 Ga0070713_100206278
655 Ga0070711_100040252
656 Ga0070711_100139566
657 Ga0070705_100039290
658 Ga0070694_100005793
659 Ga0070694_100331869
660 Ga0070708_100011789
661 Ga0070708_100030127
662 Ga0070708_100184128
663 Ga0070708_100313033
664 Ga0070708_100402394
665 Ga0070663_100107247
666 Ga0070681_10001454
667 Ga0070681_10042676
668 Ga0070681_10291298
669 Ga0070706_100013613
670 Ga0070706_100018867
671 Ga0070706_100092418
672 Ga0070706_100137109
673 Ga0070706_100737672
674 Ga0070707_100005226
675 Ga0070707_100009552
676 Ga0070707_100048008
677 Ga0070707_100241525
678 Ga0070698_100000120
679 Ga0070699_100037694
680 Ga0070679_100049144
681 Ga0070679_100078202
682 Ga0070684_100033713
683 Ga0070697_100118375
684 Ga0070697_100321893
685 Ga0070697_100425131
686 Ga0070686_100076882
687 Ga0070686_100139353
688 Ga0070686_100242897
689 Ga0070695_100002453
690 Ga0070696_100012941
691 Ga0070696_100185349
692 Ga0070665_100025432
693 Ga0070665_100155787
694 Ga0070704_100090993
695 Ga0070704_100133452
696 Ga0068855_100309091
697 Ga0068855_100329272
698 Ga0070664_100003476
699 Ga0070664_100013472
700 Ga0070664_100327358
701 Ga0068857_100127275
702 Ga0068857_100556500
703 Ga0068854_100089311
704 Ga0068856_100007474
705 Ga0068856_100080466
706 Ga0068856_100410117
707 Ga0068856_100570187
708 Ga0068852_100372739
709 Ga0068859_100330292
710 Ga0068864_100061202
711 Ga0068861_100100340
712 Ga0068863_100200038
713 Ga0068858_100242515
714 Ga0068860_100120191
715 Ga0081455_10003454
716 Ga0081455_10003851
717 Ga0081455_10006131
718 Ga0081455_10012066
719 Ga0081455_10015656
720 Ga0081455_10015809
721 Ga0081455_10114996
722 Ga0081455_10120055
723 Ga0081538_10002702
724 Ga0081538_10027065
725 Ga0081538_10045459
726 Ga0081538_10100116
727 Ga0081540_1008211
728 Ga0081540_1011593
729 Ga0081540_1106563
730 Ga0081539_10001324
731 Ga0081539_10127606
732 Ga0070717_10051629
733 Ga0070717_10055979
734 Ga0075365_10035345
735 Ga0075365_10235427
736 Ga0070715_10027992
737 Ga0070712_100001861
738 Ga0070712_100026868
739 Ga0070712_100102969
740 Ga0070712_100103929
741 Ga0070712_100281880
742 Ga0075362_10017765
743 Ga0075362_10021321
744 Ga0075367_10031983
745 Ga0075367_10224644
746 Ga0075369_10000095
747 Ga0075366_10040568
748 Ga0075366_10061081
749 Ga0068871_100030590
750 Ga0075428_100002224
751 Ga0075428_100006080
752 Ga0075428_100040588
753 Ga0075428_100062111
754 Ga0075428_100115567
755 Ga0075428_100161703
756 Ga0075428_100216603
757 Ga0075428_100505650
758 Ga0075430_100096907
759 Ga0075430_100446067
760 Ga0075431_100001942
761 Ga0075431_100109705
762 Ga0075431_100135433
763 Ga0075431_100147037
764 Ga0075431_100273080
765 Ga0075431_100292735
766 Ga0075431_100453474
767 Ga0075431_100634187
768 Ga0075433_10242087
769 Ga0075433_10414151
770 Ga0075434_100021182
771 Ga0075434_100024361
772 Ga0075434_100154634
773 Ga0075434_100190408
774 Ga0075434_100192941
775 Ga0075434_100359840
776 Ga0075434_100380374
777 Ga0075434_100409893
778 Ga0075434_100481419
779 Ga0075429_100025451
780 Ga0075429_100028600
781 Ga0075429_100067251
782 Ga0075429_100090442
783 Ga0075436_100064792
784 Ga0075436_100105083
785 Ga0075436_100240705
786 Ga0075436_100342291
787 Ga0097620_100330268
788 Ga0075435_100025689
789 Ga0075435_100081784
790 Ga0075435_100191409
791 Ga0075435_100293829
792 Ga0075435_100369653
793 Ga0075435_100372410
794 Ga0075435_100452713
795 Ga0099795_10063048
796 Ga0111539_10003908
797 Ga0111539_10007174
798 Ga0111539_10040326
799 Ga0111539_10051979
800 Ga0111539_10117561
801 Ga0111539_10221168
802 Ga0111539_10281677
803 Ga0111539_10631780
804 Ga0111539_10655888
805 Ga0105247_10009114
806 Ga0114129_10001545
807 Ga0114129_10026432
808 Ga0114129_10029236
809 Ga0114129_10034237
810 Ga0114129_10067514
811 Ga0114129_10158805
812 Ga0114129_10195686
813 Ga0114129_10208915
814 Ga0114129_10226212
815 Ga0114129_10261175
816 Ga0114129_10262051
817 Ga0114129_10393136
818 Ga0114129_10720942
819 Ga0105243_10498954
820 Ga0105242_10030709
821 Ga0105248_10033989
822 Ga0105248_10236008
823 Ga0105248_10399565
824 Ga0105248_10930066
825 Ga0105237_10720265
826 Ga0105238_10115356
827 Ga0105249_10032947
828 Ga0105249_10118700
829 Ga0105249_10125977
830 Ga0105239_10053548
831 Ga0105239_10275889
832 Ga0105246_10020602
833 Ga0105246_10495291
834 Ga0157371_10128722
835 Ga0157371_10179911
836 Ga0157374_10056029
837 Ga0157374_10747238
838 Ga0157378_10031302
839 Ga0157378_10158419
840 Ga0163162_10039741
841 Ga0157372_10544629
842 Ga0163163_10011699
843 Ga0163163_10069702
844 Ga0163163_10347981
845 Ga0163163_10418164
846 Ga0157379_10169626
847 Ga0157376_10497773
848 Ga0157376_10766308
849 Ga0206353_10763093
850 Ga0213874_10005822
851 Ga0213876_10046022
852 Ga0213876_10059592
853 Ga0213871_10018966
854 Ga0228598_1000503
855 Ga0207426_1005146
856 Ga0207697_10005163
857 Ga0207697_10048072
858 Ga0207682_10037515
859 Ga0207682_10156776
860 Ga0207692_10047089
861 Ga0207688_10003641
862 Ga0207680_10172662
863 Ga0207680_10184417
864 Ga0207647_10116870
865 Ga0207685_10007024
866 Ga0207699_10099747
867 Ga0207645_10005695
868 Ga0207705_10017253
869 Ga0207684_10035939
870 Ga0207684_10082658
871 Ga0207684_10116763
872 Ga0207684_10233794
873 Ga0207684_10323860
874 Ga0207707_10008576
875 Ga0207707_10171038
876 Ga0207671_10184259
877 Ga0207693_10005262
878 Ga0207693_10036882
879 Ga0207693_10065770
880 Ga0207693_10087719
881 Ga0207693_10089569
882 Ga0207663_10058265
883 Ga0207660_10074422
884 Ga0207662_10269342
885 Ga0207657_10002924
886 Ga0207657_10075505
887 Ga0207657_10271887
888 Ga0207649_10258288
889 Ga0207652_10007768
890 Ga0207652_10059382
891 Ga0207646_10022313
892 Ga0207646_10130273
893 Ga0207646_10200326
894 Ga0207646_10267171
895 Ga0207681_10000060
896 Ga0207681_10179927
897 Ga0207694_10036322
898 Ga0207650_10000849
899 Ga0207650_10006354
900 Ga0207687_10064128
901 Ga0207700_10008550
902 Ga0207700_10111071
903 Ga0207700_10114617
904 Ga0207700_10199285
905 Ga0207700_10466794
906 Ga0207644_10000004
907 Ga0207644_10003272
908 Ga0207644_10155939
909 Ga0207690_10020157
910 Ga0207706_10009791
911 Ga0207706_10092782
912 Ga0207686_10185559
913 Ga0207669_10133961
914 Ga0207704_10137817
915 Ga0207665_10093570
916 Ga0207691_10001183
917 Ga0207711_10239164
918 Ga0207679_10020029
919 Ga0207679_10313849
920 Ga0207667_10159683
921 Ga0207651_10001512
922 Ga0207651_10088133
923 Ga0207668_10088587
924 Ga0207640_10049585
925 Ga0207658_10056891
926 Ga0207658_10448999
927 Ga0207678_10088952
928 Ga0207708_10091196
929 Ga0207702_10014127
930 Ga0207641_10283349
931 Ga0207648_10084497
932 Ga0207676_10225680
933 Ga0207676_10266506
934 Ga0207676_10409871
935 Ga0207674_10170445
936 Ga0207674_10227999
937 Ga0207675_100130921
938 Ga0207675_100360076
939 Ga0207683_10002580
940 Ga0207683_10248786
941 Ga0209995_1000167
942 Ga0209968_1004619
943 Ga0209999_1000190
944 Ga0209982_1011476
945 Ga0209983_1000130
946 Ga0209971_1000059
947 Ga0209971_1002186
948 Ga0209971_1009713
949 Ga0209966_1000284
950 Ga0209998_10000070
951 Ga0209998_10030709
952 Ga0209974_10018384
953 Ga0209974_10110548
954 Ga0207428_10022286
955 Ga0207428_10230976
956 Ga0268266_10020289
957 Ga0268266_10113553
958 Ga0268264_10153479
959 Ga0268264_10368555
960 Ga0265334_10004014
961 Ga0265327_10000134
962 Ga0307405_10027746
963 Ga0307405_10240061
964 Ga0307406_10117841
965 Ga0307407_10092817
966 Ga0307412_10235791
967 Ga0307412_10408969
968 Ga0307409_100141778
969 Ga0307416_100018630
970 Ga0307416_100383641
971 Ga0307415_100081737
972 Ga0373953_0040583
973 Ga0373954_0073984
974 Ga0373943_0063954
975 Ga0373955_0084204
976 Ga0373931_0031798
977 Ga0373935_0183593
978 Ga0373935_0306279
979 Ga0373927_0014428
980 Ga0373927_0037856
981 Ga0373927_0268947
982 Ga0373933_0112126
983 Ga0373947_0578986
984 Ga0373937_0135271
985 Ga0373925_0039792
986 Ga0395899_0010368
987 Ga0395898_0017464
988 Ga0395898_0128047
989 Ga0436364_0864180
990 Ga0395901_0049005
991 Ga0395901_0087304
992 Ga0395901_0346152
993 Ga0436365_0993424
994 Ga0436365_1430786
995 Ga0436360_1354875
996 Ga0436361_0060090
997 Ga0436361_0128756
998 Ga0436361_0258133
999 Ga0436361_1064100
1000 Ga0436363_0664890
1001 Ga0436362_0166311
1002 Ga0436362_0716707
1003 Ga0451855_0797931
1004 Ga0439464_0002586
1005 Ga0439460_0000163
1006 Ga0466963_0018189
1007 Ga0453684_0448669
1008 Ga0451576_0093848
1009 Ga0451576_0147042
1010 Ga0466967_0114047
1011 Ga0466967_0144411
1012 Ga0495592_0064372
1013 Ga0495603_0054719
1014 Ga0495629_0099387
1015 Ga0495651_0020226
1016 Ga0495653_0069305
1017 Ga0495580_0022986
1018 Ga0495580_0164143
1019 Ga0495580_0357520
1020 Ga0495664_0176403
1021 Ga0495608_0065926
1022 Ga0495618_0078256
1023 Ga0495630_0134688
1024 Ga0495652_0048591
1025 Ga0495640_0028725
1026 Ga0495586_0131075
1027 Ga0495587_0091993
1028 Ga0495645_0133681
1029 Ga0495667_0198776
1030 Ga0495634_0140592
1031 Ga0495623_0045241
1032 Ga0495613_0214225
1033 Ga0495624_0075570
1034 Ga0495600_0141379
1035 Ga0495604_0085129
1036 Ga0495674_0055103
1037 Ga0495675_0029971
1038 Ga0495684_0202686
1039 Ga0495602_0040478
1040 Ga0495602_0165572
1041 Ga0496100_0073172
1042 Ga0496100_0355870
1043 Ga0496101_0014017
1044 Ga0496101_0060280
1045 Ga0496101_0061036
1046 Ga0496102_0088699
1047 Ga0496103_0052139
1048 Ga0496103_0157979
1049 Ga0496104_0049480
1050 Ga0496104_0056332
1051 Ga0496104_0086113
1052 Ga0496104_0147948
1053 Ga0496104_0391004
1054 Ga0496106_0014441
1055 Ga0496107_0204259
1056 Ga0496107_0357377
1057 Ga0496108_0000044
1058 Ga0496108_0008334
1059 Ga0496108_0141279
1060 Ga0496108_0253153
1061 Ga0496108_0273230
1062 Ga0496109_0028170
1063 Ga0496109_0271103
1064 Ga0496110_0010668
1065 Ga0496110_0126090
1066 Ga0496110_0203016
1067 Ga0496111_0004575
1068 Ga0496111_0050658
1069 Ga0496111_0319847
1070 Ga0496112_0015162
1071 Ga0496112_0023311
1072 Ga0496112_0108760
1073 Ga0496112_0145252
1074 Ga0496112_0172192
1075 Ga0496112_0181474
1076 Ga0496113_0005399
1077 Ga0496113_0013821
1078 Ga0496115_0125337
1079 Ga0501033_0090883
1080 Ga0501033_0374342
1081 Ga0501034_0001028
1082 Ga0501034_0003390
1083 Ga0501034_0122213
1084 Ga0501034_0244902
1085 Ga0501036_0280807
1086 Ga0501038_0081061
1087 Ga0501038_0347453
1088 Ga0501039_0093227
1089 Ga0501040_0002645
1090 Ga0501040_0205339
1091 Ga0501041_0035120
1092 Ga0501041_0069752
1093 Ga0501043_0100981
1094 Ga0501046_0004847
1095 Ga0501047_0287517
1096 Ga0501068_0151094
1097 Ga0501069_0112419
1098 Ga0501070_0002135
1099 Ga0501070_0075484
1100 Ga0501071_0128347
1101 Ga0501071_0230995
1102 Ga0501072_0023084
1103 Ga0501072_0057884
1104 Ga0501072_0160089
1105 Ga0501073_0042236
1106 Ga0501075_0072200
1107 Ga0501075_0216834
1108 Ga0501075_0431235
1109 Ga0501076_0051314
1110 Ga0501076_0389169
1111 Ga0501077_0015535
1112 Ga0501077_0025396
1113 Ga0501077_0061580
1114 Ga0501079_0028390
1115 Ga0501079_0035882
1116 Ga0501079_0318969
1117 Ga0501079_0467753
1118 Ga0501080_0000532
1119 Ga0501080_0002162
1120 Ga0501080_0218905
1121 Ga0501080_0325510
1122 Ga0501080_0367113
1123 Ga0501081_0001014
1124 Ga0501081_0002579
1125 Ga0501081_0190510
1126 Ga0501083_0023416
1127 Ga0501083_0043530
1128 Ga0501035_0303128
1129 Ga0501044_0099811
1130 Ga0501044_0144114
1131 Ga0501044_0282195
1132 Ga0501045_0025006
1133 Ga0501045_0066316
1134 Ga0501045_0088332
1135 Ga0501045_0211721
1136 Ga0501045_0396200
1137 nmdc:mga03683_4034_c1
1138 nmdc:mga00v17_159968_c1
1139 nmdc:mga00v17_333751_c1
1140 nmdc:mga0yw44_148726_c1
1141 nmdc:mga0yw44_258681_c1
1142 nmdc:mga0yw44_352367_c1
1143 nmdc:mga0yw44_9269_c1
1144 nmdc:mga0k408_229281_c1
1145 nmdc:mga0k408_89093_c1
1146 nmdc:mga06z11_112641_c1
1147 nmdc:mga06z11_212884_c1
1148 nmdc:mga06z11_225723_c1
1149 nmdc:mga07m45_4096_c2
1150 nmdc:mga05p37_149998_c1
1151 nmdc:mga05p37_166872_c1
1152 nmdc:mga05p37_1833_c1
1153 nmdc:mga05p37_185608_c1
1154 nmdc:mga05p37_203139_c1
1155 nmdc:mga05p37_2151_c1
1156 nmdc:mga05p37_278664_c1
1157 nmdc:mga05p37_293964_c1
1158 nmdc:mga05p37_31085_c1
1159 nmdc:mga05p37_416463_c1
1160 nmdc:mga05p37_53652_c1
1161 nmdc:mga09592_15934_c1
1162 nmdc:mga09592_24442_c1
1163 nmdc:mga09592_300166_c1
1164 nmdc:mga09592_356777_c1
1165 nmdc:mga09592_93915_c1
1166 nmdc:mga0qj67_124337_c1
1167 nmdc:mga0qj67_147086_c1
1168 nmdc:mga06r32_186040_c1
1169 nmdc:mga06r32_206871_c1
1170 nmdc:mga06r32_265843_c1
1171 nmdc:mga06r32_368102_c1
1172 nmdc:mga06r32_58221_c1
1173 nmdc:mga06r32_63501_c1
1174 nmdc:mga08y16_122127_c1
1175 nmdc:mga08y16_365464_c1
1176 nmdc:mga08y16_5512_c1
1177 nmdc:mga08y16_83079_c1
1178 nmdc:mga08y16_89309_c1
1179 nmdc:mga0n895_123406_c1
1180 nmdc:mga0n895_130519_c1
1181 nmdc:mga0n895_179324_c1
1182 nmdc:mga0n895_218_c1
1183 nmdc:mga0n895_247208_c1
1184 nmdc:mga0n895_251351_c1
1185 nmdc:mga0n895_324274_c1
1186 nmdc:mga0n895_5315_c1
1187 nmdc:mga0rr50_339320_c1
1188 nmdc:mga0rr50_365802_c1
1189 nmdc:mga0rr50_47252_c1
1190 nmdc:mga0rr50_68735_c1
1191 nmdc:mga08x19_180415_c1
1192 nmdc:mga08x19_210306_c1
1193 nmdc:mga08x19_71360_c1
1194 nmdc:mga0a205_117590_c1
1195 nmdc:mga0a205_201525_c1
1196 nmdc:mga0a205_217973_c1
1197 nmdc:mga0a205_283645_c1
1198 nmdc:mga0a205_294847_c1
1199 nmdc:mga0a205_7820_c1
1200 nmdc:mga0sz30_2099_c1
1201 Ga0495612_0096246
1202 Ga0495619_0098243
1203 Ga0495619_0169516
1204 Ga0495619_0435810
1205 Ga0500647_0032829
1206 Ga0500641_0001537
1207 Ga0500616_0003334
1208 Ga0500552_000026
1209 Ga0501084_0009170
1210 Ga0501084_0157712
1211 Ga0501084_0210197
1212 Ga0501082_0034360
1213 Ga0501082_0121822
1214 Ga0501082_0268180
1215 Ga0501082_0299144
1216 Ga0530510_0017394
1217 Ga0530510_0050448
1218 Ga0530510_0153059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

39

315

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w4z-assembly1.cif.gz_A crystal structure of riboflavin lyase (rcae) with modified fmn and substrate riboflavin 0.8194 2 277
2b81-assembly2.cif.gz_C crystal structure of the luciferase-like monooxygenase from bacillus cereus 0.8094 1 276
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.8081 2 283
3rao-assembly2.cif.gz_A-2 crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8043 2 284
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.8037 1 280
ID Description Score Start End Superfamily
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8555 20 284 3.20.20.30
af_P71701_5_258_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8483 2 275 3.20.20.30
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8433 20 284 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8359 1 285 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8341 1 284 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A3N5M3D6-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9732 1 285 GO:0008726
GO:0046306
AF-A0A2D8LF62-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9471 1 285 GO:0008726
GO:0046306
AF-A0A2D8LF62-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9439 1 285 GO:0008726
GO:0046306
AF-A0A2E6YJT3-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9363 1 281 GO:0008726
GO:0046306
AF-A0A2E9UV59-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9348 2 285 GO:0008726
GO:0046306

Map