F468815
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 608 | 342 | 588 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300046518|Ga0495631_0036896|Ga0495631_0036896_1062_1652 |
| Length | 196 |
| Sequence | MGSRPGHAADRPPRRRASGRVVDVGSEQMQFGRYYEEFEVGAVYKHWPGKTVTEYDDHLFCLLTMNHHPLHMDVNYAEKTTDFGKNVVVGNYIYSLLLGMSVPDVSGKAIANLEIESLRHVAPTFHGDTIYGETTVLDKTESKSKDDRGIVHVETLGYKQDGTIVCIFRRKVMVPKRSYGEARGGEQPGRPEPLPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 2 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 3 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 4 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 5 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 6 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 7 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 8 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 9 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 10 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 11 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 12 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 13 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 14 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 15 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 16 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 17 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 18 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 19 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 170 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 171 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 183 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 193 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 197 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 198 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 199 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 200 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 201 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 202 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 277 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 278 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 279 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 306 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 307 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 308 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 309 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 332 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 334 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 337 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 342 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.23 |
| Metatranscriptomes | 1.48 |
| Isolates | 3.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.48 |
| Nodule | 0 |
| Rhizoplane | 4.93 |
| Rhizosphere | 88.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10022234 | 3300001990 | Bacteria | 2016 |
| 2 | JGI24748J21848_1015178 | 3300002074 | Bacteria | 915 |
| 3 | JGI25406J46586_10005808 | 3300003203 | Bacteria | 5710 |
| 4 | JGI25405J52794_10037970 | 3300003911 | Bacteria | 1013 |
| 5 | Ga0070658_10001192 | 3300005327 | Bacteria | 22232 |
| 6 | Ga0070683_100042106 | 3300005329 | Bacteria | 4205 |
| 7 | Ga0070683_100291298 | 3300005329 | Bacteria | 1553 |
| 8 | Ga0070690_100737001 | 3300005330 | Bacteria | 760 |
| 9 | Ga0070680_100000297 | 3300005336 | Bacteria | 33160 |
| 10 | Ga0070682_100083369 | 3300005337 | Bacteria | 2074 |
| 11 | Ga0070682_100178088 | 3300005337 | Bacteria | 1483 |
| 12 | Ga0070682_100755209 | 3300005337 | Bacteria | 786 |
| 13 | Ga0070682_100852579 | 3300005337 | Bacteria | 745 |
| 14 | Ga0070689_100640827 | 3300005340 | Bacteria | 923 |
| 15 | Ga0070692_10303370 | 3300005345 | Bacteria | 976 |
| 16 | Ga0070692_10308202 | 3300005345 | Bacteria | 969 |
| 17 | Ga0070668_100070930 | 3300005347 | Bacteria | 2713 |
| 18 | Ga0070668_100663690 | 3300005347 | Bacteria | 917 |
| 19 | Ga0070669_100096830 | 3300005353 | Bacteria | 2220 |
| 20 | Ga0070675_100046469 | 3300005354 | Bacteria | 3555 |
| 21 | Ga0070671_100043473 | 3300005355 | Bacteria | 3733 |
| 22 | Ga0070688_100709555 | 3300005365 | Bacteria | 780 |
| 23 | Ga0070667_100013536 | 3300005367 | Bacteria | 6741 |
| 24 | Ga0070714_100000701 | 3300005435 | Bacteria | 23697 |
| 25 | Ga0070714_100005205 | 3300005435 | Bacteria | 9899 |
| 26 | Ga0070714_100011815 | 3300005435 | Bacteria | 6940 |
| 27 | Ga0070714_101167849 | 3300005435 | Bacteria | 751 |
| 28 | Ga0070713_100527263 | 3300005436 | Bacteria | 1117 |
| 29 | Ga0070678_100491291 | 3300005456 | Bacteria | 1082 |
| 30 | Ga0070681_10025473 | 3300005458 | Bacteria | 5950 |
| 31 | Ga0070685_10818795 | 3300005466 | Bacteria | 688 |
| 32 | Ga0070706_100034591 | 3300005467 | Bacteria | 4668 |
| 33 | Ga0070707_100179566 | 3300005468 | Bacteria | 2063 |
| 34 | Ga0070707_100867664 | 3300005468 | Bacteria | 867 |
| 35 | Ga0070699_100059306 | 3300005518 | Bacteria | 3315 |
| 36 | Ga0070679_100006559 | 3300005530 | Bacteria | 10844 |
| 37 | Ga0070684_100364310 | 3300005535 | Bacteria | 1330 |
| 38 | Ga0070686_100243456 | 3300005544 | Bacteria | 1311 |
| 39 | Ga0070696_100326848 | 3300005546 | Bacteria | 1182 |
| 40 | Ga0070693_100082068 | 3300005547 | Bacteria | 1924 |
| 41 | Ga0070693_100717615 | 3300005547 | Bacteria | 733 |
| 42 | Ga0070665_100652231 | 3300005548 | Bacteria | 1066 |
| 43 | Ga0070704_100452377 | 3300005549 | Bacteria | 1106 |
| 44 | Ga0070704_100458825 | 3300005549 | Bacteria | 1099 |
| 45 | Ga0070664_100932362 | 3300005564 | Bacteria | 815 |
| 46 | Ga0068857_100806713 | 3300005577 | Bacteria | 896 |
| 47 | Ga0068856_100007511 | 3300005614 | Bacteria | 10643 |
| 48 | Ga0068852_100054959 | 3300005616 | Bacteria | 3434 |
| 49 | Ga0068859_100000301 | 3300005617 | Bacteria | 49173 |
| 50 | Ga0068859_100003956 | 3300005617 | Bacteria | 15123 |
| 51 | Ga0068859_101174599 | 3300005617 | Bacteria | 845 |
| 52 | Ga0068864_100462482 | 3300005618 | Bacteria | 1215 |
| 53 | Ga0068864_101859878 | 3300005618 | Bacteria | 608 |
| 54 | Ga0068861_100657596 | 3300005719 | Bacteria | 969 |
| 55 | Ga0068863_100000163 | 3300005841 | Bacteria | 71286 |
| 56 | Ga0068863_100139312 | 3300005841 | Bacteria | 2318 |
| 57 | Ga0068858_100000010 | 3300005842 | Bacteria | 234748 |
| 58 | Ga0068858_100759489 | 3300005842 | Bacteria | 945 |
| 59 | Ga0068860_100064334 | 3300005843 | Bacteria | 3484 |
| 60 | Ga0068862_100000049 | 3300005844 | Bacteria | 149792 |
| 61 | Ga0081455_10000544 | 3300005937 | Bacteria | 48955 |
| 62 | Ga0081455_10259492 | 3300005937 | Bacteria | 1266 |
| 63 | Ga0081540_1164447 | 3300005983 | Bacteria | 855 |
| 64 | Ga0081539_10000094 | 3300005985 | Bacteria | 206102 |
| 65 | Ga0070717_10001308 | 3300006028 | Bacteria | 17047 |
| 66 | Ga0070717_10488027 | 3300006028 | Bacteria | 1113 |
| 67 | Ga0075365_10017626 | 3300006038 | Bacteria | 4375 |
| 68 | Ga0070716_100121795 | 3300006173 | Bacteria | 1634 |
| 69 | Ga0097621_100004204 | 3300006237 | Bacteria | 9992 |
| 70 | Ga0068871_100089172 | 3300006358 | Bacteria | 2567 |
| 71 | Ga0075428_100008649 | 3300006844 | Bacteria | 11291 |
| 72 | Ga0075428_100016810 | 3300006844 | Bacteria | 8078 |
| 73 | Ga0075428_100081064 | 3300006844 | Bacteria | 3542 |
| 74 | Ga0075430_100013280 | 3300006846 | Bacteria | 7020 |
| 75 | Ga0075430_100250134 | 3300006846 | Bacteria | 1469 |
| 76 | Ga0075430_100312955 | 3300006846 | Bacteria | 1298 |
| 77 | Ga0075431_100015347 | 3300006847 | Bacteria | 7762 |
| 78 | Ga0075431_100441400 | 3300006847 | Bacteria | 1298 |
| 79 | Ga0075431_100809161 | 3300006847 | Bacteria | 910 |
| 80 | Ga0075434_100004924 | 3300006871 | Bacteria | 12103 |
| 81 | Ga0075429_100003160 | 3300006880 | Bacteria | 13999 |
| 82 | Ga0075429_100031061 | 3300006880 | Bacteria | 4643 |
| 83 | Ga0075429_100347510 | 3300006880 | Bacteria | 1298 |
| 84 | Ga0075436_100000375 | 3300006914 | Bacteria | 28483 |
| 85 | Ga0097620_100000301 | 3300006931 | Bacteria | 49173 |
| 86 | Ga0097620_100003956 | 3300006931 | Bacteria | 15123 |
| 87 | Ga0097620_101174406 | 3300006931 | Bacteria | 845 |
| 88 | Ga0075435_100308138 | 3300007076 | Bacteria | 1355 |
| 89 | Ga0075435_100663325 | 3300007076 | Bacteria | 906 |
| 90 | Ga0099794_10019000 | 3300007265 | Bacteria | 3090 |
| 91 | Ga0105251_10036456 | 3300009011 | Bacteria | 2420 |
| 92 | Ga0105250_10155234 | 3300009092 | Bacteria | 953 |
| 93 | Ga0105250_10241967 | 3300009092 | Bacteria | 769 |
| 94 | Ga0105240_10037718 | 3300009093 | Bacteria | 6209 |
| 95 | Ga0111539_10016743 | 3300009094 | Bacteria | 9085 |
| 96 | Ga0111539_11176431 | 3300009094 | Bacteria | 891 |
| 97 | Ga0105245_10109792 | 3300009098 | Bacteria | 2564 |
| 98 | Ga0105245_11168492 | 3300009098 | Bacteria | 817 |
| 99 | Ga0105247_10000834 | 3300009101 | Bacteria | 23420 |
| 100 | Ga0114129_10003939 | 3300009147 | Bacteria | 20975 |
| 101 | Ga0114129_10029362 | 3300009147 | Bacteria | 7789 |
| 102 | Ga0114129_10072691 | 3300009147 | Bacteria | 4794 |
| 103 | Ga0114129_10236611 | 3300009147 | Bacteria | 2457 |
| 104 | Ga0114129_11189012 | 3300009147 | Bacteria | 950 |
| 105 | Ga0105243_10383916 | 3300009148 | Bacteria | 1300 |
| 106 | Ga0105241_10607688 | 3300009174 | Bacteria | 989 |
| 107 | Ga0105242_10607969 | 3300009176 | Bacteria | 1057 |
| 108 | Ga0105248_10000147 | 3300009177 | Bacteria | 81699 |
| 109 | Ga0105248_10000377 | 3300009177 | Bacteria | 52002 |
| 110 | Ga0105248_10016629 | 3300009177 | Bacteria | 8099 |
| 111 | Ga0105248_11022731 | 3300009177 | Bacteria | 933 |
| 112 | Ga0105248_11989166 | 3300009177 | Bacteria | 660 |
| 113 | Ga0105237_10013119 | 3300009545 | Bacteria | 8699 |
| 114 | Ga0105237_10040024 | 3300009545 | Bacteria | 4729 |
| 115 | Ga0105237_10808569 | 3300009545 | Bacteria | 944 |
| 116 | Ga0105249_10165031 | 3300009553 | Bacteria | 2143 |
| 117 | Ga0105249_10277011 | 3300009553 | Bacteria | 1673 |
| 118 | Ga0105033_103522 | 3300009986 | Bacteria | 1320 |
| 119 | Ga0105239_10018684 | 3300010375 | Bacteria | 7657 |
| 120 | Ga0105239_10702747 | 3300010375 | Bacteria | 1156 |
| 121 | Ga0157335_1004676 | 3300012492 | Bacteria | 931 |
| 122 | Ga0157370_10078473 | 3300013104 | Bacteria | 3109 |
| 123 | Ga0157369_10023576 | 3300013105 | Bacteria | 6854 |
| 124 | Ga0157369_10651635 | 3300013105 | Unclassified | 1086 |
| 125 | Ga0157369_10718874 | 3300013105 | Bacteria | 1028 |
| 126 | Ga0157374_10187916 | 3300013296 | Bacteria | 2020 |
| 127 | Ga0157375_10018285 | 3300013308 | Bacteria | 6353 |
| 128 | Ga0157375_10184847 | 3300013308 | Bacteria | 2237 |
| 129 | Ga0157375_10525782 | 3300013308 | Bacteria | 1346 |
| 130 | Ga0163163_10002172 | 3300014325 | Bacteria | 16561 |
| 131 | Ga0163163_10010694 | 3300014325 | Bacteria | 8271 |
| 132 | Ga0163163_10102206 | 3300014325 | Bacteria | 2889 |
| 133 | Ga0163163_10363312 | 3300014325 | Bacteria | 1504 |
| 134 | Ga0163163_10450650 | 3300014325 | Bacteria | 1347 |
| 135 | Ga0163163_10710561 | 3300014325 | Bacteria | 1069 |
| 136 | Ga0157380_10149971 | 3300014326 | Bacteria | 2014 |
| 137 | Ga0157380_11296638 | 3300014326 | Bacteria | 775 |
| 138 | Ga0157380_11872423 | 3300014326 | Bacteria | 660 |
| 139 | Ga0157377_11058663 | 3300014745 | Bacteria | 618 |
| 140 | Ga0157379_10000149 | 3300014968 | Bacteria | 51280 |
| 141 | Ga0197907_10830029 | 3300020069 | Bacteria | 1363 |
| 142 | Ga0206351_10215200 | 3300020077 | Bacteria | 1220 |
| 143 | Ga0206350_10124477 | 3300020080 | Bacteria | 821 |
| 144 | Ga0154015_1709930 | 3300020610 | Bacteria | 831 |
| 145 | Ga0213876_10266763 | 3300021384 | Bacteria | 910 |
| 146 | Ga0224712_10210574 | 3300022467 | Bacteria | 886 |
| 147 | Ga0209130_1048847 | 3300025284 | Bacteria | 779 |
| 148 | Ga0209256_1003564 | 3300025299 | Bacteria | 10761 |
| 149 | Ga0207696_1117897 | 3300025711 | Bacteria | 717 |
| 150 | Ga0207692_10018350 | 3300025898 | Bacteria | 3140 |
| 151 | Ga0207710_10000107 | 3300025900 | Bacteria | 105449 |
| 152 | Ga0207710_10000144 | 3300025900 | Bacteria | 82093 |
| 153 | Ga0207647_10055951 | 3300025904 | Bacteria | 2422 |
| 154 | Ga0207647_10271449 | 3300025904 | Bacteria | 970 |
| 155 | Ga0207699_10000045 | 3300025906 | Bacteria | 112158 |
| 156 | Ga0207705_10015019 | 3300025909 | Bacteria | 5567 |
| 157 | Ga0207684_10015851 | 3300025910 | Bacteria | 6479 |
| 158 | Ga0207684_11274077 | 3300025910 | Bacteria | 606 |
| 159 | Ga0207654_10107189 | 3300025911 | Bacteria | 1732 |
| 160 | Ga0207707_10001022 | 3300025912 | Bacteria | 26886 |
| 161 | Ga0207695_10035602 | 3300025913 | Bacteria | 5395 |
| 162 | Ga0207671_10119158 | 3300025914 | Bacteria | 2016 |
| 163 | Ga0207671_10614849 | 3300025914 | Bacteria | 866 |
| 164 | Ga0207671_10682671 | 3300025914 | Bacteria | 817 |
| 165 | Ga0207693_10693463 | 3300025915 | Bacteria | 789 |
| 166 | Ga0207693_11209026 | 3300025915 | Bacteria | 569 |
| 167 | Ga0207663_11439085 | 3300025916 | Bacteria | 555 |
| 168 | Ga0207660_10000404 | 3300025917 | Bacteria | 28485 |
| 169 | Ga0207657_10368149 | 3300025919 | Bacteria | 1132 |
| 170 | Ga0207652_10000717 | 3300025921 | Bacteria | 32120 |
| 171 | Ga0207646_10038249 | 3300025922 | Bacteria | 4323 |
| 172 | Ga0207694_10381039 | 3300025924 | Bacteria | 1171 |
| 173 | Ga0207659_10143277 | 3300025926 | Bacteria | 1857 |
| 174 | Ga0207687_10528271 | 3300025927 | Bacteria | 988 |
| 175 | Ga0207700_10048409 | 3300025928 | Bacteria | 3156 |
| 176 | Ga0207700_10128005 | 3300025928 | Bacteria | 2069 |
| 177 | Ga0207664_10000641 | 3300025929 | Bacteria | 24306 |
| 178 | Ga0207664_10046528 | 3300025929 | Bacteria | 3406 |
| 179 | Ga0207664_10407463 | 3300025929 | Bacteria | 1210 |
| 180 | Ga0207664_10924062 | 3300025929 | Bacteria | 783 |
| 181 | Ga0207709_10616358 | 3300025935 | Bacteria | 861 |
| 182 | Ga0207670_10126139 | 3300025936 | Bacteria | 1868 |
| 183 | Ga0207665_10114972 | 3300025939 | Bacteria | 1895 |
| 184 | Ga0207711_10000056 | 3300025941 | Bacteria | 135485 |
| 185 | Ga0207711_10010080 | 3300025941 | Bacteria | 7856 |
| 186 | Ga0207711_11169981 | 3300025941 | Bacteria | 710 |
| 187 | Ga0207661_10061928 | 3300025944 | Bacteria | 3025 |
| 188 | Ga0207661_10137783 | 3300025944 | Bacteria | 2098 |
| 189 | Ga0207667_10003347 | 3300025949 | Bacteria | 19783 |
| 190 | Ga0207712_10119767 | 3300025961 | Bacteria | 1989 |
| 191 | Ga0207658_10138354 | 3300025986 | Bacteria | 1967 |
| 192 | Ga0207677_10186648 | 3300026023 | Bacteria | 1636 |
| 193 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 194 | Ga0207703_10114654 | 3300026035 | Bacteria | 2305 |
| 195 | Ga0207702_10009578 | 3300026078 | Bacteria | 8133 |
| 196 | Ga0207702_10022306 | 3300026078 | Bacteria | 5248 |
| 197 | Ga0207641_10000877 | 3300026088 | Bacteria | 31494 |
| 198 | Ga0207641_10012501 | 3300026088 | Bacteria | 6958 |
| 199 | Ga0207641_10256522 | 3300026088 | Bacteria | 1635 |
| 200 | Ga0207648_10162618 | 3300026089 | Bacteria | 1972 |
| 201 | Ga0207676_10327322 | 3300026095 | Bacteria | 1409 |
| 202 | Ga0207676_10448950 | 3300026095 | Bacteria | 1215 |
| 203 | Ga0207674_10298033 | 3300026116 | Bacteria | 1561 |
| 204 | Ga0207675_100690069 | 3300026118 | Bacteria | 1029 |
| 205 | Ga0207683_10489755 | 3300026121 | Bacteria | 1135 |
| 206 | Ga0207683_10639308 | 3300026121 | Bacteria | 985 |
| 207 | Ga0207683_11331636 | 3300026121 | Bacteria | 664 |
| 208 | Ga0207428_10388837 | 3300027907 | Bacteria | 1022 |
| 209 | Ga0268266_10035268 | 3300028379 | Bacteria | 4255 |
| 210 | Ga0268265_10000017 | 3300028380 | Bacteria | 293875 |
| 211 | Ga0268264_10003187 | 3300028381 | Bacteria | 14212 |
| 212 | Ga0265770_1032434 | 3300030878 | Bacteria | 881 |
| 213 | Ga0307513_10047714 | 3300031456 | Bacteria | 4656 |
| 214 | Ga0307513_10287866 | 3300031456 | Bacteria | 1416 |
| 215 | Ga0307408_100079053 | 3300031548 | Bacteria | 2453 |
| 216 | Ga0307408_100482781 | 3300031548 | Bacteria | 1081 |
| 217 | Ga0307405_10032700 | 3300031731 | Bacteria | 3077 |
| 218 | Ga0307413_10458006 | 3300031824 | Bacteria | 1014 |
| 219 | Ga0307410_10001047 | 3300031852 | Bacteria | 12017 |
| 220 | Ga0307410_10038534 | 3300031852 | Bacteria | 3132 |
| 221 | Ga0307410_10321663 | 3300031852 | Bacteria | 1227 |
| 222 | Ga0307410_10634507 | 3300031852 | Bacteria | 894 |
| 223 | Ga0307406_10096690 | 3300031901 | Bacteria | 2001 |
| 224 | Ga0307406_10136734 | 3300031901 | Bacteria | 1728 |
| 225 | Ga0307406_10689026 | 3300031901 | Bacteria | 852 |
| 226 | Ga0307407_10257666 | 3300031903 | Bacteria | 1198 |
| 227 | Ga0307407_10434125 | 3300031903 | Bacteria | 949 |
| 228 | Ga0307412_10251110 | 3300031911 | Bacteria | 1373 |
| 229 | Ga0307409_100093287 | 3300031995 | Bacteria | 2473 |
| 230 | Ga0307409_100094104 | 3300031995 | Bacteria | 2464 |
| 231 | Ga0307409_100110011 | 3300031995 | Bacteria | 2308 |
| 232 | Ga0307409_100346646 | 3300031995 | Bacteria | 1400 |
| 233 | Ga0307409_100468656 | 3300031995 | Bacteria | 1219 |
| 234 | Ga0307409_100845266 | 3300031995 | Bacteria | 926 |
| 235 | Ga0307409_101130111 | 3300031995 | Bacteria | 805 |
| 236 | Ga0307416_100053043 | 3300032002 | Bacteria | 3251 |
| 237 | Ga0307416_100330506 | 3300032002 | Bacteria | 1531 |
| 238 | Ga0307416_100597985 | 3300032002 | Bacteria | 1182 |
| 239 | Ga0307416_100626013 | 3300032002 | Bacteria | 1158 |
| 240 | Ga0307416_100941587 | 3300032002 | Bacteria | 965 |
| 241 | Ga0307414_10175222 | 3300032004 | Bacteria | 1719 |
| 242 | Ga0307414_10305719 | 3300032004 | Bacteria | 1347 |
| 243 | Ga0307411_10673289 | 3300032005 | Bacteria | 898 |
| 244 | Ga0307415_100031514 | 3300032126 | Bacteria | 3416 |
| 245 | Ga0307415_100102430 | 3300032126 | Bacteria | 2103 |
| 246 | Ga0307415_100198226 | 3300032126 | Bacteria | 1590 |
| 247 | Ga0307415_100224594 | 3300032126 | Bacteria | 1508 |
| 248 | Ga0307415_100315906 | 3300032126 | Bacteria | 1300 |
| 249 | Ga0307415_100934863 | 3300032126 | Bacteria | 801 |
| 250 | Ga0307415_101621540 | 3300032126 | Bacteria | 622 |
| 251 | Ga0307507_10000113 | 3300033179 | Bacteria | 133812 |
| 252 | Ga0307507_10004395 | 3300033179 | Bacteria | 25121 |
| 253 | Ga0373948_0128498 | 3300034817 | Bacteria | 618 |
| 254 | Ga0373938_0020992 | 3300034957 | Bacteria | 1320 |
| 255 | Ga0373934_0071709 | 3300035086 | Bacteria | 1386 |
| 256 | Ga0373953_0029960 | 3300035117 | Bacteria | 2107 |
| 257 | Ga0373953_0442143 | 3300035117 | Bacteria | 574 |
| 258 | Ga0373956_0012279 | 3300035119 | Bacteria | 3548 |
| 259 | Ga0373956_0030746 | 3300035119 | Bacteria | 2349 |
| 260 | Ga0373957_0023039 | 3300035120 | Bacteria | 2223 |
| 261 | Ga0373960_0042624 | 3300035121 | Bacteria | 1318 |
| 262 | Ga0373955_0011088 | 3300035172 | Bacteria | 4281 |
| 263 | Ga0373955_0512645 | 3300035172 | Bacteria | 733 |
| 264 | Ga0373942_0018270 | 3300035207 | Bacteria | 1739 |
| 265 | Ga0373961_0008367 | 3300035241 | Bacteria | 2516 |
| 266 | Ga0373931_0106676 | 3300035691 | Bacteria | 1583 |
| 267 | Ga0373935_0534944 | 3300035692 | Bacteria | 853 |
| 268 | Ga0373927_0125662 | 3300035695 | Bacteria | 1674 |
| 269 | Ga0373933_0005121 | 3300035724 | Bacteria | 7152 |
| 270 | Ga0373933_0406989 | 3300035724 | Bacteria | 888 |
| 271 | Ga0373947_0339740 | 3300035725 | Bacteria | 1006 |
| 272 | Ga0373937_0026090 | 3300036401 | Bacteria | 5279 |
| 273 | Ga0373937_0054128 | 3300036401 | Bacteria | 3682 |
| 274 | Ga0395899_0017796 | 3300037312 | Bacteria | 5410 |
| 275 | Ga0395900_0015034 | 3300037418 | Bacteria | 7889 |
| 276 | Ga0395900_0108490 | 3300037418 | Bacteria | 2852 |
| 277 | Ga0395900_0138769 | 3300037418 | Bacteria | 2490 |
| 278 | Ga0395900_0183497 | 3300037418 | Bacteria | 2125 |
| 279 | Ga0395898_1051954 | 3300037466 | Bacteria | 748 |
| 280 | Ga0395905_0300418 | 3300037471 | Bacteria | 1493 |
| 281 | Ga0395905_0448999 | 3300037471 | Bacteria | 1187 |
| 282 | Ga0395905_0515252 | 3300037471 | Bacteria | 1096 |
| 283 | Ga0395901_0250160 | 3300038443 | Bacteria | 1847 |
| 284 | Ga0395901_0340924 | 3300038443 | Bacteria | 1548 |
| 285 | Ga0436365_1785580 | 3300039437 | Bacteria | 793 |
| 286 | Ga0439461_0089488 | 3300041410 | Bacteria | 737 |
| 287 | Ga0451789_1052800 | 3300041443 | Bacteria | 763 |
| 288 | Ga0451793_0219251 | 3300041452 | Bacteria | 647 |
| 289 | Ga0451793_1844926 | 3300041452 | Bacteria | 589 |
| 290 | Ga0451807_1159192 | 3300041486 | Bacteria | 2266 |
| 291 | Ga0451851_0894497 | 3300041507 | Bacteria | 702 |
| 292 | Ga0439442_030398 | 3300042002 | Bacteria | 1128 |
| 293 | Ga0439435_0060373 | 3300042436 | Bacteria | 1104 |
| 294 | Ga0451577_0099523 | 3300042876 | Bacteria | 2597 |
| 295 | Ga0451577_0429767 | 3300042876 | Bacteria | 1199 |
| 296 | Ga0466969_0012981 | 3300044656 | Bacteria | 4387 |
| 297 | Ga0466969_0090528 | 3300044656 | Bacteria | 1450 |
| 298 | Ga0466969_0094403 | 3300044656 | Bacteria | 1414 |
| 299 | Ga0466969_0096229 | 3300044656 | Bacteria | 1398 |
| 300 | Ga0466972_0013425 | 3300044658 | Bacteria | 4113 |
| 301 | Ga0466972_0031423 | 3300044658 | Bacteria | 2611 |
| 302 | Ga0466972_0083717 | 3300044658 | Bacteria | 1517 |
| 303 | Ga0466972_0210194 | 3300044658 | Bacteria | 911 |
| 304 | Ga0466972_0426056 | 3300044658 | Bacteria | 623 |
| 305 | Ga0453683_0011272 | 3300044673 | Bacteria | 5901 |
| 306 | Ga0466965_0023943 | 3300044683 | Bacteria | 2951 |
| 307 | Ga0466965_0433285 | 3300044683 | Bacteria | 730 |
| 308 | Ga0466966_0039381 | 3300044684 | Bacteria | 3044 |
| 309 | Ga0466966_0059821 | 3300044684 | Bacteria | 2405 |
| 310 | Ga0466966_0121075 | 3300044684 | Bacteria | 1607 |
| 311 | Ga0466966_0403536 | 3300044684 | Bacteria | 821 |
| 312 | Ga0466966_0449776 | 3300044684 | Bacteria | 774 |
| 313 | Ga0466961_0003497 | 3300044693 | Bacteria | 9791 |
| 314 | Ga0466961_0049856 | 3300044693 | Bacteria | 2675 |
| 315 | Ga0466961_0066958 | 3300044693 | Bacteria | 2281 |
| 316 | Ga0466961_0072924 | 3300044693 | Bacteria | 2177 |
| 317 | Ga0466961_0088673 | 3300044693 | Bacteria | 1954 |
| 318 | Ga0466961_0108177 | 3300044693 | Bacteria | 1750 |
| 319 | Ga0466961_0134902 | 3300044693 | Bacteria | 1546 |
| 320 | Ga0466961_0189160 | 3300044693 | Bacteria | 1276 |
| 321 | Ga0466961_0192442 | 3300044693 | Bacteria | 1264 |
| 322 | Ga0466961_0295475 | 3300044693 | Bacteria | 990 |
| 323 | Ga0466963_0002849 | 3300044694 | Bacteria | 9755 |
| 324 | Ga0466963_0014159 | 3300044694 | Bacteria | 4914 |
| 325 | Ga0466963_0029589 | 3300044694 | Bacteria | 3527 |
| 326 | Ga0466963_0052305 | 3300044694 | Bacteria | 2710 |
| 327 | Ga0466963_0086900 | 3300044694 | Bacteria | 2125 |
| 328 | Ga0466963_0208994 | 3300044694 | Bacteria | 1366 |
| 329 | Ga0466964_0007178 | 3300044706 | Bacteria | 4167 |
| 330 | Ga0466964_0089676 | 3300044706 | Bacteria | 1336 |
| 331 | Ga0466964_0426520 | 3300044706 | Bacteria | 698 |
| 332 | Ga0453684_0012539 | 3300044712 | Bacteria | 13955 |
| 333 | Ga0466971_0003719 | 3300044719 | Bacteria | 6528 |
| 334 | Ga0466971_0007792 | 3300044719 | Bacteria | 4668 |
| 335 | Ga0466971_0026619 | 3300044719 | Bacteria | 2586 |
| 336 | Ga0466971_0044346 | 3300044719 | Bacteria | 1997 |
| 337 | Ga0466971_0195562 | 3300044719 | Bacteria | 954 |
| 338 | Ga0466971_0393811 | 3300044719 | Bacteria | 674 |
| 339 | Ga0466970_0010596 | 3300044765 | Bacteria | 4682 |
| 340 | Ga0466970_0020655 | 3300044765 | Bacteria | 3424 |
| 341 | Ga0466970_0036349 | 3300044765 | Bacteria | 2609 |
| 342 | Ga0466970_0048225 | 3300044765 | Bacteria | 2271 |
| 343 | Ga0466970_0091491 | 3300044765 | Bacteria | 1651 |
| 344 | Ga0466970_0552196 | 3300044765 | Bacteria | 666 |
| 345 | Ga0466970_0576252 | 3300044765 | Bacteria | 652 |
| 346 | Ga0466957_0014176 | 3300044842 | Bacteria | 4638 |
| 347 | Ga0466957_0021338 | 3300044842 | Bacteria | 3816 |
| 348 | Ga0466957_0053914 | 3300044842 | Bacteria | 2453 |
| 349 | Ga0466957_0082117 | 3300044842 | Bacteria | 2008 |
| 350 | Ga0466957_0130898 | 3300044842 | Bacteria | 1607 |
| 351 | Ga0466957_0177635 | 3300044842 | Bacteria | 1389 |
| 352 | Ga0466957_0299987 | 3300044842 | Bacteria | 1079 |
| 353 | Ga0466957_0700959 | 3300044842 | Bacteria | 714 |
| 354 | Ga0466960_0007075 | 3300044901 | Bacteria | 4537 |
| 355 | Ga0466960_0072265 | 3300044901 | Bacteria | 1719 |
| 356 | Ga0466960_0100153 | 3300044901 | Bacteria | 1491 |
| 357 | Ga0466960_0124142 | 3300044901 | Bacteria | 1355 |
| 358 | Ga0466960_0232322 | 3300044901 | Bacteria | 1018 |
| 359 | Ga0466959_0044294 | 3300045049 | Bacteria | 3279 |
| 360 | Ga0466959_0054045 | 3300045049 | Bacteria | 2935 |
| 361 | Ga0466959_0058916 | 3300045049 | Bacteria | 2797 |
| 362 | Ga0466959_0062173 | 3300045049 | Bacteria | 2714 |
| 363 | Ga0466959_0136848 | 3300045049 | Bacteria | 1733 |
| 364 | Ga0466959_0150860 | 3300045049 | Bacteria | 1638 |
| 365 | Ga0466959_0310694 | 3300045049 | Bacteria | 1079 |
| 366 | Ga0451576_0029721 | 3300045051 | Bacteria | 5846 |
| 367 | Ga0451576_0048352 | 3300045051 | Bacteria | 4468 |
| 368 | Ga0466958_0006888 | 3300045836 | Bacteria | 6215 |
| 369 | Ga0466958_0008606 | 3300045836 | Bacteria | 5664 |
| 370 | Ga0466958_0015729 | 3300045836 | Bacteria | 4343 |
| 371 | Ga0466958_0041210 | 3300045836 | Bacteria | 2777 |
| 372 | Ga0466958_0044573 | 3300045836 | Bacteria | 2673 |
| 373 | Ga0466958_0067772 | 3300045836 | Bacteria | 2180 |
| 374 | Ga0466958_0516432 | 3300045836 | Bacteria | 775 |
| 375 | Ga0466958_0552229 | 3300045836 | Bacteria | 748 |
| 376 | Ga0466967_0006716 | 3300045976 | Bacteria | 8185 |
| 377 | Ga0466967_0032803 | 3300045976 | Bacteria | 4390 |
| 378 | Ga0466967_0050747 | 3300045976 | Bacteria | 3633 |
| 379 | Ga0466967_0056572 | 3300045976 | Bacteria | 3459 |
| 380 | Ga0466967_0172559 | 3300045976 | Bacteria | 2035 |
| 381 | Ga0466967_0227288 | 3300045976 | Bacteria | 1776 |
| 382 | Ga0466967_0267314 | 3300045976 | Bacteria | 1638 |
| 383 | Ga0466967_0328650 | 3300045976 | Bacteria | 1476 |
| 384 | Ga0466967_0915111 | 3300045976 | Bacteria | 872 |
| 385 | Ga0495592_0010881 | 3300046454 | Bacteria | 6864 |
| 386 | Ga0495603_0148774 | 3300046455 | Bacteria | 1361 |
| 387 | Ga0495651_0022043 | 3300046462 | Bacteria | 4953 |
| 388 | Ga0495651_0087932 | 3300046462 | Bacteria | 2336 |
| 389 | Ga0495653_0012957 | 3300046463 | Bacteria | 6802 |
| 390 | Ga0495582_0418121 | 3300046473 | Bacteria | 773 |
| 391 | Ga0495662_0000796 | 3300046476 | Bacteria | 15310 |
| 392 | Ga0495662_0010433 | 3300046476 | Bacteria | 4549 |
| 393 | Ga0495664_0002832 | 3300046477 | Bacteria | 9330 |
| 394 | Ga0495608_0013736 | 3300046511 | Bacteria | 5617 |
| 395 | Ga0495608_0574961 | 3300046511 | Bacteria | 678 |
| 396 | Ga0495628_0306346 | 3300046516 | Bacteria | 1175 |
| 397 | Ga0495630_0015069 | 3300046517 | Bacteria | 5640 |
| 398 | Ga0495630_0146698 | 3300046517 | Bacteria | 1794 |
| 399 | Ga0495631_0036896 | 3300046518 | Bacteria | 2180 |
| 400 | Ga0495631_0126907 | 3300046518 | Bacteria | 1096 |
| 401 | Ga0495663_0044446 | 3300046525 | Bacteria | 1360 |
| 402 | Ga0495666_0002368 | 3300046526 | Bacteria | 9399 |
| 403 | Ga0495652_0050310 | 3300046529 | Bacteria | 3563 |
| 404 | Ga0495652_0163446 | 3300046529 | Bacteria | 1725 |
| 405 | Ga0495665_0034897 | 3300046531 | Bacteria | 2689 |
| 406 | Ga0495640_0008853 | 3300046533 | Bacteria | 7868 |
| 407 | Ga0495640_0037412 | 3300046533 | Bacteria | 3422 |
| 408 | Ga0495586_0059979 | 3300046535 | Bacteria | 2068 |
| 409 | Ga0495598_0133655 | 3300046537 | Bacteria | 853 |
| 410 | Ga0495598_0133912 | 3300046537 | Bacteria | 852 |
| 411 | Ga0495645_0015444 | 3300046543 | Bacteria | 5429 |
| 412 | Ga0495667_0011382 | 3300046559 | Bacteria | 6023 |
| 413 | Ga0495667_0091129 | 3300046559 | Bacteria | 1974 |
| 414 | Ga0495667_0147219 | 3300046559 | Bacteria | 1517 |
| 415 | Ga0495656_0130395 | 3300046615 | Bacteria | 1196 |
| 416 | Ga0495634_0201985 | 3300046642 | Bacteria | 1234 |
| 417 | Ga0495634_0517677 | 3300046642 | Bacteria | 698 |
| 418 | Ga0495588_0324046 | 3300046674 | Bacteria | 810 |
| 419 | Ga0495657_0009221 | 3300046675 | Bacteria | 7488 |
| 420 | Ga0495657_0537631 | 3300046675 | Bacteria | 679 |
| 421 | Ga0495599_0127281 | 3300046678 | Bacteria | 1583 |
| 422 | Ga0495599_0166206 | 3300046678 | Bacteria | 1362 |
| 423 | Ga0495623_0099069 | 3300046679 | Bacteria | 1778 |
| 424 | Ga0495623_0140179 | 3300046679 | Bacteria | 1439 |
| 425 | Ga0495623_0226480 | 3300046679 | Bacteria | 1062 |
| 426 | Ga0495646_0116180 | 3300046680 | Bacteria | 1518 |
| 427 | Ga0495647_0101047 | 3300046681 | Bacteria | 1194 |
| 428 | Ga0495658_0434872 | 3300046683 | Bacteria | 838 |
| 429 | Ga0495613_0012604 | 3300046689 | Bacteria | 6286 |
| 430 | Ga0495624_0039898 | 3300046690 | Bacteria | 3009 |
| 431 | Ga0495600_0135863 | 3300046809 | Bacteria | 1597 |
| 432 | Ga0495600_0419864 | 3300046809 | Bacteria | 830 |
| 433 | Ga0495581_0074152 | 3300047315 | Bacteria | 1969 |
| 434 | Ga0495581_0158300 | 3300047315 | Bacteria | 1324 |
| 435 | Ga0495604_0000925 | 3300047317 | Bacteria | 24435 |
| 436 | Ga0495604_0001249 | 3300047317 | Bacteria | 20835 |
| 437 | Ga0495604_0350888 | 3300047317 | Bacteria | 980 |
| 438 | Ga0495636_0008964 | 3300047318 | Bacteria | 3939 |
| 439 | Ga0495636_0362954 | 3300047318 | Bacteria | 685 |
| 440 | Ga0495674_0048596 | 3300047319 | Bacteria | 3753 |
| 441 | Ga0495672_0371186 | 3300047320 | Bacteria | 660 |
| 442 | Ga0495676_0065421 | 3300047321 | Bacteria | 2822 |
| 443 | Ga0495676_0455294 | 3300047321 | Bacteria | 844 |
| 444 | Ga0495680_0320143 | 3300047322 | Bacteria | 1085 |
| 445 | Ga0495680_0332072 | 3300047322 | Bacteria | 1062 |
| 446 | Ga0495675_0017354 | 3300047444 | Bacteria | 4561 |
| 447 | Ga0495675_0044672 | 3300047444 | Bacteria | 2822 |
| 448 | Ga0495679_005264 | 3300047446 | Bacteria | 5770 |
| 449 | Ga0495685_080450 | 3300047447 | Bacteria | 1085 |
| 450 | Ga0495684_0040950 | 3300047471 | Bacteria | 3550 |
| 451 | Ga0495602_0082865 | 3300048088 | Bacteria | 2689 |
| 452 | Ga0496100_0068828 | 3300048903 | Bacteria | 2355 |
| 453 | Ga0496101_0014011 | 3300048904 | Bacteria | 5385 |
| 454 | Ga0496102_0043034 | 3300048905 | Bacteria | 4093 |
| 455 | Ga0496102_0140265 | 3300048905 | Bacteria | 2266 |
| 456 | Ga0496103_0004537 | 3300048906 | Bacteria | 8407 |
| 457 | Ga0496104_0105303 | 3300048907 | Bacteria | 2703 |
| 458 | Ga0496105_0012010 | 3300048908 | Bacteria | 6858 |
| 459 | Ga0496105_0381119 | 3300048908 | Bacteria | 1122 |
| 460 | Ga0496106_0248893 | 3300048909 | Bacteria | 1421 |
| 461 | Ga0496106_0290875 | 3300048909 | Bacteria | 1310 |
| 462 | Ga0496107_0092600 | 3300048910 | Bacteria | 2210 |
| 463 | Ga0496107_1166132 | 3300048910 | Bacteria | 555 |
| 464 | Ga0496108_0023473 | 3300048911 | Bacteria | 5076 |
| 465 | Ga0496108_0263228 | 3300048911 | Bacteria | 1501 |
| 466 | Ga0496108_1549591 | 3300048911 | Bacteria | 550 |
| 467 | Ga0496109_0021128 | 3300048912 | Bacteria | 5754 |
| 468 | Ga0496110_0059045 | 3300048913 | Bacteria | 3379 |
| 469 | Ga0496110_0473448 | 3300048913 | Bacteria | 1141 |
| 470 | Ga0496111_0122063 | 3300048914 | Bacteria | 1924 |
| 471 | Ga0496111_0569856 | 3300048914 | Bacteria | 830 |
| 472 | Ga0496112_0022266 | 3300048915 | Bacteria | 6037 |
| 473 | Ga0496112_0528758 | 3300048915 | Bacteria | 1114 |
| 474 | Ga0496113_0306186 | 3300048916 | Bacteria | 1273 |
| 475 | Ga0496114_0020831 | 3300048917 | Bacteria | 5324 |
| 476 | Ga0496114_0046107 | 3300048917 | Bacteria | 3621 |
| 477 | Ga0496114_1021545 | 3300048917 | Bacteria | 710 |
| 478 | Ga0496116_0000578 | 3300048919 | Bacteria | 48938 |
| 479 | Ga0496117_0021178 | 3300048920 | Bacteria | 5271 |
| 480 | Ga0496118_0002249 | 3300048921 | Bacteria | 26504 |
| 481 | Ga0496119_0000282 | 3300048922 | Bacteria | 71403 |
| 482 | Ga0496119_0007110 | 3300048922 | Bacteria | 10173 |
| 483 | Ga0496119_0008226 | 3300048922 | Bacteria | 9220 |
| 484 | Ga0496119_0052315 | 3300048922 | Bacteria | 2502 |
| 485 | Ga0496120_0000250 | 3300048923 | Bacteria | 90632 |
| 486 | Ga0496120_0001391 | 3300048923 | Bacteria | 29334 |
| 487 | Ga0496121_0021638 | 3300048924 | Bacteria | 6289 |
| 488 | Ga0496126_0000026 | 3300048929 | Bacteria | 422310 |
| 489 | Ga0501031_0067790 | 3300049568 | Bacteria | 2324 |
| 490 | Ga0501031_0226057 | 3300049568 | Bacteria | 1218 |
| 491 | Ga0501032_0113155 | 3300049569 | Bacteria | 1795 |
| 492 | Ga0501033_0217114 | 3300049570 | Bacteria | 1362 |
| 493 | Ga0501034_0104075 | 3300049571 | Bacteria | 2832 |
| 494 | Ga0501036_0379322 | 3300049572 | Bacteria | 1180 |
| 495 | Ga0501036_0547054 | 3300049572 | Bacteria | 962 |
| 496 | Ga0501037_0011562 | 3300049573 | Bacteria | 6497 |
| 497 | Ga0501037_0239415 | 3300049573 | Bacteria | 1272 |
| 498 | Ga0501038_0002533 | 3300049574 | Bacteria | 17039 |
| 499 | Ga0501038_0065713 | 3300049574 | Bacteria | 3090 |
| 500 | Ga0501039_0367635 | 3300049575 | Bacteria | 1130 |
| 501 | Ga0501040_0090451 | 3300049576 | Bacteria | 2127 |
| 502 | Ga0501041_0462748 | 3300049577 | Bacteria | 805 |
| 503 | Ga0501046_0449821 | 3300049580 | Bacteria | 926 |
| 504 | Ga0501047_0135253 | 3300049581 | Bacteria | 2345 |
| 505 | Ga0501048_0012241 | 3300049582 | Bacteria | 6385 |
| 506 | Ga0501048_0053299 | 3300049582 | Bacteria | 2877 |
| 507 | Ga0501067_0009778 | 3300049583 | Bacteria | 5307 |
| 508 | Ga0501068_0561312 | 3300049584 | Bacteria | 743 |
| 509 | Ga0501070_0015355 | 3300049586 | Bacteria | 6444 |
| 510 | Ga0501070_0031163 | 3300049586 | Bacteria | 4467 |
| 511 | Ga0501070_0106834 | 3300049586 | Bacteria | 2313 |
| 512 | Ga0501071_0616265 | 3300049587 | Bacteria | 834 |
| 513 | Ga0501072_0029969 | 3300049588 | Bacteria | 4252 |
| 514 | Ga0501072_0073568 | 3300049588 | Bacteria | 2701 |
| 515 | Ga0501072_0210136 | 3300049588 | Bacteria | 1551 |
| 516 | Ga0501073_0212684 | 3300049589 | Bacteria | 1336 |
| 517 | Ga0501074_0039623 | 3300049590 | Bacteria | 3412 |
| 518 | Ga0501074_0304667 | 3300049590 | Bacteria | 1132 |
| 519 | Ga0501074_0536248 | 3300049590 | Bacteria | 829 |
| 520 | Ga0501075_0278015 | 3300049591 | Bacteria | 1276 |
| 521 | Ga0501076_0602312 | 3300049592 | Bacteria | 906 |
| 522 | Ga0501206_057952 | 3300049653 | Bacteria | 630 |
| 523 | Ga0501209_090588 | 3300049656 | Bacteria | 889 |
| 524 | Ga0501216_106095 | 3300049660 | Bacteria | 625 |
| 525 | Ga0501256_030455 | 3300049685 | Bacteria | 606 |
| 526 | Ga0501080_0589651 | 3300049742 | Bacteria | 987 |
| 527 | Ga0501081_0124429 | 3300049743 | Bacteria | 1839 |
| 528 | Ga0501081_0254201 | 3300049743 | Bacteria | 1283 |
| 529 | Ga0501083_0028191 | 3300049744 | Bacteria | 3872 |
| 530 | Ga0501083_0533813 | 3300049744 | Bacteria | 763 |
| 531 | Ga0501282_007663 | 3300049778 | Bacteria | 1154 |
| 532 | Ga0501035_0081641 | 3300049822 | Bacteria | 2853 |
| 533 | Ga0501035_0176571 | 3300049822 | Bacteria | 1842 |
| 534 | Ga0501044_0117519 | 3300049823 | Bacteria | 2663 |
| 535 | Ga0501044_0265276 | 3300049823 | Bacteria | 1655 |
| 536 | Ga0501044_0436615 | 3300049823 | Bacteria | 1218 |
| 537 | Ga0501045_0144777 | 3300049824 | Bacteria | 1767 |
| 538 | nmdc:mga0yw44_9360_c1 | 3300050492 | Bacteria | 4947 |
| 539 | nmdc:mga05p37_123297_c1 | 3300050507 | Bacteria | 3183 |
| 540 | nmdc:mga05p37_25797_c1 | 3300050507 | Bacteria | 7147 |
| 541 | nmdc:mga09592_33389_c1 | 3300050508 | Bacteria | 4295 |
| 542 | nmdc:mga09592_693_c1 | 3300050508 | Bacteria | 22366 |
| 543 | nmdc:mga09592_77618_c1 | 3300050508 | Bacteria | 2825 |
| 544 | nmdc:mga0qj67_106_c1 | 3300050509 | Bacteria | 21190 |
| 545 | nmdc:mga0qj67_132318_c1 | 3300050509 | Bacteria | 2020 |
| 546 | nmdc:mga0qj67_33844_c1 | 3300050509 | Bacteria | 3989 |
| 547 | nmdc:mga06r32_17855_c1 | 3300050510 | Bacteria | 6484 |
| 548 | nmdc:mga06r32_3172_c2 | 3300050510 | Bacteria | 11440 |
| 549 | nmdc:mga06r32_378114_c1 | 3300050510 | Bacteria | 1399 |
| 550 | nmdc:mga06r32_832008_c1 | 3300050510 | Bacteria | 882 |
| 551 | nmdc:mga08y16_194844_c1 | 3300050511 | Bacteria | 2101 |
| 552 | nmdc:mga0n895_263799_c1 | 3300050512 | Bacteria | 1748 |
| 553 | nmdc:mga0rr50_384192_c1 | 3300050513 | Bacteria | 1184 |
| 554 | nmdc:mga0rr50_392832_c1 | 3300050513 | Bacteria | 1171 |
| 555 | nmdc:mga08x19_820_c1 | 3300050514 | Bacteria | 19741 |
| 556 | nmdc:mga0a205_477547_c1 | 3300050515 | Bacteria | 1105 |
| 557 | Ga0495601_0029692 | 3300053077 | Bacteria | 3393 |
| 558 | Ga0495601_0050539 | 3300053077 | Bacteria | 2622 |
| 559 | Ga0495612_0007799 | 3300053078 | Bacteria | 4368 |
| 560 | Ga0495655_0059930 | 3300053083 | Bacteria | 1035 |
| 561 | Ga0495619_0078602 | 3300053085 | Bacteria | 2218 |
| 562 | Ga0495619_0194072 | 3300053085 | Bacteria | 1406 |
| 563 | Ga0495619_0199896 | 3300053085 | Bacteria | 1383 |
| 564 | Ga0495619_0611241 | 3300053085 | Bacteria | 745 |
| 565 | Ga0500644_0028617 | 3300053088 | Bacteria | 1745 |
| 566 | Ga0500646_0013310 | 3300053090 | Bacteria | 2129 |
| 567 | Ga0500618_000110 | 3300053125 | Bacteria | 66025 |
| 568 | Ga0500559_0000055 | 3300053136 | Bacteria | 89392 |
| 569 | Ga0500573_0120348 | 3300053140 | Bacteria | 1462 |
| 570 | Ga0501084_0064988 | 3300054114 | Bacteria | 3052 |
| 571 | Ga0501084_0176176 | 3300054114 | Bacteria | 1805 |
| 572 | Ga0590071_134490 | 3300059421 | Bacteria | 636 |
| 573 | Ga0587077_158362 | 3300059493 | Bacteria | 597 |
| 574 | Ga0587088_110876 | 3300059508 | Bacteria | 624 |
| 575 | Ga0587069_006763 | 3300059642 | Bacteria | 1392 |
| 576 | Ga0501082_0014421 | 3300060353 | Bacteria | 6801 |
| 577 | Ga0501082_0040538 | 3300060353 | Bacteria | 4016 |
| 578 | Ga0501082_0075352 | 3300060353 | Bacteria | 2907 |
| 579 | Ga0501082_0194759 | 3300060353 | Bacteria | 1763 |
| 580 | Ga0501082_0447342 | 3300060353 | Bacteria | 1129 |
| 581 | Ga0501082_1271232 | 3300060353 | Bacteria | 643 |
| 582 | Ga0466962_0013903 | 3300061719 | Bacteria | 3876 |
| 583 | Ga0466962_0085017 | 3300061719 | Bacteria | 1514 |
| 584 | Ga0466962_0112347 | 3300061719 | Bacteria | 1312 |
| 585 | Ga0466962_0152541 | 3300061719 | Bacteria | 1121 |
| 586 | Ga0466962_0215155 | 3300061719 | Bacteria | 940 |
| 587 | Ga0466962_0445708 | 3300061719 | Bacteria | 651 |
| 588 | Ga0466962_0542272 | 3300061719 | Bacteria | 590 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0537631 | Ga0495657_0537631_23_526 | 149 |
| 2 | 3300053085 | Ga0495619_0611241 | Ga0495619_0611241_232_735 | 149 |
| 3 | 3300046455 | Ga0495603_0148774 | Ga0495603_0148774_263_769 | 150 |
| 4 | 3300049743 | Ga0501081_0124429 | Ga0501081_0124429_1239_1775 | 151 |
| 5 | 3300060353 | Ga0501082_0194759 | Ga0501082_0194759_1244_1729 | 151 |
| 6 | 3300005347 | Ga0070668_100663690 | Ga0070668_1006636901 | 152 |
| 7 | 3300006844 | Ga0075428_100008649 | Ga0075428_10000864915 | 153 |
| 8 | 3300053090 | Ga0500646_0013310 | Ga0500646_0013310_506_1012 | 153 |
| 9 | 3300042436 | Ga0439435_0060373 | Ga0439435_0060373_347_838 | 155 |
| 10 | 3300009147 | Ga0114129_11189012 | Ga0114129_111890121 | 156 |
| 11 | 3300009177 | Ga0105248_10016629 | Ga0105248_100166297 | 156 |
| 12 | 3300005329 | Ga0070683_100042106 | Ga0070683_1000421063 | 157 |
| 13 | 3300005340 | Ga0070689_100640827 | Ga0070689_1006408272 | 157 |
| 14 | 3300005345 | Ga0070692_10308202 | Ga0070692_103082022 | 157 |
| 15 | 3300005353 | Ga0070669_100096830 | Ga0070669_1000968302 | 157 |
| 16 | 3300005354 | Ga0070675_100046469 | Ga0070675_1000464693 | 157 |
| 17 | 3300005456 | Ga0070678_100491291 | Ga0070678_1004912912 | 157 |
| 18 | 3300005518 | Ga0070699_100059306 | Ga0070699_1000593063 | 157 |
| 19 | 3300005544 | Ga0070686_100243456 | Ga0070686_1002434562 | 157 |
| 20 | 3300005546 | Ga0070696_100326848 | Ga0070696_1003268482 | 157 |
| 21 | 3300005547 | Ga0070693_100082068 | Ga0070693_1000820682 | 157 |
| 22 | 3300005549 | Ga0070704_100452377 | Ga0070704_1004523772 | 157 |
| 23 | 3300005549 | Ga0070704_100458825 | Ga0070704_1004588252 | 157 |
| 24 | 3300005719 | Ga0068861_100657596 | Ga0068861_1006575962 | 157 |
| 25 | 3300005842 | Ga0068858_100759489 | Ga0068858_1007594892 | 157 |
| 26 | 3300006038 | Ga0075365_10017626 | Ga0075365_100176263 | 157 |
| 27 | 3300006237 | Ga0097621_100004204 | Ga0097621_1000042042 | 157 |
| 28 | 3300006358 | Ga0068871_100089172 | Ga0068871_1000891723 | 157 |
| 29 | 3300006871 | Ga0075434_100004924 | Ga0075434_1000049244 | 157 |
| 30 | 3300006914 | Ga0075436_100000375 | Ga0075436_10000037515 | 157 |
| 31 | 3300007076 | Ga0075435_100308138 | Ga0075435_1003081382 | 157 |
| 32 | 3300007265 | Ga0099794_10019000 | Ga0099794_100190002 | 157 |
| 33 | 3300009094 | Ga0111539_10016743 | Ga0111539_100167436 | 157 |
| 34 | 3300009176 | Ga0105242_10607969 | Ga0105242_106079692 | 157 |
| 35 | 3300009177 | Ga0105248_11989166 | Ga0105248_119891661 | 157 |
| 36 | 3300013105 | Ga0157369_10651635 | Ga0157369_106516351 | 157 |
| 37 | 3300014326 | Ga0157380_10149971 | Ga0157380_101499712 | 157 |
| 38 | 3300014326 | Ga0157380_11296638 | Ga0157380_112966382 | 157 |
| 39 | 3300014326 | Ga0157380_11872423 | Ga0157380_118724232 | 157 |
| 40 | 3300014745 | Ga0157377_11058663 | Ga0157377_110586631 | 157 |
| 41 | 3300025284 | Ga0209130_1048847 | Ga0209130_10488472 | 157 |
| 42 | 3300025898 | Ga0207692_10018350 | Ga0207692_100183502 | 157 |
| 43 | 3300025926 | Ga0207659_10143277 | Ga0207659_101432772 | 157 |
| 44 | 3300025936 | Ga0207670_10126139 | Ga0207670_101261392 | 157 |
| 45 | 3300025944 | Ga0207661_10061928 | Ga0207661_100619283 | 157 |
| 46 | 3300026035 | Ga0207703_10114654 | Ga0207703_101146543 | 157 |
| 47 | 3300026089 | Ga0207648_10162618 | Ga0207648_101626182 | 157 |
| 48 | 3300026095 | Ga0207676_10327322 | Ga0207676_103273222 | 157 |
| 49 | 3300026118 | Ga0207675_100690069 | Ga0207675_1006900692 | 157 |
| 50 | 3300027907 | Ga0207428_10388837 | Ga0207428_103888372 | 157 |
| 51 | 3300031548 | Ga0307408_100079053 | Ga0307408_1000790532 | 157 |
| 52 | 3300031901 | Ga0307406_10689026 | Ga0307406_106890262 | 157 |
| 53 | 3300031995 | Ga0307409_101130111 | Ga0307409_1011301112 | 157 |
| 54 | 3300032002 | Ga0307416_100597985 | Ga0307416_1005979852 | 157 |
| 55 | 3300034817 | Ga0373948_0128498 | Ga0373948_0128498_31_549 | 157 |
| 56 | 3300034957 | Ga0373938_0020992 | Ga0373938_0020992_501_1019 | 157 |
| 57 | 3300035086 | Ga0373934_0071709 | Ga0373934_0071709_596_1114 | 157 |
| 58 | 3300035117 | Ga0373953_0029960 | Ga0373953_0029960_251_769 | 157 |
| 59 | 3300035119 | Ga0373956_0030746 | Ga0373956_0030746_192_710 | 157 |
| 60 | 3300035120 | Ga0373957_0023039 | Ga0373957_0023039_502_1020 | 157 |
| 61 | 3300035121 | Ga0373960_0042624 | Ga0373960_0042624_207_725 | 157 |
| 62 | 3300035172 | Ga0373955_0011088 | Ga0373955_0011088_2665_3183 | 157 |
| 63 | 3300035172 | Ga0373955_0512645 | Ga0373955_0512645_124_645 | 157 |
| 64 | 3300035241 | Ga0373961_0008367 | Ga0373961_0008367_1709_2227 | 157 |
| 65 | 3300035691 | Ga0373931_0106676 | Ga0373931_0106676_628_1146 | 157 |
| 66 | 3300035724 | Ga0373933_0005121 | Ga0373933_0005121_3916_4434 | 157 |
| 67 | 3300035724 | Ga0373933_0406989 | Ga0373933_0406989_314_835 | 157 |
| 68 | 3300036401 | Ga0373937_0026090 | Ga0373937_0026090_3363_3881 | 157 |
| 69 | 3300041486 | Ga0451807_1159192 | Ga0451807_1159192_1438_1956 | 157 |
| 70 | 3300041507 | Ga0451851_0894497 | Ga0451851_0894497_39_557 | 157 |
| 71 | 3300042876 | Ga0451577_0099523 | Ga0451577_0099523_1346_1864 | 157 |
| 72 | 3300044673 | Ga0453683_0011272 | Ga0453683_0011272_2201_2719 | 157 |
| 73 | 3300044712 | Ga0453684_0012539 | Ga0453684_0012539_3705_4223 | 157 |
| 74 | 3300045051 | Ga0451576_0029721 | Ga0451576_0029721_1850_2368 | 157 |
| 75 | 3300045051 | Ga0451576_0048352 | Ga0451576_0048352_3625_4143 | 157 |
| 76 | 3300046476 | Ga0495662_0010433 | Ga0495662_0010433_2575_3093 | 157 |
| 77 | 3300046516 | Ga0495628_0306346 | Ga0495628_0306346_383_904 | 157 |
| 78 | 3300046517 | Ga0495630_0015069 | Ga0495630_0015069_3263_3781 | 157 |
| 79 | 3300046533 | Ga0495640_0008853 | Ga0495640_0008853_1455_1973 | 157 |
| 80 | 3300046537 | Ga0495598_0133655 | Ga0495598_0133655_208_726 | 157 |
| 81 | 3300046537 | Ga0495598_0133912 | Ga0495598_0133912_153_671 | 157 |
| 82 | 3300046559 | Ga0495667_0011382 | Ga0495667_0011382_362_880 | 157 |
| 83 | 3300046642 | Ga0495634_0201985 | Ga0495634_0201985_253_771 | 157 |
| 84 | 3300046679 | Ga0495623_0099069 | Ga0495623_0099069_1031_1549 | 157 |
| 85 | 3300046681 | Ga0495647_0101047 | Ga0495647_0101047_456_974 | 157 |
| 86 | 3300046690 | Ga0495624_0039898 | Ga0495624_0039898_734_1252 | 157 |
| 87 | 3300046809 | Ga0495600_0419864 | Ga0495600_0419864_162_680 | 157 |
| 88 | 3300047315 | Ga0495581_0158300 | Ga0495581_0158300_707_1225 | 157 |
| 89 | 3300047317 | Ga0495604_0350888 | Ga0495604_0350888_440_958 | 157 |
| 90 | 3300047318 | Ga0495636_0008964 | Ga0495636_0008964_1791_2309 | 157 |
| 91 | 3300047322 | Ga0495680_0320143 | Ga0495680_0320143_189_707 | 157 |
| 92 | 3300047322 | Ga0495680_0332072 | Ga0495680_0332072_445_963 | 157 |
| 93 | 3300049569 | Ga0501032_0113155 | Ga0501032_0113155_794_1312 | 157 |
| 94 | 3300049570 | Ga0501033_0217114 | Ga0501033_0217114_160_678 | 157 |
| 95 | 3300049572 | Ga0501036_0379322 | Ga0501036_0379322_192_710 | 157 |
| 96 | 3300049573 | Ga0501037_0239415 | Ga0501037_0239415_41_559 | 157 |
| 97 | 3300049574 | Ga0501038_0065713 | Ga0501038_0065713_709_1227 | 157 |
| 98 | 3300049575 | Ga0501039_0367635 | Ga0501039_0367635_562_1080 | 157 |
| 99 | 3300049584 | Ga0501068_0561312 | Ga0501068_0561312_165_683 | 157 |
| 100 | 3300049586 | Ga0501070_0031163 | Ga0501070_0031163_3706_4224 | 157 |
| 101 | 3300049586 | Ga0501070_0106834 | Ga0501070_0106834_270_788 | 157 |
| 102 | 3300049588 | Ga0501072_0210136 | Ga0501072_0210136_327_845 | 157 |
| 103 | 3300049589 | Ga0501073_0212684 | Ga0501073_0212684_450_968 | 157 |
| 104 | 3300049744 | Ga0501083_0028191 | Ga0501083_0028191_340_858 | 157 |
| 105 | 3300050492 | nmdc:mga0yw44_9360_c1 | nmdc:mga0yw44_9360_c1_225_743 | 157 |
| 106 | 3300050511 | nmdc:mga08y16_194844_c1 | nmdc:mga08y16_194844_c1_1360_1878 | 157 |
| 107 | 3300050512 | nmdc:mga0n895_263799_c1 | nmdc:mga0n895_263799_c1_666_1184 | 157 |
| 108 | 3300050513 | nmdc:mga0rr50_384192_c1 | nmdc:mga0rr50_384192_c1_58_576 | 157 |
| 109 | 3300050513 | nmdc:mga0rr50_392832_c1 | nmdc:mga0rr50_392832_c1_446_964 | 157 |
| 110 | 3300050514 | nmdc:mga08x19_820_c1 | nmdc:mga08x19_820_c1_10504_11022 | 157 |
| 111 | 3300050515 | nmdc:mga0a205_477547_c1 | nmdc:mga0a205_477547_c1_59_577 | 157 |
| 112 | 3300059421 | Ga0590071_134490 | Ga0590071_134490_57_575 | 157 |
| 113 | 3300060353 | Ga0501082_0040538 | Ga0501082_0040538_1287_1805 | 157 |
| 114 | iso_pu_bacteria | 8057568493 | 8057568882 | 157 |
| 115 | 3300021384 | Ga0213876_10266763 | Ga0213876_102667632 | 158 |
| 116 | 3300025299 | Ga0209256_1003564 | Ga0209256_10035642 | 158 |
| 117 | 3300030878 | Ga0265770_1032434 | Ga0265770_10324342 | 158 |
| 118 | 3300032004 | Ga0307414_10305719 | Ga0307414_103057192 | 158 |
| 119 | 3300035692 | Ga0373935_0534944 | Ga0373935_0534944_23_544 | 158 |
| 120 | 3300038443 | Ga0395901_0250160 | Ga0395901_0250160_412_933 | 158 |
| 121 | 3300039437 | Ga0436365_1785580 | Ga0436365_1785580_29_595 | 158 |
| 122 | 3300042876 | Ga0451577_0429767 | Ga0451577_0429767_14_535 | 158 |
| 123 | 3300046518 | Ga0495631_0126907 | Ga0495631_0126907_484_1005 | 158 |
| 124 | 3300047446 | Ga0495679_005264 | Ga0495679_005264_209_730 | 158 |
| 125 | 3300049583 | Ga0501067_0009778 | Ga0501067_0009778_4417_4938 | 158 |
| 126 | 3300049588 | Ga0501072_0073568 | Ga0501072_0073568_406_927 | 158 |
| 127 | 3300049590 | Ga0501074_0039623 | Ga0501074_0039623_1315_1836 | 158 |
| 128 | 3300049742 | Ga0501080_0589651 | Ga0501080_0589651_15_536 | 158 |
| 129 | 3300049744 | Ga0501083_0533813 | Ga0501083_0533813_231_752 | 158 |
| 130 | 3300053125 | Ga0500618_000110 | Ga0500618_000110_10133_10654 | 158 |
| 131 | 3300053136 | Ga0500559_0000055 | Ga0500559_0000055_78972_79493 | 158 |
| 132 | 3300054114 | Ga0501084_0064988 | Ga0501084_0064988_1691_2212 | 158 |
| 133 | 3300060353 | Ga0501082_0014421 | Ga0501082_0014421_4180_4701 | 158 |
| 134 | iso_pu_bacteria | 2524023250 | 2524609267 | 158 |
| 135 | iso_pu_bacteria | 2643221598 | 2644002167 | 158 |
| 136 | iso_pu_bacteria | 2791355048 | 2792463552 | 158 |
| 137 | iso_pu_bacteria | 2843744320 | 2843748344 | 158 |
| 138 | iso_pu_bacteria | 2849560528 | 2849564756 | 158 |
| 139 | iso_pu_bacteria | 2849573788 | 2849576998 | 158 |
| 140 | iso_pu_bacteria | 2851153111 | 2851155146 | 158 |
| 141 | iso_pu_bacteria | 2898329390 | 2898329694 | 158 |
| 142 | iso_pu_bacteria | 2941485952 | 2941486390 | 158 |
| 143 | 3300044658 | Ga0466972_0210194 | Ga0466972_0210194_238_762 | 159 |
| 144 | 3300005327 | Ga0070658_10001192 | Ga0070658_1000119212 | 160 |
| 145 | 3300005336 | Ga0070680_100000297 | Ga0070680_10000029727 | 160 |
| 146 | 3300005458 | Ga0070681_10025473 | Ga0070681_100254733 | 160 |
| 147 | 3300005530 | Ga0070679_100006559 | Ga0070679_1000065598 | 160 |
| 148 | 3300013104 | Ga0157370_10078473 | Ga0157370_100784734 | 160 |
| 149 | 3300025909 | Ga0207705_10015019 | Ga0207705_100150197 | 160 |
| 150 | 3300025912 | Ga0207707_10001022 | Ga0207707_1000102223 | 160 |
| 151 | 3300025917 | Ga0207660_10000404 | Ga0207660_100004047 | 160 |
| 152 | 3300025919 | Ga0207657_10368149 | Ga0207657_103681492 | 160 |
| 153 | 3300025921 | Ga0207652_10000717 | Ga0207652_1000071727 | 160 |
| 154 | 3300041443 | Ga0451789_1052800 | Ga0451789_1052800_131_670 | 160 |
| 155 | 3300046678 | Ga0495599_0127281 | Ga0495599_0127281_726_1226 | 160 |
| 156 | 3300031731 | Ga0307405_10032700 | Ga0307405_100327004 | 161 |
| 157 | 3300049685 | Ga0501256_030455 | Ga0501256_030455_30_521 | 161 |
| 158 | 3300005435 | Ga0070714_101167849 | Ga0070714_1011678492 | 162 |
| 159 | 3300005467 | Ga0070706_100034591 | Ga0070706_1000345914 | 162 |
| 160 | 3300005468 | Ga0070707_100179566 | Ga0070707_1001795662 | 162 |
| 161 | 3300005468 | Ga0070707_100867664 | Ga0070707_1008676641 | 162 |
| 162 | 3300025910 | Ga0207684_10015851 | Ga0207684_100158516 | 162 |
| 163 | 3300025910 | Ga0207684_11274077 | Ga0207684_112740771 | 162 |
| 164 | 3300025916 | Ga0207663_11439085 | Ga0207663_114390851 | 162 |
| 165 | 3300025922 | Ga0207646_10038249 | Ga0207646_100382492 | 162 |
| 166 | iso_pu_bacteria | 2643221578 | 2643901990 | 162 |
| 167 | iso_pu_bacteria | 2643221601 | 2644017982 | 162 |
| 168 | iso_pu_bacteria | 2643221631 | 2644180730 | 162 |
| 169 | iso_pu_bacteria | 2643221673 | 2644408134 | 162 |
| 170 | iso_pu_bacteria | 2643221711 | 2644607381 | 162 |
| 171 | iso_pu_bacteria | 2811994882 | 2812373829 | 162 |
| 172 | iso_pu_bacteria | 2818991462 | 2819691312 | 162 |
| 173 | iso_pu_bacteria | 2818991469 | 2819729205 | 162 |
| 174 | iso_pu_bacteria | 2875391855 | 2875397701 | 162 |
| 175 | iso_pu_bacteria | 2946045630 | 2946046824 | 162 |
| 176 | 3300005577 | Ga0068857_100806713 | Ga0068857_1008067132 | 163 |
| 177 | 3300005617 | Ga0068859_101174599 | Ga0068859_1011745992 | 163 |
| 178 | 3300006844 | Ga0075428_100016810 | Ga0075428_1000168103 | 163 |
| 179 | 3300006844 | Ga0075428_100081064 | Ga0075428_1000810644 | 163 |
| 180 | 3300006846 | Ga0075430_100013280 | Ga0075430_1000132804 | 163 |
| 181 | 3300006846 | Ga0075430_100312955 | Ga0075430_1003129551 | 163 |
| 182 | 3300006847 | Ga0075431_100015347 | Ga0075431_1000153478 | 163 |
| 183 | 3300006847 | Ga0075431_100441400 | Ga0075431_1004414002 | 163 |
| 184 | 3300006847 | Ga0075431_100809161 | Ga0075431_1008091612 | 163 |
| 185 | 3300006880 | Ga0075429_100003160 | Ga0075429_10000316011 | 163 |
| 186 | 3300006880 | Ga0075429_100347510 | Ga0075429_1003475102 | 163 |
| 187 | 3300006931 | Ga0097620_101174406 | Ga0097620_1011744062 | 163 |
| 188 | 3300009147 | Ga0114129_10003939 | Ga0114129_100039396 | 163 |
| 189 | 3300009147 | Ga0114129_10029362 | Ga0114129_100293625 | 163 |
| 190 | 3300009147 | Ga0114129_10072691 | Ga0114129_100726914 | 163 |
| 191 | 3300009147 | Ga0114129_10236611 | Ga0114129_102366113 | 163 |
| 192 | 3300009174 | Ga0105241_10607688 | Ga0105241_106076882 | 163 |
| 193 | 3300026116 | Ga0207674_10298033 | Ga0207674_102980332 | 163 |
| 194 | 3300031995 | Ga0307409_100845266 | Ga0307409_1008452661 | 163 |
| 195 | 3300032126 | Ga0307415_101621540 | Ga0307415_1016215401 | 163 |
| 196 | 3300035117 | Ga0373953_0442143 | Ga0373953_0442143_31_525 | 163 |
| 197 | 3300035207 | Ga0373942_0018270 | Ga0373942_0018270_73_573 | 163 |
| 198 | 3300035725 | Ga0373947_0339740 | Ga0373947_0339740_264_758 | 163 |
| 199 | 3300036401 | Ga0373937_0054128 | Ga0373937_0054128_2786_3280 | 163 |
| 200 | 3300041452 | Ga0451793_1844926 | Ga0451793_1844926_22_516 | 163 |
| 201 | 3300046559 | Ga0495667_0147219 | Ga0495667_0147219_578_1072 | 163 |
| 202 | 3300050507 | nmdc:mga05p37_123297_c1 | nmdc:mga05p37_123297_c1_280_777 | 163 |
| 203 | 3300050507 | nmdc:mga05p37_25797_c1 | nmdc:mga05p37_25797_c1_2726_3220 | 163 |
| 204 | 3300050508 | nmdc:mga09592_33389_c1 | nmdc:mga09592_33389_c1_1503_1994 | 163 |
| 205 | 3300050508 | nmdc:mga09592_693_c1 | nmdc:mga09592_693_c1_18922_19416 | 163 |
| 206 | 3300050509 | nmdc:mga0qj67_106_c1 | nmdc:mga0qj67_106_c1_17866_18360 | 163 |
| 207 | 3300050509 | nmdc:mga0qj67_33844_c1 | nmdc:mga0qj67_33844_c1_1345_1836 | 163 |
| 208 | 3300050510 | nmdc:mga06r32_17855_c1 | nmdc:mga06r32_17855_c1_1622_2113 | 163 |
| 209 | 3300050510 | nmdc:mga06r32_3172_c2 | nmdc:mga06r32_3172_c2_2831_3325 | 163 |
| 210 | 3300050510 | nmdc:mga06r32_378114_c1 | nmdc:mga06r32_378114_c1_308_805 | 163 |
| 211 | 3300050510 | nmdc:mga06r32_832008_c1 | nmdc:mga06r32_832008_c1_272_769 | 163 |
| 212 | 3300053085 | Ga0495619_0194072 | Ga0495619_0194072_541_1035 | 163 |
| 213 | 3300053088 | Ga0500644_0028617 | Ga0500644_0028617_815_1321 | 163 |
| 214 | 3300020080 | Ga0206350_10124477 | Ga0206350_101244771 | 165 |
| 215 | 3300020610 | Ga0154015_1709930 | Ga0154015_17099301 | 165 |
| 216 | 3300026121 | Ga0207683_11331636 | Ga0207683_113316361 | 165 |
| 217 | 3300044765 | Ga0466970_0576252 | Ga0466970_0576252_115_621 | 165 |
| 218 | 3300049590 | Ga0501074_0536248 | Ga0501074_0536248_210_716 | 165 |
| 219 | 3300001990 | JGI24737J22298_10022234 | JGI24737J22298_100222342 | 166 |
| 220 | 3300002074 | JGI24748J21848_1015178 | JGI24748J21848_10151781 | 166 |
| 221 | 3300003203 | JGI25406J46586_10005808 | JGI25406J46586_100058083 | 166 |
| 222 | 3300003911 | JGI25405J52794_10037970 | JGI25405J52794_100379701 | 166 |
| 223 | 3300005329 | Ga0070683_100291298 | Ga0070683_1002912982 | 166 |
| 224 | 3300005330 | Ga0070690_100737001 | Ga0070690_1007370011 | 166 |
| 225 | 3300005337 | Ga0070682_100083369 | Ga0070682_1000833693 | 166 |
| 226 | 3300005337 | Ga0070682_100178088 | Ga0070682_1001780881 | 166 |
| 227 | 3300005337 | Ga0070682_100755209 | Ga0070682_1007552091 | 166 |
| 228 | 3300005337 | Ga0070682_100852579 | Ga0070682_1008525791 | 166 |
| 229 | 3300005345 | Ga0070692_10303370 | Ga0070692_103033702 | 166 |
| 230 | 3300005347 | Ga0070668_100070930 | Ga0070668_1000709302 | 166 |
| 231 | 3300005355 | Ga0070671_100043473 | Ga0070671_1000434734 | 166 |
| 232 | 3300005365 | Ga0070688_100709555 | Ga0070688_1007095551 | 166 |
| 233 | 3300005367 | Ga0070667_100013536 | Ga0070667_1000135363 | 166 |
| 234 | 3300005435 | Ga0070714_100000701 | Ga0070714_10000070118 | 166 |
| 235 | 3300005435 | Ga0070714_100005205 | Ga0070714_1000052057 | 166 |
| 236 | 3300005435 | Ga0070714_100011815 | Ga0070714_1000118156 | 166 |
| 237 | 3300005436 | Ga0070713_100527263 | Ga0070713_1005272632 | 166 |
| 238 | 3300005466 | Ga0070685_10818795 | Ga0070685_108187951 | 166 |
| 239 | 3300005535 | Ga0070684_100364310 | Ga0070684_1003643102 | 166 |
| 240 | 3300005547 | Ga0070693_100717615 | Ga0070693_1007176151 | 166 |
| 241 | 3300005548 | Ga0070665_100652231 | Ga0070665_1006522312 | 166 |
| 242 | 3300005564 | Ga0070664_100932362 | Ga0070664_1009323622 | 166 |
| 243 | 3300005614 | Ga0068856_100007511 | Ga0068856_1000075119 | 166 |
| 244 | 3300005616 | Ga0068852_100054959 | Ga0068852_1000549592 | 166 |
| 245 | 3300005617 | Ga0068859_100000301 | Ga0068859_10000030124 | 166 |
| 246 | 3300005617 | Ga0068859_100003956 | Ga0068859_10000395612 | 166 |
| 247 | 3300005618 | Ga0068864_100462482 | Ga0068864_1004624822 | 166 |
| 248 | 3300005618 | Ga0068864_101859878 | Ga0068864_1018598781 | 166 |
| 249 | 3300005841 | Ga0068863_100000163 | Ga0068863_10000016361 | 166 |
| 250 | 3300005841 | Ga0068863_100139312 | Ga0068863_1001393122 | 166 |
| 251 | 3300005842 | Ga0068858_100000010 | Ga0068858_100000010224 | 166 |
| 252 | 3300005843 | Ga0068860_100064334 | Ga0068860_1000643342 | 166 |
| 253 | 3300005844 | Ga0068862_100000049 | Ga0068862_10000004926 | 166 |
| 254 | 3300005937 | Ga0081455_10000544 | Ga0081455_1000054432 | 166 |
| 255 | 3300005937 | Ga0081455_10259492 | Ga0081455_102594922 | 166 |
| 256 | 3300005983 | Ga0081540_1164447 | Ga0081540_11644472 | 166 |
| 257 | 3300005985 | Ga0081539_10000094 | Ga0081539_1000009484 | 166 |
| 258 | 3300006028 | Ga0070717_10001308 | Ga0070717_100013085 | 166 |
| 259 | 3300006028 | Ga0070717_10488027 | Ga0070717_104880273 | 166 |
| 260 | 3300006173 | Ga0070716_100121795 | Ga0070716_1001217952 | 166 |
| 261 | 3300006846 | Ga0075430_100250134 | Ga0075430_1002501342 | 166 |
| 262 | 3300006880 | Ga0075429_100031061 | Ga0075429_1000310616 | 166 |
| 263 | 3300006931 | Ga0097620_100000301 | Ga0097620_10000030126 | 166 |
| 264 | 3300006931 | Ga0097620_100003956 | Ga0097620_1000039565 | 166 |
| 265 | 3300007076 | Ga0075435_100663325 | Ga0075435_1006633251 | 166 |
| 266 | 3300009011 | Ga0105251_10036456 | Ga0105251_100364563 | 166 |
| 267 | 3300009092 | Ga0105250_10155234 | Ga0105250_101552342 | 166 |
| 268 | 3300009092 | Ga0105250_10241967 | Ga0105250_102419671 | 166 |
| 269 | 3300009093 | Ga0105240_10037718 | Ga0105240_100377182 | 166 |
| 270 | 3300009094 | Ga0111539_11176431 | Ga0111539_111764311 | 166 |
| 271 | 3300009098 | Ga0105245_10109792 | Ga0105245_101097924 | 166 |
| 272 | 3300009098 | Ga0105245_11168492 | Ga0105245_111684921 | 166 |
| 273 | 3300009101 | Ga0105247_10000834 | Ga0105247_1000083410 | 166 |
| 274 | 3300009148 | Ga0105243_10383916 | Ga0105243_103839162 | 166 |
| 275 | 3300009177 | Ga0105248_10000147 | Ga0105248_1000014714 | 166 |
| 276 | 3300009177 | Ga0105248_10000377 | Ga0105248_1000037736 | 166 |
| 277 | 3300009177 | Ga0105248_11022731 | Ga0105248_110227312 | 166 |
| 278 | 3300009545 | Ga0105237_10013119 | Ga0105237_100131193 | 166 |
| 279 | 3300009545 | Ga0105237_10040024 | Ga0105237_100400241 | 166 |
| 280 | 3300009545 | Ga0105237_10808569 | Ga0105237_108085691 | 166 |
| 281 | 3300009553 | Ga0105249_10165031 | Ga0105249_101650312 | 166 |
| 282 | 3300009553 | Ga0105249_10277011 | Ga0105249_102770111 | 166 |
| 283 | 3300009986 | Ga0105033_103522 | Ga0105033_1035221 | 166 |
| 284 | 3300010375 | Ga0105239_10018684 | Ga0105239_100186845 | 166 |
| 285 | 3300010375 | Ga0105239_10702747 | Ga0105239_107027472 | 166 |
| 286 | 3300012492 | Ga0157335_1004676 | Ga0157335_10046761 | 166 |
| 287 | 3300013105 | Ga0157369_10023576 | Ga0157369_100235763 | 166 |
| 288 | 3300013105 | Ga0157369_10718874 | Ga0157369_107188741 | 166 |
| 289 | 3300013296 | Ga0157374_10187916 | Ga0157374_101879162 | 166 |
| 290 | 3300013308 | Ga0157375_10018285 | Ga0157375_100182852 | 166 |
| 291 | 3300013308 | Ga0157375_10184847 | Ga0157375_101848473 | 166 |
| 292 | 3300013308 | Ga0157375_10525782 | Ga0157375_105257822 | 166 |
| 293 | 3300014325 | Ga0163163_10002172 | Ga0163163_100021726 | 166 |
| 294 | 3300014325 | Ga0163163_10010694 | Ga0163163_100106949 | 166 |
| 295 | 3300014325 | Ga0163163_10102206 | Ga0163163_101022064 | 166 |
| 296 | 3300014325 | Ga0163163_10363312 | Ga0163163_103633122 | 166 |
| 297 | 3300014325 | Ga0163163_10450650 | Ga0163163_104506502 | 166 |
| 298 | 3300014325 | Ga0163163_10710561 | Ga0163163_107105612 | 166 |
| 299 | 3300014968 | Ga0157379_10000149 | Ga0157379_1000014938 | 166 |
| 300 | 3300020069 | Ga0197907_10830029 | Ga0197907_108300292 | 166 |
| 301 | 3300020077 | Ga0206351_10215200 | Ga0206351_102152001 | 166 |
| 302 | 3300022467 | Ga0224712_10210574 | Ga0224712_102105742 | 166 |
| 303 | 3300025711 | Ga0207696_1117897 | Ga0207696_11178971 | 166 |
| 304 | 3300025900 | Ga0207710_10000107 | Ga0207710_100001078 | 166 |
| 305 | 3300025900 | Ga0207710_10000144 | Ga0207710_1000014428 | 166 |
| 306 | 3300025904 | Ga0207647_10055951 | Ga0207647_100559513 | 166 |
| 307 | 3300025904 | Ga0207647_10271449 | Ga0207647_102714492 | 166 |
| 308 | 3300025906 | Ga0207699_10000045 | Ga0207699_10000045125 | 166 |
| 309 | 3300025911 | Ga0207654_10107189 | Ga0207654_101071891 | 166 |
| 310 | 3300025913 | Ga0207695_10035602 | Ga0207695_100356022 | 166 |
| 311 | 3300025914 | Ga0207671_10119158 | Ga0207671_101191582 | 166 |
| 312 | 3300025914 | Ga0207671_10614849 | Ga0207671_106148492 | 166 |
| 313 | 3300025914 | Ga0207671_10682671 | Ga0207671_106826711 | 166 |
| 314 | 3300025915 | Ga0207693_10693463 | Ga0207693_106934631 | 166 |
| 315 | 3300025915 | Ga0207693_11209026 | Ga0207693_112090261 | 166 |
| 316 | 3300025924 | Ga0207694_10381039 | Ga0207694_103810391 | 166 |
| 317 | 3300025927 | Ga0207687_10528271 | Ga0207687_105282712 | 166 |
| 318 | 3300025928 | Ga0207700_10048409 | Ga0207700_100484095 | 166 |
| 319 | 3300025928 | Ga0207700_10128005 | Ga0207700_101280052 | 166 |
| 320 | 3300025929 | Ga0207664_10000641 | Ga0207664_100006415 | 166 |
| 321 | 3300025929 | Ga0207664_10046528 | Ga0207664_100465282 | 166 |
| 322 | 3300025929 | Ga0207664_10407463 | Ga0207664_104074632 | 166 |
| 323 | 3300025929 | Ga0207664_10924062 | Ga0207664_109240621 | 166 |
| 324 | 3300025935 | Ga0207709_10616358 | Ga0207709_106163581 | 166 |
| 325 | 3300025939 | Ga0207665_10114972 | Ga0207665_101149722 | 166 |
| 326 | 3300025941 | Ga0207711_10000056 | Ga0207711_1000005613 | 166 |
| 327 | 3300025941 | Ga0207711_10010080 | Ga0207711_100100806 | 166 |
| 328 | 3300025941 | Ga0207711_11169981 | Ga0207711_111699812 | 166 |
| 329 | 3300025944 | Ga0207661_10137783 | Ga0207661_101377832 | 166 |
| 330 | 3300025949 | Ga0207667_10003347 | Ga0207667_1000334716 | 166 |
| 331 | 3300025961 | Ga0207712_10119767 | Ga0207712_101197672 | 166 |
| 332 | 3300025986 | Ga0207658_10138354 | Ga0207658_101383544 | 166 |
| 333 | 3300026023 | Ga0207677_10186648 | Ga0207677_101866482 | 166 |
| 334 | 3300026035 | Ga0207703_10000002 | Ga0207703_1000000251 | 166 |
| 335 | 3300026078 | Ga0207702_10009578 | Ga0207702_100095789 | 166 |
| 336 | 3300026078 | Ga0207702_10022306 | Ga0207702_100223065 | 166 |
| 337 | 3300026088 | Ga0207641_10000877 | Ga0207641_1000087728 | 166 |
| 338 | 3300026088 | Ga0207641_10012501 | Ga0207641_100125017 | 166 |
| 339 | 3300026088 | Ga0207641_10256522 | Ga0207641_102565222 | 166 |
| 340 | 3300026095 | Ga0207676_10448950 | Ga0207676_104489502 | 166 |
| 341 | 3300026121 | Ga0207683_10489755 | Ga0207683_104897552 | 166 |
| 342 | 3300026121 | Ga0207683_10639308 | Ga0207683_106393082 | 166 |
| 343 | 3300028379 | Ga0268266_10035268 | Ga0268266_100352683 | 166 |
| 344 | 3300028380 | Ga0268265_10000017 | Ga0268265_10000017132 | 166 |
| 345 | 3300028381 | Ga0268264_10003187 | Ga0268264_1000318710 | 166 |
| 346 | 3300031456 | Ga0307513_10047714 | Ga0307513_100477146 | 166 |
| 347 | 3300031456 | Ga0307513_10287866 | Ga0307513_102878662 | 166 |
| 348 | 3300031548 | Ga0307408_100482781 | Ga0307408_1004827812 | 166 |
| 349 | 3300031824 | Ga0307413_10458006 | Ga0307413_104580062 | 166 |
| 350 | 3300031852 | Ga0307410_10001047 | Ga0307410_100010475 | 166 |
| 351 | 3300031852 | Ga0307410_10038534 | Ga0307410_100385345 | 166 |
| 352 | 3300031852 | Ga0307410_10321663 | Ga0307410_103216632 | 166 |
| 353 | 3300031852 | Ga0307410_10634507 | Ga0307410_106345072 | 166 |
| 354 | 3300031901 | Ga0307406_10096690 | Ga0307406_100966903 | 166 |
| 355 | 3300031901 | Ga0307406_10136734 | Ga0307406_101367343 | 166 |
| 356 | 3300031903 | Ga0307407_10257666 | Ga0307407_102576662 | 166 |
| 357 | 3300031903 | Ga0307407_10434125 | Ga0307407_104341251 | 166 |
| 358 | 3300031911 | Ga0307412_10251110 | Ga0307412_102511102 | 166 |
| 359 | 3300031995 | Ga0307409_100093287 | Ga0307409_1000932874 | 166 |
| 360 | 3300031995 | Ga0307409_100094104 | Ga0307409_1000941042 | 166 |
| 361 | 3300031995 | Ga0307409_100110011 | Ga0307409_1001100113 | 166 |
| 362 | 3300031995 | Ga0307409_100346646 | Ga0307409_1003466462 | 166 |
| 363 | 3300031995 | Ga0307409_100468656 | Ga0307409_1004686562 | 166 |
| 364 | 3300032002 | Ga0307416_100053043 | Ga0307416_1000530433 | 166 |
| 365 | 3300032002 | Ga0307416_100330506 | Ga0307416_1003305061 | 166 |
| 366 | 3300032002 | Ga0307416_100626013 | Ga0307416_1006260132 | 166 |
| 367 | 3300032002 | Ga0307416_100941587 | Ga0307416_1009415872 | 166 |
| 368 | 3300032004 | Ga0307414_10175222 | Ga0307414_101752223 | 166 |
| 369 | 3300032005 | Ga0307411_10673289 | Ga0307411_106732892 | 166 |
| 370 | 3300032126 | Ga0307415_100031514 | Ga0307415_1000315142 | 166 |
| 371 | 3300032126 | Ga0307415_100102430 | Ga0307415_1001024303 | 166 |
| 372 | 3300032126 | Ga0307415_100198226 | Ga0307415_1001982262 | 166 |
| 373 | 3300032126 | Ga0307415_100224594 | Ga0307415_1002245942 | 166 |
| 374 | 3300032126 | Ga0307415_100315906 | Ga0307415_1003159061 | 166 |
| 375 | 3300032126 | Ga0307415_100934863 | Ga0307415_1009348631 | 166 |
| 376 | 3300033179 | Ga0307507_10000113 | Ga0307507_100001137 | 166 |
| 377 | 3300033179 | Ga0307507_10004395 | Ga0307507_100043952 | 166 |
| 378 | 3300035119 | Ga0373956_0012279 | Ga0373956_0012279_2286_2819 | 166 |
| 379 | 3300035695 | Ga0373927_0125662 | Ga0373927_0125662_477_980 | 166 |
| 380 | 3300037312 | Ga0395899_0017796 | Ga0395899_0017796_4744_5250 | 166 |
| 381 | 3300037418 | Ga0395900_0015034 | Ga0395900_0015034_3038_3544 | 166 |
| 382 | 3300037418 | Ga0395900_0108490 | Ga0395900_0108490_1856_2362 | 166 |
| 383 | 3300037418 | Ga0395900_0138769 | Ga0395900_0138769_1891_2433 | 166 |
| 384 | 3300037418 | Ga0395900_0183497 | Ga0395900_0183497_1198_1707 | 166 |
| 385 | 3300037466 | Ga0395898_1051954 | Ga0395898_1051954_63_605 | 166 |
| 386 | 3300037471 | Ga0395905_0300418 | Ga0395905_0300418_125_634 | 166 |
| 387 | 3300037471 | Ga0395905_0448999 | Ga0395905_0448999_489_1031 | 166 |
| 388 | 3300037471 | Ga0395905_0515252 | Ga0395905_0515252_122_643 | 166 |
| 389 | 3300038443 | Ga0395901_0340924 | Ga0395901_0340924_811_1353 | 166 |
| 390 | 3300041410 | Ga0439461_0089488 | Ga0439461_0089488_41_550 | 166 |
| 391 | 3300041452 | Ga0451793_0219251 | Ga0451793_0219251_10_516 | 166 |
| 392 | 3300042002 | Ga0439442_030398 | Ga0439442_030398_76_597 | 166 |
| 393 | 3300044656 | Ga0466969_0012981 | Ga0466969_0012981_459_962 | 166 |
| 394 | 3300044656 | Ga0466969_0090528 | Ga0466969_0090528_273_782 | 166 |
| 395 | 3300044656 | Ga0466969_0094403 | Ga0466969_0094403_522_1025 | 166 |
| 396 | 3300044656 | Ga0466969_0096229 | Ga0466969_0096229_343_852 | 166 |
| 397 | 3300044658 | Ga0466972_0013425 | Ga0466972_0013425_1575_2081 | 166 |
| 398 | 3300044658 | Ga0466972_0031423 | Ga0466972_0031423_316_825 | 166 |
| 399 | 3300044658 | Ga0466972_0083717 | Ga0466972_0083717_915_1421 | 166 |
| 400 | 3300044658 | Ga0466972_0426056 | Ga0466972_0426056_78_587 | 166 |
| 401 | 3300044683 | Ga0466965_0023943 | Ga0466965_0023943_993_1502 | 166 |
| 402 | 3300044683 | Ga0466965_0433285 | Ga0466965_0433285_208_714 | 166 |
| 403 | 3300044684 | Ga0466966_0039381 | Ga0466966_0039381_459_977 | 166 |
| 404 | 3300044684 | Ga0466966_0059821 | Ga0466966_0059821_1611_2114 | 166 |
| 405 | 3300044684 | Ga0466966_0121075 | Ga0466966_0121075_216_722 | 166 |
| 406 | 3300044684 | Ga0466966_0403536 | Ga0466966_0403536_275_784 | 166 |
| 407 | 3300044684 | Ga0466966_0449776 | Ga0466966_0449776_29_538 | 166 |
| 408 | 3300044693 | Ga0466961_0003497 | Ga0466961_0003497_4842_5342 | 166 |
| 409 | 3300044693 | Ga0466961_0049856 | Ga0466961_0049856_1658_2161 | 166 |
| 410 | 3300044693 | Ga0466961_0066958 | Ga0466961_0066958_1169_1675 | 166 |
| 411 | 3300044693 | Ga0466961_0072924 | Ga0466961_0072924_1382_1891 | 166 |
| 412 | 3300044693 | Ga0466961_0088673 | Ga0466961_0088673_437_949 | 166 |
| 413 | 3300044693 | Ga0466961_0108177 | Ga0466961_0108177_887_1402 | 166 |
| 414 | 3300044693 | Ga0466961_0134902 | Ga0466961_0134902_60_578 | 166 |
| 415 | 3300044693 | Ga0466961_0189160 | Ga0466961_0189160_224_733 | 166 |
| 416 | 3300044693 | Ga0466961_0192442 | Ga0466961_0192442_504_1013 | 166 |
| 417 | 3300044693 | Ga0466961_0295475 | Ga0466961_0295475_274_780 | 166 |
| 418 | 3300044694 | Ga0466963_0002849 | Ga0466963_0002849_5223_5735 | 166 |
| 419 | 3300044694 | Ga0466963_0014159 | Ga0466963_0014159_4146_4655 | 166 |
| 420 | 3300044694 | Ga0466963_0029589 | Ga0466963_0029589_1551_2057 | 166 |
| 421 | 3300044694 | Ga0466963_0052305 | Ga0466963_0052305_1915_2424 | 166 |
| 422 | 3300044694 | Ga0466963_0086900 | Ga0466963_0086900_1344_1853 | 166 |
| 423 | 3300044694 | Ga0466963_0208994 | Ga0466963_0208994_433_939 | 166 |
| 424 | 3300044706 | Ga0466964_0007178 | Ga0466964_0007178_1799_2308 | 166 |
| 425 | 3300044706 | Ga0466964_0089676 | Ga0466964_0089676_311_820 | 166 |
| 426 | 3300044706 | Ga0466964_0426520 | Ga0466964_0426520_154_663 | 166 |
| 427 | 3300044719 | Ga0466971_0003719 | Ga0466971_0003719_5254_5763 | 166 |
| 428 | 3300044719 | Ga0466971_0007792 | Ga0466971_0007792_1054_1566 | 166 |
| 429 | 3300044719 | Ga0466971_0026619 | Ga0466971_0026619_1131_1649 | 166 |
| 430 | 3300044719 | Ga0466971_0044346 | Ga0466971_0044346_1375_1884 | 166 |
| 431 | 3300044719 | Ga0466971_0195562 | Ga0466971_0195562_28_537 | 166 |
| 432 | 3300044719 | Ga0466971_0393811 | Ga0466971_0393811_22_528 | 166 |
| 433 | 3300044765 | Ga0466970_0010596 | Ga0466970_0010596_3481_4182 | 166 |
| 434 | 3300044765 | Ga0466970_0020655 | Ga0466970_0020655_2286_2801 | 166 |
| 435 | 3300044765 | Ga0466970_0036349 | Ga0466970_0036349_1436_1939 | 166 |
| 436 | 3300044765 | Ga0466970_0048225 | Ga0466970_0048225_800_1306 | 166 |
| 437 | 3300044765 | Ga0466970_0091491 | Ga0466970_0091491_305_814 | 166 |
| 438 | 3300044765 | Ga0466970_0552196 | Ga0466970_0552196_55_564 | 166 |
| 439 | 3300044842 | Ga0466957_0014176 | Ga0466957_0014176_3388_3897 | 166 |
| 440 | 3300044842 | Ga0466957_0021338 | Ga0466957_0021338_682_1191 | 166 |
| 441 | 3300044842 | Ga0466957_0053914 | Ga0466957_0053914_815_1321 | 166 |
| 442 | 3300044842 | Ga0466957_0082117 | Ga0466957_0082117_1303_1809 | 166 |
| 443 | 3300044842 | Ga0466957_0130898 | Ga0466957_0130898_703_1206 | 166 |
| 444 | 3300044842 | Ga0466957_0177635 | Ga0466957_0177635_203_715 | 166 |
| 445 | 3300044842 | Ga0466957_0299987 | Ga0466957_0299987_73_582 | 166 |
| 446 | 3300044842 | Ga0466957_0700959 | Ga0466957_0700959_60_566 | 166 |
| 447 | 3300044901 | Ga0466960_0007075 | Ga0466960_0007075_2598_3104 | 166 |
| 448 | 3300044901 | Ga0466960_0072265 | Ga0466960_0072265_348_857 | 166 |
| 449 | 3300044901 | Ga0466960_0100153 | Ga0466960_0100153_515_1021 | 166 |
| 450 | 3300044901 | Ga0466960_0124142 | Ga0466960_0124142_717_1223 | 166 |
| 451 | 3300044901 | Ga0466960_0232322 | Ga0466960_0232322_362_871 | 166 |
| 452 | 3300045049 | Ga0466959_0044294 | Ga0466959_0044294_2524_3027 | 166 |
| 453 | 3300045049 | Ga0466959_0054045 | Ga0466959_0054045_2307_2816 | 166 |
| 454 | 3300045049 | Ga0466959_0058916 | Ga0466959_0058916_1496_2008 | 166 |
| 455 | 3300045049 | Ga0466959_0062173 | Ga0466959_0062173_209_727 | 166 |
| 456 | 3300045049 | Ga0466959_0136848 | Ga0466959_0136848_546_1055 | 166 |
| 457 | 3300045049 | Ga0466959_0150860 | Ga0466959_0150860_1066_1569 | 166 |
| 458 | 3300045049 | Ga0466959_0310694 | Ga0466959_0310694_113_619 | 166 |
| 459 | 3300045836 | Ga0466958_0006888 | Ga0466958_0006888_1352_1861 | 166 |
| 460 | 3300045836 | Ga0466958_0008606 | Ga0466958_0008606_3237_3749 | 166 |
| 461 | 3300045836 | Ga0466958_0015729 | Ga0466958_0015729_3580_4098 | 166 |
| 462 | 3300045836 | Ga0466958_0041210 | Ga0466958_0041210_865_1383 | 166 |
| 463 | 3300045836 | Ga0466958_0044573 | Ga0466958_0044573_1080_1589 | 166 |
| 464 | 3300045836 | Ga0466958_0067772 | Ga0466958_0067772_316_825 | 166 |
| 465 | 3300045836 | Ga0466958_0516432 | Ga0466958_0516432_195_704 | 166 |
| 466 | 3300045836 | Ga0466958_0552229 | Ga0466958_0552229_146_652 | 166 |
| 467 | 3300045976 | Ga0466967_0006716 | Ga0466967_0006716_7396_7905 | 166 |
| 468 | 3300045976 | Ga0466967_0032803 | Ga0466967_0032803_1829_2338 | 166 |
| 469 | 3300045976 | Ga0466967_0050747 | Ga0466967_0050747_2518_3027 | 166 |
| 470 | 3300045976 | Ga0466967_0056572 | Ga0466967_0056572_1044_1553 | 166 |
| 471 | 3300045976 | Ga0466967_0172559 | Ga0466967_0172559_11_520 | 166 |
| 472 | 3300045976 | Ga0466967_0227288 | Ga0466967_0227288_830_1333 | 166 |
| 473 | 3300045976 | Ga0466967_0267314 | Ga0466967_0267314_192_698 | 166 |
| 474 | 3300045976 | Ga0466967_0328650 | Ga0466967_0328650_758_1261 | 166 |
| 475 | 3300045976 | Ga0466967_0915111 | Ga0466967_0915111_260_769 | 166 |
| 476 | 3300046454 | Ga0495592_0010881 | Ga0495592_0010881_1291_1794 | 166 |
| 477 | 3300046462 | Ga0495651_0022043 | Ga0495651_0022043_1103_1606 | 166 |
| 478 | 3300046462 | Ga0495651_0087932 | Ga0495651_0087932_121_624 | 166 |
| 479 | 3300046463 | Ga0495653_0012957 | Ga0495653_0012957_5188_5691 | 166 |
| 480 | 3300046473 | Ga0495582_0418121 | Ga0495582_0418121_68_574 | 166 |
| 481 | 3300046476 | Ga0495662_0000796 | Ga0495662_0000796_2195_2698 | 166 |
| 482 | 3300046477 | Ga0495664_0002832 | Ga0495664_0002832_6068_6571 | 166 |
| 483 | 3300046511 | Ga0495608_0013736 | Ga0495608_0013736_4682_5185 | 166 |
| 484 | 3300046511 | Ga0495608_0574961 | Ga0495608_0574961_35_538 | 166 |
| 485 | 3300046517 | Ga0495630_0146698 | Ga0495630_0146698_650_1153 | 166 |
| 486 | 3300046518 | Ga0495631_0036896 | Ga0495631_0036896_1062_1652 | 166 |
| 487 | 3300046525 | Ga0495663_0044446 | Ga0495663_0044446_119_709 | 166 |
| 488 | 3300046526 | Ga0495666_0002368 | Ga0495666_0002368_2999_3502 | 166 |
| 489 | 3300046529 | Ga0495652_0050310 | Ga0495652_0050310_1011_1514 | 166 |
| 490 | 3300046529 | Ga0495652_0163446 | Ga0495652_0163446_581_1084 | 166 |
| 491 | 3300046531 | Ga0495665_0034897 | Ga0495665_0034897_541_1044 | 166 |
| 492 | 3300046533 | Ga0495640_0037412 | Ga0495640_0037412_881_1384 | 166 |
| 493 | 3300046535 | Ga0495586_0059979 | Ga0495586_0059979_1310_1813 | 166 |
| 494 | 3300046543 | Ga0495645_0015444 | Ga0495645_0015444_4277_4780 | 166 |
| 495 | 3300046559 | Ga0495667_0091129 | Ga0495667_0091129_1107_1610 | 166 |
| 496 | 3300046615 | Ga0495656_0130395 | Ga0495656_0130395_132_641 | 166 |
| 497 | 3300046642 | Ga0495634_0517677 | Ga0495634_0517677_21_527 | 166 |
| 498 | 3300046674 | Ga0495588_0324046 | Ga0495588_0324046_250_753 | 166 |
| 499 | 3300046675 | Ga0495657_0009221 | Ga0495657_0009221_1211_1714 | 166 |
| 500 | 3300046678 | Ga0495599_0166206 | Ga0495599_0166206_542_1045 | 166 |
| 501 | 3300046679 | Ga0495623_0140179 | Ga0495623_0140179_545_1048 | 166 |
| 502 | 3300046679 | Ga0495623_0226480 | Ga0495623_0226480_38_541 | 166 |
| 503 | 3300046680 | Ga0495646_0116180 | Ga0495646_0116180_650_1153 | 166 |
| 504 | 3300046683 | Ga0495658_0434872 | Ga0495658_0434872_315_824 | 166 |
| 505 | 3300046689 | Ga0495613_0012604 | Ga0495613_0012604_2254_2757 | 166 |
| 506 | 3300046809 | Ga0495600_0135863 | Ga0495600_0135863_642_1145 | 166 |
| 507 | 3300047315 | Ga0495581_0074152 | Ga0495581_0074152_1355_1858 | 166 |
| 508 | 3300047317 | Ga0495604_0000925 | Ga0495604_0000925_8680_9183 | 166 |
| 509 | 3300047317 | Ga0495604_0001249 | Ga0495604_0001249_8590_9093 | 166 |
| 510 | 3300047318 | Ga0495636_0362954 | Ga0495636_0362954_36_539 | 166 |
| 511 | 3300047319 | Ga0495674_0048596 | Ga0495674_0048596_650_1153 | 166 |
| 512 | 3300047320 | Ga0495672_0371186 | Ga0495672_0371186_138_641 | 166 |
| 513 | 3300047321 | Ga0495676_0065421 | Ga0495676_0065421_416_925 | 166 |
| 514 | 3300047321 | Ga0495676_0455294 | Ga0495676_0455294_190_696 | 166 |
| 515 | 3300047444 | Ga0495675_0017354 | Ga0495675_0017354_862_1365 | 166 |
| 516 | 3300047444 | Ga0495675_0044672 | Ga0495675_0044672_650_1153 | 166 |
| 517 | 3300047447 | Ga0495685_080450 | Ga0495685_080450_336_839 | 166 |
| 518 | 3300047471 | Ga0495684_0040950 | Ga0495684_0040950_542_1045 | 166 |
| 519 | 3300048088 | Ga0495602_0082865 | Ga0495602_0082865_896_1399 | 166 |
| 520 | 3300048903 | Ga0496100_0068828 | Ga0496100_0068828_454_1008 | 166 |
| 521 | 3300048904 | Ga0496101_0014011 | Ga0496101_0014011_1860_2414 | 166 |
| 522 | 3300048905 | Ga0496102_0043034 | Ga0496102_0043034_2597_3151 | 166 |
| 523 | 3300048905 | Ga0496102_0140265 | Ga0496102_0140265_236_742 | 166 |
| 524 | 3300048906 | Ga0496103_0004537 | Ga0496103_0004537_3002_3556 | 166 |
| 525 | 3300048907 | Ga0496104_0105303 | Ga0496104_0105303_2175_2681 | 166 |
| 526 | 3300048908 | Ga0496105_0012010 | Ga0496105_0012010_3052_3606 | 166 |
| 527 | 3300048908 | Ga0496105_0381119 | Ga0496105_0381119_374_883 | 166 |
| 528 | 3300048909 | Ga0496106_0248893 | Ga0496106_0248893_16_522 | 166 |
| 529 | 3300048909 | Ga0496106_0290875 | Ga0496106_0290875_214_768 | 166 |
| 530 | 3300048910 | Ga0496107_0092600 | Ga0496107_0092600_857_1411 | 166 |
| 531 | 3300048910 | Ga0496107_1166132 | Ga0496107_1166132_11_514 | 166 |
| 532 | 3300048911 | Ga0496108_0023473 | Ga0496108_0023473_2178_2684 | 166 |
| 533 | 3300048911 | Ga0496108_0263228 | Ga0496108_0263228_930_1484 | 166 |
| 534 | 3300048911 | Ga0496108_1549591 | Ga0496108_1549591_24_527 | 166 |
| 535 | 3300048912 | Ga0496109_0021128 | Ga0496109_0021128_4407_4913 | 166 |
| 536 | 3300048913 | Ga0496110_0059045 | Ga0496110_0059045_2839_3345 | 166 |
| 537 | 3300048913 | Ga0496110_0473448 | Ga0496110_0473448_103_657 | 166 |
| 538 | 3300048914 | Ga0496111_0122063 | Ga0496111_0122063_482_988 | 166 |
| 539 | 3300048914 | Ga0496111_0569856 | Ga0496111_0569856_159_713 | 166 |
| 540 | 3300048915 | Ga0496112_0022266 | Ga0496112_0022266_4779_5285 | 166 |
| 541 | 3300048915 | Ga0496112_0528758 | Ga0496112_0528758_513_1019 | 166 |
| 542 | 3300048916 | Ga0496113_0306186 | Ga0496113_0306186_255_785 | 166 |
| 543 | 3300048917 | Ga0496114_0020831 | Ga0496114_0020831_2878_3432 | 166 |
| 544 | 3300048917 | Ga0496114_0046107 | Ga0496114_0046107_2749_3255 | 166 |
| 545 | 3300048917 | Ga0496114_1021545 | Ga0496114_1021545_95_601 | 166 |
| 546 | 3300048919 | Ga0496116_0000578 | Ga0496116_0000578_23566_24072 | 166 |
| 547 | 3300048920 | Ga0496117_0021178 | Ga0496117_0021178_2900_3406 | 166 |
| 548 | 3300048921 | Ga0496118_0002249 | Ga0496118_0002249_21677_22183 | 166 |
| 549 | 3300048922 | Ga0496119_0000282 | Ga0496119_0000282_67079_67600 | 166 |
| 550 | 3300048922 | Ga0496119_0007110 | Ga0496119_0007110_2021_2527 | 166 |
| 551 | 3300048922 | Ga0496119_0008226 | Ga0496119_0008226_6448_6957 | 166 |
| 552 | 3300048922 | Ga0496119_0052315 | Ga0496119_0052315_323_826 | 166 |
| 553 | 3300048923 | Ga0496120_0000250 | Ga0496120_0000250_53944_54453 | 166 |
| 554 | 3300048923 | Ga0496120_0001391 | Ga0496120_0001391_22288_22809 | 166 |
| 555 | 3300048924 | Ga0496121_0021638 | Ga0496121_0021638_319_825 | 166 |
| 556 | 3300048929 | Ga0496126_0000026 | Ga0496126_0000026_364432_364968 | 166 |
| 557 | 3300049568 | Ga0501031_0067790 | Ga0501031_0067790_935_1447 | 166 |
| 558 | 3300049568 | Ga0501031_0226057 | Ga0501031_0226057_341_853 | 166 |
| 559 | 3300049571 | Ga0501034_0104075 | Ga0501034_0104075_332_844 | 166 |
| 560 | 3300049572 | Ga0501036_0547054 | Ga0501036_0547054_40_552 | 166 |
| 561 | 3300049573 | Ga0501037_0011562 | Ga0501037_0011562_4872_5384 | 166 |
| 562 | 3300049574 | Ga0501038_0002533 | Ga0501038_0002533_15550_16062 | 166 |
| 563 | 3300049576 | Ga0501040_0090451 | Ga0501040_0090451_1025_1531 | 166 |
| 564 | 3300049577 | Ga0501041_0462748 | Ga0501041_0462748_216_722 | 166 |
| 565 | 3300049580 | Ga0501046_0449821 | Ga0501046_0449821_329_841 | 166 |
| 566 | 3300049581 | Ga0501047_0135253 | Ga0501047_0135253_193_705 | 166 |
| 567 | 3300049582 | Ga0501048_0012241 | Ga0501048_0012241_1219_1731 | 166 |
| 568 | 3300049582 | Ga0501048_0053299 | Ga0501048_0053299_1578_2084 | 166 |
| 569 | 3300049586 | Ga0501070_0015355 | Ga0501070_0015355_4551_5063 | 166 |
| 570 | 3300049587 | Ga0501071_0616265 | Ga0501071_0616265_116_622 | 166 |
| 571 | 3300049588 | Ga0501072_0029969 | Ga0501072_0029969_2985_3491 | 166 |
| 572 | 3300049590 | Ga0501074_0304667 | Ga0501074_0304667_59_571 | 166 |
| 573 | 3300049591 | Ga0501075_0278015 | Ga0501075_0278015_85_591 | 166 |
| 574 | 3300049592 | Ga0501076_0602312 | Ga0501076_0602312_100_606 | 166 |
| 575 | 3300049653 | Ga0501206_057952 | Ga0501206_057952_58_564 | 166 |
| 576 | 3300049656 | Ga0501209_090588 | Ga0501209_090588_352_858 | 166 |
| 577 | 3300049660 | Ga0501216_106095 | Ga0501216_106095_69_575 | 166 |
| 578 | 3300049743 | Ga0501081_0254201 | Ga0501081_0254201_192_698 | 166 |
| 579 | 3300049778 | Ga0501282_007663 | Ga0501282_007663_45_566 | 166 |
| 580 | 3300049822 | Ga0501035_0081641 | Ga0501035_0081641_710_1222 | 166 |
| 581 | 3300049822 | Ga0501035_0176571 | Ga0501035_0176571_97_603 | 166 |
| 582 | 3300049823 | Ga0501044_0117519 | Ga0501044_0117519_1453_1965 | 166 |
| 583 | 3300049823 | Ga0501044_0265276 | Ga0501044_0265276_728_1240 | 166 |
| 584 | 3300049823 | Ga0501044_0436615 | Ga0501044_0436615_333_839 | 166 |
| 585 | 3300049824 | Ga0501045_0144777 | Ga0501045_0144777_1127_1633 | 166 |
| 586 | 3300050508 | nmdc:mga09592_77618_c1 | nmdc:mga09592_77618_c1_1327_1833 | 166 |
| 587 | 3300050509 | nmdc:mga0qj67_132318_c1 | nmdc:mga0qj67_132318_c1_873_1391 | 166 |
| 588 | 3300053077 | Ga0495601_0029692 | Ga0495601_0029692_1148_1651 | 166 |
| 589 | 3300053077 | Ga0495601_0050539 | Ga0495601_0050539_1134_1637 | 166 |
| 590 | 3300053078 | Ga0495612_0007799 | Ga0495612_0007799_198_701 | 166 |
| 591 | 3300053083 | Ga0495655_0059930 | Ga0495655_0059930_113_619 | 166 |
| 592 | 3300053085 | Ga0495619_0078602 | Ga0495619_0078602_1596_2099 | 166 |
| 593 | 3300053085 | Ga0495619_0199896 | Ga0495619_0199896_445_948 | 166 |
| 594 | 3300053140 | Ga0500573_0120348 | Ga0500573_0120348_681_1184 | 166 |
| 595 | 3300054114 | Ga0501084_0176176 | Ga0501084_0176176_1025_1531 | 166 |
| 596 | 3300059493 | Ga0587077_158362 | Ga0587077_158362_41_553 | 166 |
| 597 | 3300059508 | Ga0587088_110876 | Ga0587088_110876_52_582 | 166 |
| 598 | 3300059642 | Ga0587069_006763 | Ga0587069_006763_22_531 | 166 |
| 599 | 3300060353 | Ga0501082_0075352 | Ga0501082_0075352_2378_2884 | 166 |
| 600 | 3300060353 | Ga0501082_0447342 | Ga0501082_0447342_405_917 | 166 |
| 601 | 3300060353 | Ga0501082_1271232 | Ga0501082_1271232_77_583 | 166 |
| 602 | 3300061719 | Ga0466962_0013903 | Ga0466962_0013903_2701_3204 | 166 |
| 603 | 3300061719 | Ga0466962_0085017 | Ga0466962_0085017_642_1151 | 166 |
| 604 | 3300061719 | Ga0466962_0112347 | Ga0466962_0112347_594_1103 | 166 |
| 605 | 3300061719 | Ga0466962_0152541 | Ga0466962_0152541_118_630 | 166 |
| 606 | 3300061719 | Ga0466962_0215155 | Ga0466962_0215155_386_892 | 166 |
| 607 | 3300061719 | Ga0466962_0445708 | Ga0466962_0445708_134_640 | 166 |
| 608 | 3300061719 | Ga0466962_0542272 | Ga0466962_0542272_17_520 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4e3e-assembly1.cif.gz_A | crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl | 0.9285 | 5 | 147 |
| 8hgn-assembly1.cif.gz_A | crystal structure of meac (mesaconyl-coa hydratase) | 0.9138 | 5 | 148 |
| 5cpg-assembly1.cif.gz_B | r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form | 0.8945 | 6 | 147 |
| 3exz-assembly1.cif.gz_A | crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. | 0.878 | 4 | 147 |
| 6jql-assembly1.cif.gz_A | structure of paaz, a bifunctional enzyme | 0.8738 | 2 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y9H2_24_180_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9573 | 1 | 147 | 3.10.129.10 |
| 5cpgB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8945 | 6 | 147 | 3.10.129.10 |
| af_I6Y9H2_24_180_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8925 | 1 | 147 | 3.10.129.10 |
| af_P77455_520_674_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8851 | 2 | 145 | 3.10.129.10 |
| 4ffuI00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8752 | 4 | 147 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9F7M3-F1-model_v4 | MaoC family dehydratase | 0.9903 | 1 | 145 |
GO:0016829
|
| AF-A0A7C1UID5-F1-model_v4 | MaoC family dehydratase | 0.9889 | 2 | 138 |
|
| AF-A0A3D3Q9H8-F1-model_v4 | Dehydratase | 0.9888 | 3 | 101 |
|
| AF-A0A2X3KSH4-F1-model_v4 | deleted | 0.9871 | 1 | 147 |
|
| AF-A0A6B3H865-F1-model_v4 | MaoC family dehydratase | 0.9852 | 29 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar