F468815

General Info

Members Datasets Scaffolds Average Seq Length
608 342 588 169

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0036896|Ga0495631_0036896_1062_1652
Length 196
Sequence MGSRPGHAADRPPRRRASGRVVDVGSEQMQFGRYYEEFEVGAVYKHWPGKTVTEYDDHLFCLLTMNHHPLHMDVNYAEKTTDFGKNVVVGNYIYSLLLGMSVPDVSGKAIANLEIESLRHVAPTFHGDTIYGETTVLDKTESKSKDDRGIVHVETLGYKQDGTIVCIFRRKVMVPKRSYGEARGGEQPGRPEPLPR

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2643221578 Streptomyces sp. Root63 Isolate Unclassified
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
5 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
6 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
7 2643221711 Terrabacter sp. Root85 Isolate Unclassified
8 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
9 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
10 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
11 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
12 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
13 2849560528 Caulobacter zeae 410 Isolate Unclassified
14 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
15 2851153111 Caulobacter radicis 736 Isolate Unclassified
16 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
17 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
18 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
19 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
193 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
306 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
307 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
308 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
331 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
334 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
337 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.23
Metatranscriptomes 1.48
Isolates 3.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 4.93
Rhizosphere 88.65
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10022234 3300001990 Bacteria 2016
2 JGI24748J21848_1015178 3300002074 Bacteria 915
3 JGI25406J46586_10005808 3300003203 Bacteria 5710
4 JGI25405J52794_10037970 3300003911 Bacteria 1013
5 Ga0070658_10001192 3300005327 Bacteria 22232
6 Ga0070683_100042106 3300005329 Bacteria 4205
7 Ga0070683_100291298 3300005329 Bacteria 1553
8 Ga0070690_100737001 3300005330 Bacteria 760
9 Ga0070680_100000297 3300005336 Bacteria 33160
10 Ga0070682_100083369 3300005337 Bacteria 2074
11 Ga0070682_100178088 3300005337 Bacteria 1483
12 Ga0070682_100755209 3300005337 Bacteria 786
13 Ga0070682_100852579 3300005337 Bacteria 745
14 Ga0070689_100640827 3300005340 Bacteria 923
15 Ga0070692_10303370 3300005345 Bacteria 976
16 Ga0070692_10308202 3300005345 Bacteria 969
17 Ga0070668_100070930 3300005347 Bacteria 2713
18 Ga0070668_100663690 3300005347 Bacteria 917
19 Ga0070669_100096830 3300005353 Bacteria 2220
20 Ga0070675_100046469 3300005354 Bacteria 3555
21 Ga0070671_100043473 3300005355 Bacteria 3733
22 Ga0070688_100709555 3300005365 Bacteria 780
23 Ga0070667_100013536 3300005367 Bacteria 6741
24 Ga0070714_100000701 3300005435 Bacteria 23697
25 Ga0070714_100005205 3300005435 Bacteria 9899
26 Ga0070714_100011815 3300005435 Bacteria 6940
27 Ga0070714_101167849 3300005435 Bacteria 751
28 Ga0070713_100527263 3300005436 Bacteria 1117
29 Ga0070678_100491291 3300005456 Bacteria 1082
30 Ga0070681_10025473 3300005458 Bacteria 5950
31 Ga0070685_10818795 3300005466 Bacteria 688
32 Ga0070706_100034591 3300005467 Bacteria 4668
33 Ga0070707_100179566 3300005468 Bacteria 2063
34 Ga0070707_100867664 3300005468 Bacteria 867
35 Ga0070699_100059306 3300005518 Bacteria 3315
36 Ga0070679_100006559 3300005530 Bacteria 10844
37 Ga0070684_100364310 3300005535 Bacteria 1330
38 Ga0070686_100243456 3300005544 Bacteria 1311
39 Ga0070696_100326848 3300005546 Bacteria 1182
40 Ga0070693_100082068 3300005547 Bacteria 1924
41 Ga0070693_100717615 3300005547 Bacteria 733
42 Ga0070665_100652231 3300005548 Bacteria 1066
43 Ga0070704_100452377 3300005549 Bacteria 1106
44 Ga0070704_100458825 3300005549 Bacteria 1099
45 Ga0070664_100932362 3300005564 Bacteria 815
46 Ga0068857_100806713 3300005577 Bacteria 896
47 Ga0068856_100007511 3300005614 Bacteria 10643
48 Ga0068852_100054959 3300005616 Bacteria 3434
49 Ga0068859_100000301 3300005617 Bacteria 49173
50 Ga0068859_100003956 3300005617 Bacteria 15123
51 Ga0068859_101174599 3300005617 Bacteria 845
52 Ga0068864_100462482 3300005618 Bacteria 1215
53 Ga0068864_101859878 3300005618 Bacteria 608
54 Ga0068861_100657596 3300005719 Bacteria 969
55 Ga0068863_100000163 3300005841 Bacteria 71286
56 Ga0068863_100139312 3300005841 Bacteria 2318
57 Ga0068858_100000010 3300005842 Bacteria 234748
58 Ga0068858_100759489 3300005842 Bacteria 945
59 Ga0068860_100064334 3300005843 Bacteria 3484
60 Ga0068862_100000049 3300005844 Bacteria 149792
61 Ga0081455_10000544 3300005937 Bacteria 48955
62 Ga0081455_10259492 3300005937 Bacteria 1266
63 Ga0081540_1164447 3300005983 Bacteria 855
64 Ga0081539_10000094 3300005985 Bacteria 206102
65 Ga0070717_10001308 3300006028 Bacteria 17047
66 Ga0070717_10488027 3300006028 Bacteria 1113
67 Ga0075365_10017626 3300006038 Bacteria 4375
68 Ga0070716_100121795 3300006173 Bacteria 1634
69 Ga0097621_100004204 3300006237 Bacteria 9992
70 Ga0068871_100089172 3300006358 Bacteria 2567
71 Ga0075428_100008649 3300006844 Bacteria 11291
72 Ga0075428_100016810 3300006844 Bacteria 8078
73 Ga0075428_100081064 3300006844 Bacteria 3542
74 Ga0075430_100013280 3300006846 Bacteria 7020
75 Ga0075430_100250134 3300006846 Bacteria 1469
76 Ga0075430_100312955 3300006846 Bacteria 1298
77 Ga0075431_100015347 3300006847 Bacteria 7762
78 Ga0075431_100441400 3300006847 Bacteria 1298
79 Ga0075431_100809161 3300006847 Bacteria 910
80 Ga0075434_100004924 3300006871 Bacteria 12103
81 Ga0075429_100003160 3300006880 Bacteria 13999
82 Ga0075429_100031061 3300006880 Bacteria 4643
83 Ga0075429_100347510 3300006880 Bacteria 1298
84 Ga0075436_100000375 3300006914 Bacteria 28483
85 Ga0097620_100000301 3300006931 Bacteria 49173
86 Ga0097620_100003956 3300006931 Bacteria 15123
87 Ga0097620_101174406 3300006931 Bacteria 845
88 Ga0075435_100308138 3300007076 Bacteria 1355
89 Ga0075435_100663325 3300007076 Bacteria 906
90 Ga0099794_10019000 3300007265 Bacteria 3090
91 Ga0105251_10036456 3300009011 Bacteria 2420
92 Ga0105250_10155234 3300009092 Bacteria 953
93 Ga0105250_10241967 3300009092 Bacteria 769
94 Ga0105240_10037718 3300009093 Bacteria 6209
95 Ga0111539_10016743 3300009094 Bacteria 9085
96 Ga0111539_11176431 3300009094 Bacteria 891
97 Ga0105245_10109792 3300009098 Bacteria 2564
98 Ga0105245_11168492 3300009098 Bacteria 817
99 Ga0105247_10000834 3300009101 Bacteria 23420
100 Ga0114129_10003939 3300009147 Bacteria 20975
101 Ga0114129_10029362 3300009147 Bacteria 7789
102 Ga0114129_10072691 3300009147 Bacteria 4794
103 Ga0114129_10236611 3300009147 Bacteria 2457
104 Ga0114129_11189012 3300009147 Bacteria 950
105 Ga0105243_10383916 3300009148 Bacteria 1300
106 Ga0105241_10607688 3300009174 Bacteria 989
107 Ga0105242_10607969 3300009176 Bacteria 1057
108 Ga0105248_10000147 3300009177 Bacteria 81699
109 Ga0105248_10000377 3300009177 Bacteria 52002
110 Ga0105248_10016629 3300009177 Bacteria 8099
111 Ga0105248_11022731 3300009177 Bacteria 933
112 Ga0105248_11989166 3300009177 Bacteria 660
113 Ga0105237_10013119 3300009545 Bacteria 8699
114 Ga0105237_10040024 3300009545 Bacteria 4729
115 Ga0105237_10808569 3300009545 Bacteria 944
116 Ga0105249_10165031 3300009553 Bacteria 2143
117 Ga0105249_10277011 3300009553 Bacteria 1673
118 Ga0105033_103522 3300009986 Bacteria 1320
119 Ga0105239_10018684 3300010375 Bacteria 7657
120 Ga0105239_10702747 3300010375 Bacteria 1156
121 Ga0157335_1004676 3300012492 Bacteria 931
122 Ga0157370_10078473 3300013104 Bacteria 3109
123 Ga0157369_10023576 3300013105 Bacteria 6854
124 Ga0157369_10651635 3300013105 Unclassified 1086
125 Ga0157369_10718874 3300013105 Bacteria 1028
126 Ga0157374_10187916 3300013296 Bacteria 2020
127 Ga0157375_10018285 3300013308 Bacteria 6353
128 Ga0157375_10184847 3300013308 Bacteria 2237
129 Ga0157375_10525782 3300013308 Bacteria 1346
130 Ga0163163_10002172 3300014325 Bacteria 16561
131 Ga0163163_10010694 3300014325 Bacteria 8271
132 Ga0163163_10102206 3300014325 Bacteria 2889
133 Ga0163163_10363312 3300014325 Bacteria 1504
134 Ga0163163_10450650 3300014325 Bacteria 1347
135 Ga0163163_10710561 3300014325 Bacteria 1069
136 Ga0157380_10149971 3300014326 Bacteria 2014
137 Ga0157380_11296638 3300014326 Bacteria 775
138 Ga0157380_11872423 3300014326 Bacteria 660
139 Ga0157377_11058663 3300014745 Bacteria 618
140 Ga0157379_10000149 3300014968 Bacteria 51280
141 Ga0197907_10830029 3300020069 Bacteria 1363
142 Ga0206351_10215200 3300020077 Bacteria 1220
143 Ga0206350_10124477 3300020080 Bacteria 821
144 Ga0154015_1709930 3300020610 Bacteria 831
145 Ga0213876_10266763 3300021384 Bacteria 910
146 Ga0224712_10210574 3300022467 Bacteria 886
147 Ga0209130_1048847 3300025284 Bacteria 779
148 Ga0209256_1003564 3300025299 Bacteria 10761
149 Ga0207696_1117897 3300025711 Bacteria 717
150 Ga0207692_10018350 3300025898 Bacteria 3140
151 Ga0207710_10000107 3300025900 Bacteria 105449
152 Ga0207710_10000144 3300025900 Bacteria 82093
153 Ga0207647_10055951 3300025904 Bacteria 2422
154 Ga0207647_10271449 3300025904 Bacteria 970
155 Ga0207699_10000045 3300025906 Bacteria 112158
156 Ga0207705_10015019 3300025909 Bacteria 5567
157 Ga0207684_10015851 3300025910 Bacteria 6479
158 Ga0207684_11274077 3300025910 Bacteria 606
159 Ga0207654_10107189 3300025911 Bacteria 1732
160 Ga0207707_10001022 3300025912 Bacteria 26886
161 Ga0207695_10035602 3300025913 Bacteria 5395
162 Ga0207671_10119158 3300025914 Bacteria 2016
163 Ga0207671_10614849 3300025914 Bacteria 866
164 Ga0207671_10682671 3300025914 Bacteria 817
165 Ga0207693_10693463 3300025915 Bacteria 789
166 Ga0207693_11209026 3300025915 Bacteria 569
167 Ga0207663_11439085 3300025916 Bacteria 555
168 Ga0207660_10000404 3300025917 Bacteria 28485
169 Ga0207657_10368149 3300025919 Bacteria 1132
170 Ga0207652_10000717 3300025921 Bacteria 32120
171 Ga0207646_10038249 3300025922 Bacteria 4323
172 Ga0207694_10381039 3300025924 Bacteria 1171
173 Ga0207659_10143277 3300025926 Bacteria 1857
174 Ga0207687_10528271 3300025927 Bacteria 988
175 Ga0207700_10048409 3300025928 Bacteria 3156
176 Ga0207700_10128005 3300025928 Bacteria 2069
177 Ga0207664_10000641 3300025929 Bacteria 24306
178 Ga0207664_10046528 3300025929 Bacteria 3406
179 Ga0207664_10407463 3300025929 Bacteria 1210
180 Ga0207664_10924062 3300025929 Bacteria 783
181 Ga0207709_10616358 3300025935 Bacteria 861
182 Ga0207670_10126139 3300025936 Bacteria 1868
183 Ga0207665_10114972 3300025939 Bacteria 1895
184 Ga0207711_10000056 3300025941 Bacteria 135485
185 Ga0207711_10010080 3300025941 Bacteria 7856
186 Ga0207711_11169981 3300025941 Bacteria 710
187 Ga0207661_10061928 3300025944 Bacteria 3025
188 Ga0207661_10137783 3300025944 Bacteria 2098
189 Ga0207667_10003347 3300025949 Bacteria 19783
190 Ga0207712_10119767 3300025961 Bacteria 1989
191 Ga0207658_10138354 3300025986 Bacteria 1967
192 Ga0207677_10186648 3300026023 Bacteria 1636
193 Ga0207703_10000002 3300026035 Bacteria 600711
194 Ga0207703_10114654 3300026035 Bacteria 2305
195 Ga0207702_10009578 3300026078 Bacteria 8133
196 Ga0207702_10022306 3300026078 Bacteria 5248
197 Ga0207641_10000877 3300026088 Bacteria 31494
198 Ga0207641_10012501 3300026088 Bacteria 6958
199 Ga0207641_10256522 3300026088 Bacteria 1635
200 Ga0207648_10162618 3300026089 Bacteria 1972
201 Ga0207676_10327322 3300026095 Bacteria 1409
202 Ga0207676_10448950 3300026095 Bacteria 1215
203 Ga0207674_10298033 3300026116 Bacteria 1561
204 Ga0207675_100690069 3300026118 Bacteria 1029
205 Ga0207683_10489755 3300026121 Bacteria 1135
206 Ga0207683_10639308 3300026121 Bacteria 985
207 Ga0207683_11331636 3300026121 Bacteria 664
208 Ga0207428_10388837 3300027907 Bacteria 1022
209 Ga0268266_10035268 3300028379 Bacteria 4255
210 Ga0268265_10000017 3300028380 Bacteria 293875
211 Ga0268264_10003187 3300028381 Bacteria 14212
212 Ga0265770_1032434 3300030878 Bacteria 881
213 Ga0307513_10047714 3300031456 Bacteria 4656
214 Ga0307513_10287866 3300031456 Bacteria 1416
215 Ga0307408_100079053 3300031548 Bacteria 2453
216 Ga0307408_100482781 3300031548 Bacteria 1081
217 Ga0307405_10032700 3300031731 Bacteria 3077
218 Ga0307413_10458006 3300031824 Bacteria 1014
219 Ga0307410_10001047 3300031852 Bacteria 12017
220 Ga0307410_10038534 3300031852 Bacteria 3132
221 Ga0307410_10321663 3300031852 Bacteria 1227
222 Ga0307410_10634507 3300031852 Bacteria 894
223 Ga0307406_10096690 3300031901 Bacteria 2001
224 Ga0307406_10136734 3300031901 Bacteria 1728
225 Ga0307406_10689026 3300031901 Bacteria 852
226 Ga0307407_10257666 3300031903 Bacteria 1198
227 Ga0307407_10434125 3300031903 Bacteria 949
228 Ga0307412_10251110 3300031911 Bacteria 1373
229 Ga0307409_100093287 3300031995 Bacteria 2473
230 Ga0307409_100094104 3300031995 Bacteria 2464
231 Ga0307409_100110011 3300031995 Bacteria 2308
232 Ga0307409_100346646 3300031995 Bacteria 1400
233 Ga0307409_100468656 3300031995 Bacteria 1219
234 Ga0307409_100845266 3300031995 Bacteria 926
235 Ga0307409_101130111 3300031995 Bacteria 805
236 Ga0307416_100053043 3300032002 Bacteria 3251
237 Ga0307416_100330506 3300032002 Bacteria 1531
238 Ga0307416_100597985 3300032002 Bacteria 1182
239 Ga0307416_100626013 3300032002 Bacteria 1158
240 Ga0307416_100941587 3300032002 Bacteria 965
241 Ga0307414_10175222 3300032004 Bacteria 1719
242 Ga0307414_10305719 3300032004 Bacteria 1347
243 Ga0307411_10673289 3300032005 Bacteria 898
244 Ga0307415_100031514 3300032126 Bacteria 3416
245 Ga0307415_100102430 3300032126 Bacteria 2103
246 Ga0307415_100198226 3300032126 Bacteria 1590
247 Ga0307415_100224594 3300032126 Bacteria 1508
248 Ga0307415_100315906 3300032126 Bacteria 1300
249 Ga0307415_100934863 3300032126 Bacteria 801
250 Ga0307415_101621540 3300032126 Bacteria 622
251 Ga0307507_10000113 3300033179 Bacteria 133812
252 Ga0307507_10004395 3300033179 Bacteria 25121
253 Ga0373948_0128498 3300034817 Bacteria 618
254 Ga0373938_0020992 3300034957 Bacteria 1320
255 Ga0373934_0071709 3300035086 Bacteria 1386
256 Ga0373953_0029960 3300035117 Bacteria 2107
257 Ga0373953_0442143 3300035117 Bacteria 574
258 Ga0373956_0012279 3300035119 Bacteria 3548
259 Ga0373956_0030746 3300035119 Bacteria 2349
260 Ga0373957_0023039 3300035120 Bacteria 2223
261 Ga0373960_0042624 3300035121 Bacteria 1318
262 Ga0373955_0011088 3300035172 Bacteria 4281
263 Ga0373955_0512645 3300035172 Bacteria 733
264 Ga0373942_0018270 3300035207 Bacteria 1739
265 Ga0373961_0008367 3300035241 Bacteria 2516
266 Ga0373931_0106676 3300035691 Bacteria 1583
267 Ga0373935_0534944 3300035692 Bacteria 853
268 Ga0373927_0125662 3300035695 Bacteria 1674
269 Ga0373933_0005121 3300035724 Bacteria 7152
270 Ga0373933_0406989 3300035724 Bacteria 888
271 Ga0373947_0339740 3300035725 Bacteria 1006
272 Ga0373937_0026090 3300036401 Bacteria 5279
273 Ga0373937_0054128 3300036401 Bacteria 3682
274 Ga0395899_0017796 3300037312 Bacteria 5410
275 Ga0395900_0015034 3300037418 Bacteria 7889
276 Ga0395900_0108490 3300037418 Bacteria 2852
277 Ga0395900_0138769 3300037418 Bacteria 2490
278 Ga0395900_0183497 3300037418 Bacteria 2125
279 Ga0395898_1051954 3300037466 Bacteria 748
280 Ga0395905_0300418 3300037471 Bacteria 1493
281 Ga0395905_0448999 3300037471 Bacteria 1187
282 Ga0395905_0515252 3300037471 Bacteria 1096
283 Ga0395901_0250160 3300038443 Bacteria 1847
284 Ga0395901_0340924 3300038443 Bacteria 1548
285 Ga0436365_1785580 3300039437 Bacteria 793
286 Ga0439461_0089488 3300041410 Bacteria 737
287 Ga0451789_1052800 3300041443 Bacteria 763
288 Ga0451793_0219251 3300041452 Bacteria 647
289 Ga0451793_1844926 3300041452 Bacteria 589
290 Ga0451807_1159192 3300041486 Bacteria 2266
291 Ga0451851_0894497 3300041507 Bacteria 702
292 Ga0439442_030398 3300042002 Bacteria 1128
293 Ga0439435_0060373 3300042436 Bacteria 1104
294 Ga0451577_0099523 3300042876 Bacteria 2597
295 Ga0451577_0429767 3300042876 Bacteria 1199
296 Ga0466969_0012981 3300044656 Bacteria 4387
297 Ga0466969_0090528 3300044656 Bacteria 1450
298 Ga0466969_0094403 3300044656 Bacteria 1414
299 Ga0466969_0096229 3300044656 Bacteria 1398
300 Ga0466972_0013425 3300044658 Bacteria 4113
301 Ga0466972_0031423 3300044658 Bacteria 2611
302 Ga0466972_0083717 3300044658 Bacteria 1517
303 Ga0466972_0210194 3300044658 Bacteria 911
304 Ga0466972_0426056 3300044658 Bacteria 623
305 Ga0453683_0011272 3300044673 Bacteria 5901
306 Ga0466965_0023943 3300044683 Bacteria 2951
307 Ga0466965_0433285 3300044683 Bacteria 730
308 Ga0466966_0039381 3300044684 Bacteria 3044
309 Ga0466966_0059821 3300044684 Bacteria 2405
310 Ga0466966_0121075 3300044684 Bacteria 1607
311 Ga0466966_0403536 3300044684 Bacteria 821
312 Ga0466966_0449776 3300044684 Bacteria 774
313 Ga0466961_0003497 3300044693 Bacteria 9791
314 Ga0466961_0049856 3300044693 Bacteria 2675
315 Ga0466961_0066958 3300044693 Bacteria 2281
316 Ga0466961_0072924 3300044693 Bacteria 2177
317 Ga0466961_0088673 3300044693 Bacteria 1954
318 Ga0466961_0108177 3300044693 Bacteria 1750
319 Ga0466961_0134902 3300044693 Bacteria 1546
320 Ga0466961_0189160 3300044693 Bacteria 1276
321 Ga0466961_0192442 3300044693 Bacteria 1264
322 Ga0466961_0295475 3300044693 Bacteria 990
323 Ga0466963_0002849 3300044694 Bacteria 9755
324 Ga0466963_0014159 3300044694 Bacteria 4914
325 Ga0466963_0029589 3300044694 Bacteria 3527
326 Ga0466963_0052305 3300044694 Bacteria 2710
327 Ga0466963_0086900 3300044694 Bacteria 2125
328 Ga0466963_0208994 3300044694 Bacteria 1366
329 Ga0466964_0007178 3300044706 Bacteria 4167
330 Ga0466964_0089676 3300044706 Bacteria 1336
331 Ga0466964_0426520 3300044706 Bacteria 698
332 Ga0453684_0012539 3300044712 Bacteria 13955
333 Ga0466971_0003719 3300044719 Bacteria 6528
334 Ga0466971_0007792 3300044719 Bacteria 4668
335 Ga0466971_0026619 3300044719 Bacteria 2586
336 Ga0466971_0044346 3300044719 Bacteria 1997
337 Ga0466971_0195562 3300044719 Bacteria 954
338 Ga0466971_0393811 3300044719 Bacteria 674
339 Ga0466970_0010596 3300044765 Bacteria 4682
340 Ga0466970_0020655 3300044765 Bacteria 3424
341 Ga0466970_0036349 3300044765 Bacteria 2609
342 Ga0466970_0048225 3300044765 Bacteria 2271
343 Ga0466970_0091491 3300044765 Bacteria 1651
344 Ga0466970_0552196 3300044765 Bacteria 666
345 Ga0466970_0576252 3300044765 Bacteria 652
346 Ga0466957_0014176 3300044842 Bacteria 4638
347 Ga0466957_0021338 3300044842 Bacteria 3816
348 Ga0466957_0053914 3300044842 Bacteria 2453
349 Ga0466957_0082117 3300044842 Bacteria 2008
350 Ga0466957_0130898 3300044842 Bacteria 1607
351 Ga0466957_0177635 3300044842 Bacteria 1389
352 Ga0466957_0299987 3300044842 Bacteria 1079
353 Ga0466957_0700959 3300044842 Bacteria 714
354 Ga0466960_0007075 3300044901 Bacteria 4537
355 Ga0466960_0072265 3300044901 Bacteria 1719
356 Ga0466960_0100153 3300044901 Bacteria 1491
357 Ga0466960_0124142 3300044901 Bacteria 1355
358 Ga0466960_0232322 3300044901 Bacteria 1018
359 Ga0466959_0044294 3300045049 Bacteria 3279
360 Ga0466959_0054045 3300045049 Bacteria 2935
361 Ga0466959_0058916 3300045049 Bacteria 2797
362 Ga0466959_0062173 3300045049 Bacteria 2714
363 Ga0466959_0136848 3300045049 Bacteria 1733
364 Ga0466959_0150860 3300045049 Bacteria 1638
365 Ga0466959_0310694 3300045049 Bacteria 1079
366 Ga0451576_0029721 3300045051 Bacteria 5846
367 Ga0451576_0048352 3300045051 Bacteria 4468
368 Ga0466958_0006888 3300045836 Bacteria 6215
369 Ga0466958_0008606 3300045836 Bacteria 5664
370 Ga0466958_0015729 3300045836 Bacteria 4343
371 Ga0466958_0041210 3300045836 Bacteria 2777
372 Ga0466958_0044573 3300045836 Bacteria 2673
373 Ga0466958_0067772 3300045836 Bacteria 2180
374 Ga0466958_0516432 3300045836 Bacteria 775
375 Ga0466958_0552229 3300045836 Bacteria 748
376 Ga0466967_0006716 3300045976 Bacteria 8185
377 Ga0466967_0032803 3300045976 Bacteria 4390
378 Ga0466967_0050747 3300045976 Bacteria 3633
379 Ga0466967_0056572 3300045976 Bacteria 3459
380 Ga0466967_0172559 3300045976 Bacteria 2035
381 Ga0466967_0227288 3300045976 Bacteria 1776
382 Ga0466967_0267314 3300045976 Bacteria 1638
383 Ga0466967_0328650 3300045976 Bacteria 1476
384 Ga0466967_0915111 3300045976 Bacteria 872
385 Ga0495592_0010881 3300046454 Bacteria 6864
386 Ga0495603_0148774 3300046455 Bacteria 1361
387 Ga0495651_0022043 3300046462 Bacteria 4953
388 Ga0495651_0087932 3300046462 Bacteria 2336
389 Ga0495653_0012957 3300046463 Bacteria 6802
390 Ga0495582_0418121 3300046473 Bacteria 773
391 Ga0495662_0000796 3300046476 Bacteria 15310
392 Ga0495662_0010433 3300046476 Bacteria 4549
393 Ga0495664_0002832 3300046477 Bacteria 9330
394 Ga0495608_0013736 3300046511 Bacteria 5617
395 Ga0495608_0574961 3300046511 Bacteria 678
396 Ga0495628_0306346 3300046516 Bacteria 1175
397 Ga0495630_0015069 3300046517 Bacteria 5640
398 Ga0495630_0146698 3300046517 Bacteria 1794
399 Ga0495631_0036896 3300046518 Bacteria 2180
400 Ga0495631_0126907 3300046518 Bacteria 1096
401 Ga0495663_0044446 3300046525 Bacteria 1360
402 Ga0495666_0002368 3300046526 Bacteria 9399
403 Ga0495652_0050310 3300046529 Bacteria 3563
404 Ga0495652_0163446 3300046529 Bacteria 1725
405 Ga0495665_0034897 3300046531 Bacteria 2689
406 Ga0495640_0008853 3300046533 Bacteria 7868
407 Ga0495640_0037412 3300046533 Bacteria 3422
408 Ga0495586_0059979 3300046535 Bacteria 2068
409 Ga0495598_0133655 3300046537 Bacteria 853
410 Ga0495598_0133912 3300046537 Bacteria 852
411 Ga0495645_0015444 3300046543 Bacteria 5429
412 Ga0495667_0011382 3300046559 Bacteria 6023
413 Ga0495667_0091129 3300046559 Bacteria 1974
414 Ga0495667_0147219 3300046559 Bacteria 1517
415 Ga0495656_0130395 3300046615 Bacteria 1196
416 Ga0495634_0201985 3300046642 Bacteria 1234
417 Ga0495634_0517677 3300046642 Bacteria 698
418 Ga0495588_0324046 3300046674 Bacteria 810
419 Ga0495657_0009221 3300046675 Bacteria 7488
420 Ga0495657_0537631 3300046675 Bacteria 679
421 Ga0495599_0127281 3300046678 Bacteria 1583
422 Ga0495599_0166206 3300046678 Bacteria 1362
423 Ga0495623_0099069 3300046679 Bacteria 1778
424 Ga0495623_0140179 3300046679 Bacteria 1439
425 Ga0495623_0226480 3300046679 Bacteria 1062
426 Ga0495646_0116180 3300046680 Bacteria 1518
427 Ga0495647_0101047 3300046681 Bacteria 1194
428 Ga0495658_0434872 3300046683 Bacteria 838
429 Ga0495613_0012604 3300046689 Bacteria 6286
430 Ga0495624_0039898 3300046690 Bacteria 3009
431 Ga0495600_0135863 3300046809 Bacteria 1597
432 Ga0495600_0419864 3300046809 Bacteria 830
433 Ga0495581_0074152 3300047315 Bacteria 1969
434 Ga0495581_0158300 3300047315 Bacteria 1324
435 Ga0495604_0000925 3300047317 Bacteria 24435
436 Ga0495604_0001249 3300047317 Bacteria 20835
437 Ga0495604_0350888 3300047317 Bacteria 980
438 Ga0495636_0008964 3300047318 Bacteria 3939
439 Ga0495636_0362954 3300047318 Bacteria 685
440 Ga0495674_0048596 3300047319 Bacteria 3753
441 Ga0495672_0371186 3300047320 Bacteria 660
442 Ga0495676_0065421 3300047321 Bacteria 2822
443 Ga0495676_0455294 3300047321 Bacteria 844
444 Ga0495680_0320143 3300047322 Bacteria 1085
445 Ga0495680_0332072 3300047322 Bacteria 1062
446 Ga0495675_0017354 3300047444 Bacteria 4561
447 Ga0495675_0044672 3300047444 Bacteria 2822
448 Ga0495679_005264 3300047446 Bacteria 5770
449 Ga0495685_080450 3300047447 Bacteria 1085
450 Ga0495684_0040950 3300047471 Bacteria 3550
451 Ga0495602_0082865 3300048088 Bacteria 2689
452 Ga0496100_0068828 3300048903 Bacteria 2355
453 Ga0496101_0014011 3300048904 Bacteria 5385
454 Ga0496102_0043034 3300048905 Bacteria 4093
455 Ga0496102_0140265 3300048905 Bacteria 2266
456 Ga0496103_0004537 3300048906 Bacteria 8407
457 Ga0496104_0105303 3300048907 Bacteria 2703
458 Ga0496105_0012010 3300048908 Bacteria 6858
459 Ga0496105_0381119 3300048908 Bacteria 1122
460 Ga0496106_0248893 3300048909 Bacteria 1421
461 Ga0496106_0290875 3300048909 Bacteria 1310
462 Ga0496107_0092600 3300048910 Bacteria 2210
463 Ga0496107_1166132 3300048910 Bacteria 555
464 Ga0496108_0023473 3300048911 Bacteria 5076
465 Ga0496108_0263228 3300048911 Bacteria 1501
466 Ga0496108_1549591 3300048911 Bacteria 550
467 Ga0496109_0021128 3300048912 Bacteria 5754
468 Ga0496110_0059045 3300048913 Bacteria 3379
469 Ga0496110_0473448 3300048913 Bacteria 1141
470 Ga0496111_0122063 3300048914 Bacteria 1924
471 Ga0496111_0569856 3300048914 Bacteria 830
472 Ga0496112_0022266 3300048915 Bacteria 6037
473 Ga0496112_0528758 3300048915 Bacteria 1114
474 Ga0496113_0306186 3300048916 Bacteria 1273
475 Ga0496114_0020831 3300048917 Bacteria 5324
476 Ga0496114_0046107 3300048917 Bacteria 3621
477 Ga0496114_1021545 3300048917 Bacteria 710
478 Ga0496116_0000578 3300048919 Bacteria 48938
479 Ga0496117_0021178 3300048920 Bacteria 5271
480 Ga0496118_0002249 3300048921 Bacteria 26504
481 Ga0496119_0000282 3300048922 Bacteria 71403
482 Ga0496119_0007110 3300048922 Bacteria 10173
483 Ga0496119_0008226 3300048922 Bacteria 9220
484 Ga0496119_0052315 3300048922 Bacteria 2502
485 Ga0496120_0000250 3300048923 Bacteria 90632
486 Ga0496120_0001391 3300048923 Bacteria 29334
487 Ga0496121_0021638 3300048924 Bacteria 6289
488 Ga0496126_0000026 3300048929 Bacteria 422310
489 Ga0501031_0067790 3300049568 Bacteria 2324
490 Ga0501031_0226057 3300049568 Bacteria 1218
491 Ga0501032_0113155 3300049569 Bacteria 1795
492 Ga0501033_0217114 3300049570 Bacteria 1362
493 Ga0501034_0104075 3300049571 Bacteria 2832
494 Ga0501036_0379322 3300049572 Bacteria 1180
495 Ga0501036_0547054 3300049572 Bacteria 962
496 Ga0501037_0011562 3300049573 Bacteria 6497
497 Ga0501037_0239415 3300049573 Bacteria 1272
498 Ga0501038_0002533 3300049574 Bacteria 17039
499 Ga0501038_0065713 3300049574 Bacteria 3090
500 Ga0501039_0367635 3300049575 Bacteria 1130
501 Ga0501040_0090451 3300049576 Bacteria 2127
502 Ga0501041_0462748 3300049577 Bacteria 805
503 Ga0501046_0449821 3300049580 Bacteria 926
504 Ga0501047_0135253 3300049581 Bacteria 2345
505 Ga0501048_0012241 3300049582 Bacteria 6385
506 Ga0501048_0053299 3300049582 Bacteria 2877
507 Ga0501067_0009778 3300049583 Bacteria 5307
508 Ga0501068_0561312 3300049584 Bacteria 743
509 Ga0501070_0015355 3300049586 Bacteria 6444
510 Ga0501070_0031163 3300049586 Bacteria 4467
511 Ga0501070_0106834 3300049586 Bacteria 2313
512 Ga0501071_0616265 3300049587 Bacteria 834
513 Ga0501072_0029969 3300049588 Bacteria 4252
514 Ga0501072_0073568 3300049588 Bacteria 2701
515 Ga0501072_0210136 3300049588 Bacteria 1551
516 Ga0501073_0212684 3300049589 Bacteria 1336
517 Ga0501074_0039623 3300049590 Bacteria 3412
518 Ga0501074_0304667 3300049590 Bacteria 1132
519 Ga0501074_0536248 3300049590 Bacteria 829
520 Ga0501075_0278015 3300049591 Bacteria 1276
521 Ga0501076_0602312 3300049592 Bacteria 906
522 Ga0501206_057952 3300049653 Bacteria 630
523 Ga0501209_090588 3300049656 Bacteria 889
524 Ga0501216_106095 3300049660 Bacteria 625
525 Ga0501256_030455 3300049685 Bacteria 606
526 Ga0501080_0589651 3300049742 Bacteria 987
527 Ga0501081_0124429 3300049743 Bacteria 1839
528 Ga0501081_0254201 3300049743 Bacteria 1283
529 Ga0501083_0028191 3300049744 Bacteria 3872
530 Ga0501083_0533813 3300049744 Bacteria 763
531 Ga0501282_007663 3300049778 Bacteria 1154
532 Ga0501035_0081641 3300049822 Bacteria 2853
533 Ga0501035_0176571 3300049822 Bacteria 1842
534 Ga0501044_0117519 3300049823 Bacteria 2663
535 Ga0501044_0265276 3300049823 Bacteria 1655
536 Ga0501044_0436615 3300049823 Bacteria 1218
537 Ga0501045_0144777 3300049824 Bacteria 1767
538 nmdc:mga0yw44_9360_c1 3300050492 Bacteria 4947
539 nmdc:mga05p37_123297_c1 3300050507 Bacteria 3183
540 nmdc:mga05p37_25797_c1 3300050507 Bacteria 7147
541 nmdc:mga09592_33389_c1 3300050508 Bacteria 4295
542 nmdc:mga09592_693_c1 3300050508 Bacteria 22366
543 nmdc:mga09592_77618_c1 3300050508 Bacteria 2825
544 nmdc:mga0qj67_106_c1 3300050509 Bacteria 21190
545 nmdc:mga0qj67_132318_c1 3300050509 Bacteria 2020
546 nmdc:mga0qj67_33844_c1 3300050509 Bacteria 3989
547 nmdc:mga06r32_17855_c1 3300050510 Bacteria 6484
548 nmdc:mga06r32_3172_c2 3300050510 Bacteria 11440
549 nmdc:mga06r32_378114_c1 3300050510 Bacteria 1399
550 nmdc:mga06r32_832008_c1 3300050510 Bacteria 882
551 nmdc:mga08y16_194844_c1 3300050511 Bacteria 2101
552 nmdc:mga0n895_263799_c1 3300050512 Bacteria 1748
553 nmdc:mga0rr50_384192_c1 3300050513 Bacteria 1184
554 nmdc:mga0rr50_392832_c1 3300050513 Bacteria 1171
555 nmdc:mga08x19_820_c1 3300050514 Bacteria 19741
556 nmdc:mga0a205_477547_c1 3300050515 Bacteria 1105
557 Ga0495601_0029692 3300053077 Bacteria 3393
558 Ga0495601_0050539 3300053077 Bacteria 2622
559 Ga0495612_0007799 3300053078 Bacteria 4368
560 Ga0495655_0059930 3300053083 Bacteria 1035
561 Ga0495619_0078602 3300053085 Bacteria 2218
562 Ga0495619_0194072 3300053085 Bacteria 1406
563 Ga0495619_0199896 3300053085 Bacteria 1383
564 Ga0495619_0611241 3300053085 Bacteria 745
565 Ga0500644_0028617 3300053088 Bacteria 1745
566 Ga0500646_0013310 3300053090 Bacteria 2129
567 Ga0500618_000110 3300053125 Bacteria 66025
568 Ga0500559_0000055 3300053136 Bacteria 89392
569 Ga0500573_0120348 3300053140 Bacteria 1462
570 Ga0501084_0064988 3300054114 Bacteria 3052
571 Ga0501084_0176176 3300054114 Bacteria 1805
572 Ga0590071_134490 3300059421 Bacteria 636
573 Ga0587077_158362 3300059493 Bacteria 597
574 Ga0587088_110876 3300059508 Bacteria 624
575 Ga0587069_006763 3300059642 Bacteria 1392
576 Ga0501082_0014421 3300060353 Bacteria 6801
577 Ga0501082_0040538 3300060353 Bacteria 4016
578 Ga0501082_0075352 3300060353 Bacteria 2907
579 Ga0501082_0194759 3300060353 Bacteria 1763
580 Ga0501082_0447342 3300060353 Bacteria 1129
581 Ga0501082_1271232 3300060353 Bacteria 643
582 Ga0466962_0013903 3300061719 Bacteria 3876
583 Ga0466962_0085017 3300061719 Bacteria 1514
584 Ga0466962_0112347 3300061719 Bacteria 1312
585 Ga0466962_0152541 3300061719 Bacteria 1121
586 Ga0466962_0215155 3300061719 Bacteria 940
587 Ga0466962_0445708 3300061719 Bacteria 651
588 Ga0466962_0542272 3300061719 Bacteria 590

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0537631 Ga0495657_0537631_23_526 149
2 3300053085 Ga0495619_0611241 Ga0495619_0611241_232_735 149
3 3300046455 Ga0495603_0148774 Ga0495603_0148774_263_769 150
4 3300049743 Ga0501081_0124429 Ga0501081_0124429_1239_1775 151
5 3300060353 Ga0501082_0194759 Ga0501082_0194759_1244_1729 151
6 3300005347 Ga0070668_100663690 Ga0070668_1006636901 152
7 3300006844 Ga0075428_100008649 Ga0075428_10000864915 153
8 3300053090 Ga0500646_0013310 Ga0500646_0013310_506_1012 153
9 3300042436 Ga0439435_0060373 Ga0439435_0060373_347_838 155
10 3300009147 Ga0114129_11189012 Ga0114129_111890121 156
11 3300009177 Ga0105248_10016629 Ga0105248_100166297 156
12 3300005329 Ga0070683_100042106 Ga0070683_1000421063 157
13 3300005340 Ga0070689_100640827 Ga0070689_1006408272 157
14 3300005345 Ga0070692_10308202 Ga0070692_103082022 157
15 3300005353 Ga0070669_100096830 Ga0070669_1000968302 157
16 3300005354 Ga0070675_100046469 Ga0070675_1000464693 157
17 3300005456 Ga0070678_100491291 Ga0070678_1004912912 157
18 3300005518 Ga0070699_100059306 Ga0070699_1000593063 157
19 3300005544 Ga0070686_100243456 Ga0070686_1002434562 157
20 3300005546 Ga0070696_100326848 Ga0070696_1003268482 157
21 3300005547 Ga0070693_100082068 Ga0070693_1000820682 157
22 3300005549 Ga0070704_100452377 Ga0070704_1004523772 157
23 3300005549 Ga0070704_100458825 Ga0070704_1004588252 157
24 3300005719 Ga0068861_100657596 Ga0068861_1006575962 157
25 3300005842 Ga0068858_100759489 Ga0068858_1007594892 157
26 3300006038 Ga0075365_10017626 Ga0075365_100176263 157
27 3300006237 Ga0097621_100004204 Ga0097621_1000042042 157
28 3300006358 Ga0068871_100089172 Ga0068871_1000891723 157
29 3300006871 Ga0075434_100004924 Ga0075434_1000049244 157
30 3300006914 Ga0075436_100000375 Ga0075436_10000037515 157
31 3300007076 Ga0075435_100308138 Ga0075435_1003081382 157
32 3300007265 Ga0099794_10019000 Ga0099794_100190002 157
33 3300009094 Ga0111539_10016743 Ga0111539_100167436 157
34 3300009176 Ga0105242_10607969 Ga0105242_106079692 157
35 3300009177 Ga0105248_11989166 Ga0105248_119891661 157
36 3300013105 Ga0157369_10651635 Ga0157369_106516351 157
37 3300014326 Ga0157380_10149971 Ga0157380_101499712 157
38 3300014326 Ga0157380_11296638 Ga0157380_112966382 157
39 3300014326 Ga0157380_11872423 Ga0157380_118724232 157
40 3300014745 Ga0157377_11058663 Ga0157377_110586631 157
41 3300025284 Ga0209130_1048847 Ga0209130_10488472 157
42 3300025898 Ga0207692_10018350 Ga0207692_100183502 157
43 3300025926 Ga0207659_10143277 Ga0207659_101432772 157
44 3300025936 Ga0207670_10126139 Ga0207670_101261392 157
45 3300025944 Ga0207661_10061928 Ga0207661_100619283 157
46 3300026035 Ga0207703_10114654 Ga0207703_101146543 157
47 3300026089 Ga0207648_10162618 Ga0207648_101626182 157
48 3300026095 Ga0207676_10327322 Ga0207676_103273222 157
49 3300026118 Ga0207675_100690069 Ga0207675_1006900692 157
50 3300027907 Ga0207428_10388837 Ga0207428_103888372 157
51 3300031548 Ga0307408_100079053 Ga0307408_1000790532 157
52 3300031901 Ga0307406_10689026 Ga0307406_106890262 157
53 3300031995 Ga0307409_101130111 Ga0307409_1011301112 157
54 3300032002 Ga0307416_100597985 Ga0307416_1005979852 157
55 3300034817 Ga0373948_0128498 Ga0373948_0128498_31_549 157
56 3300034957 Ga0373938_0020992 Ga0373938_0020992_501_1019 157
57 3300035086 Ga0373934_0071709 Ga0373934_0071709_596_1114 157
58 3300035117 Ga0373953_0029960 Ga0373953_0029960_251_769 157
59 3300035119 Ga0373956_0030746 Ga0373956_0030746_192_710 157
60 3300035120 Ga0373957_0023039 Ga0373957_0023039_502_1020 157
61 3300035121 Ga0373960_0042624 Ga0373960_0042624_207_725 157
62 3300035172 Ga0373955_0011088 Ga0373955_0011088_2665_3183 157
63 3300035172 Ga0373955_0512645 Ga0373955_0512645_124_645 157
64 3300035241 Ga0373961_0008367 Ga0373961_0008367_1709_2227 157
65 3300035691 Ga0373931_0106676 Ga0373931_0106676_628_1146 157
66 3300035724 Ga0373933_0005121 Ga0373933_0005121_3916_4434 157
67 3300035724 Ga0373933_0406989 Ga0373933_0406989_314_835 157
68 3300036401 Ga0373937_0026090 Ga0373937_0026090_3363_3881 157
69 3300041486 Ga0451807_1159192 Ga0451807_1159192_1438_1956 157
70 3300041507 Ga0451851_0894497 Ga0451851_0894497_39_557 157
71 3300042876 Ga0451577_0099523 Ga0451577_0099523_1346_1864 157
72 3300044673 Ga0453683_0011272 Ga0453683_0011272_2201_2719 157
73 3300044712 Ga0453684_0012539 Ga0453684_0012539_3705_4223 157
74 3300045051 Ga0451576_0029721 Ga0451576_0029721_1850_2368 157
75 3300045051 Ga0451576_0048352 Ga0451576_0048352_3625_4143 157
76 3300046476 Ga0495662_0010433 Ga0495662_0010433_2575_3093 157
77 3300046516 Ga0495628_0306346 Ga0495628_0306346_383_904 157
78 3300046517 Ga0495630_0015069 Ga0495630_0015069_3263_3781 157
79 3300046533 Ga0495640_0008853 Ga0495640_0008853_1455_1973 157
80 3300046537 Ga0495598_0133655 Ga0495598_0133655_208_726 157
81 3300046537 Ga0495598_0133912 Ga0495598_0133912_153_671 157
82 3300046559 Ga0495667_0011382 Ga0495667_0011382_362_880 157
83 3300046642 Ga0495634_0201985 Ga0495634_0201985_253_771 157
84 3300046679 Ga0495623_0099069 Ga0495623_0099069_1031_1549 157
85 3300046681 Ga0495647_0101047 Ga0495647_0101047_456_974 157
86 3300046690 Ga0495624_0039898 Ga0495624_0039898_734_1252 157
87 3300046809 Ga0495600_0419864 Ga0495600_0419864_162_680 157
88 3300047315 Ga0495581_0158300 Ga0495581_0158300_707_1225 157
89 3300047317 Ga0495604_0350888 Ga0495604_0350888_440_958 157
90 3300047318 Ga0495636_0008964 Ga0495636_0008964_1791_2309 157
91 3300047322 Ga0495680_0320143 Ga0495680_0320143_189_707 157
92 3300047322 Ga0495680_0332072 Ga0495680_0332072_445_963 157
93 3300049569 Ga0501032_0113155 Ga0501032_0113155_794_1312 157
94 3300049570 Ga0501033_0217114 Ga0501033_0217114_160_678 157
95 3300049572 Ga0501036_0379322 Ga0501036_0379322_192_710 157
96 3300049573 Ga0501037_0239415 Ga0501037_0239415_41_559 157
97 3300049574 Ga0501038_0065713 Ga0501038_0065713_709_1227 157
98 3300049575 Ga0501039_0367635 Ga0501039_0367635_562_1080 157
99 3300049584 Ga0501068_0561312 Ga0501068_0561312_165_683 157
100 3300049586 Ga0501070_0031163 Ga0501070_0031163_3706_4224 157
101 3300049586 Ga0501070_0106834 Ga0501070_0106834_270_788 157
102 3300049588 Ga0501072_0210136 Ga0501072_0210136_327_845 157
103 3300049589 Ga0501073_0212684 Ga0501073_0212684_450_968 157
104 3300049744 Ga0501083_0028191 Ga0501083_0028191_340_858 157
105 3300050492 nmdc:mga0yw44_9360_c1 nmdc:mga0yw44_9360_c1_225_743 157
106 3300050511 nmdc:mga08y16_194844_c1 nmdc:mga08y16_194844_c1_1360_1878 157
107 3300050512 nmdc:mga0n895_263799_c1 nmdc:mga0n895_263799_c1_666_1184 157
108 3300050513 nmdc:mga0rr50_384192_c1 nmdc:mga0rr50_384192_c1_58_576 157
109 3300050513 nmdc:mga0rr50_392832_c1 nmdc:mga0rr50_392832_c1_446_964 157
110 3300050514 nmdc:mga08x19_820_c1 nmdc:mga08x19_820_c1_10504_11022 157
111 3300050515 nmdc:mga0a205_477547_c1 nmdc:mga0a205_477547_c1_59_577 157
112 3300059421 Ga0590071_134490 Ga0590071_134490_57_575 157
113 3300060353 Ga0501082_0040538 Ga0501082_0040538_1287_1805 157
114 iso_pu_bacteria 8057568493 8057568882 157
115 3300021384 Ga0213876_10266763 Ga0213876_102667632 158
116 3300025299 Ga0209256_1003564 Ga0209256_10035642 158
117 3300030878 Ga0265770_1032434 Ga0265770_10324342 158
118 3300032004 Ga0307414_10305719 Ga0307414_103057192 158
119 3300035692 Ga0373935_0534944 Ga0373935_0534944_23_544 158
120 3300038443 Ga0395901_0250160 Ga0395901_0250160_412_933 158
121 3300039437 Ga0436365_1785580 Ga0436365_1785580_29_595 158
122 3300042876 Ga0451577_0429767 Ga0451577_0429767_14_535 158
123 3300046518 Ga0495631_0126907 Ga0495631_0126907_484_1005 158
124 3300047446 Ga0495679_005264 Ga0495679_005264_209_730 158
125 3300049583 Ga0501067_0009778 Ga0501067_0009778_4417_4938 158
126 3300049588 Ga0501072_0073568 Ga0501072_0073568_406_927 158
127 3300049590 Ga0501074_0039623 Ga0501074_0039623_1315_1836 158
128 3300049742 Ga0501080_0589651 Ga0501080_0589651_15_536 158
129 3300049744 Ga0501083_0533813 Ga0501083_0533813_231_752 158
130 3300053125 Ga0500618_000110 Ga0500618_000110_10133_10654 158
131 3300053136 Ga0500559_0000055 Ga0500559_0000055_78972_79493 158
132 3300054114 Ga0501084_0064988 Ga0501084_0064988_1691_2212 158
133 3300060353 Ga0501082_0014421 Ga0501082_0014421_4180_4701 158
134 iso_pu_bacteria 2524023250 2524609267 158
135 iso_pu_bacteria 2643221598 2644002167 158
136 iso_pu_bacteria 2791355048 2792463552 158
137 iso_pu_bacteria 2843744320 2843748344 158
138 iso_pu_bacteria 2849560528 2849564756 158
139 iso_pu_bacteria 2849573788 2849576998 158
140 iso_pu_bacteria 2851153111 2851155146 158
141 iso_pu_bacteria 2898329390 2898329694 158
142 iso_pu_bacteria 2941485952 2941486390 158
143 3300044658 Ga0466972_0210194 Ga0466972_0210194_238_762 159
144 3300005327 Ga0070658_10001192 Ga0070658_1000119212 160
145 3300005336 Ga0070680_100000297 Ga0070680_10000029727 160
146 3300005458 Ga0070681_10025473 Ga0070681_100254733 160
147 3300005530 Ga0070679_100006559 Ga0070679_1000065598 160
148 3300013104 Ga0157370_10078473 Ga0157370_100784734 160
149 3300025909 Ga0207705_10015019 Ga0207705_100150197 160
150 3300025912 Ga0207707_10001022 Ga0207707_1000102223 160
151 3300025917 Ga0207660_10000404 Ga0207660_100004047 160
152 3300025919 Ga0207657_10368149 Ga0207657_103681492 160
153 3300025921 Ga0207652_10000717 Ga0207652_1000071727 160
154 3300041443 Ga0451789_1052800 Ga0451789_1052800_131_670 160
155 3300046678 Ga0495599_0127281 Ga0495599_0127281_726_1226 160
156 3300031731 Ga0307405_10032700 Ga0307405_100327004 161
157 3300049685 Ga0501256_030455 Ga0501256_030455_30_521 161
158 3300005435 Ga0070714_101167849 Ga0070714_1011678492 162
159 3300005467 Ga0070706_100034591 Ga0070706_1000345914 162
160 3300005468 Ga0070707_100179566 Ga0070707_1001795662 162
161 3300005468 Ga0070707_100867664 Ga0070707_1008676641 162
162 3300025910 Ga0207684_10015851 Ga0207684_100158516 162
163 3300025910 Ga0207684_11274077 Ga0207684_112740771 162
164 3300025916 Ga0207663_11439085 Ga0207663_114390851 162
165 3300025922 Ga0207646_10038249 Ga0207646_100382492 162
166 iso_pu_bacteria 2643221578 2643901990 162
167 iso_pu_bacteria 2643221601 2644017982 162
168 iso_pu_bacteria 2643221631 2644180730 162
169 iso_pu_bacteria 2643221673 2644408134 162
170 iso_pu_bacteria 2643221711 2644607381 162
171 iso_pu_bacteria 2811994882 2812373829 162
172 iso_pu_bacteria 2818991462 2819691312 162
173 iso_pu_bacteria 2818991469 2819729205 162
174 iso_pu_bacteria 2875391855 2875397701 162
175 iso_pu_bacteria 2946045630 2946046824 162
176 3300005577 Ga0068857_100806713 Ga0068857_1008067132 163
177 3300005617 Ga0068859_101174599 Ga0068859_1011745992 163
178 3300006844 Ga0075428_100016810 Ga0075428_1000168103 163
179 3300006844 Ga0075428_100081064 Ga0075428_1000810644 163
180 3300006846 Ga0075430_100013280 Ga0075430_1000132804 163
181 3300006846 Ga0075430_100312955 Ga0075430_1003129551 163
182 3300006847 Ga0075431_100015347 Ga0075431_1000153478 163
183 3300006847 Ga0075431_100441400 Ga0075431_1004414002 163
184 3300006847 Ga0075431_100809161 Ga0075431_1008091612 163
185 3300006880 Ga0075429_100003160 Ga0075429_10000316011 163
186 3300006880 Ga0075429_100347510 Ga0075429_1003475102 163
187 3300006931 Ga0097620_101174406 Ga0097620_1011744062 163
188 3300009147 Ga0114129_10003939 Ga0114129_100039396 163
189 3300009147 Ga0114129_10029362 Ga0114129_100293625 163
190 3300009147 Ga0114129_10072691 Ga0114129_100726914 163
191 3300009147 Ga0114129_10236611 Ga0114129_102366113 163
192 3300009174 Ga0105241_10607688 Ga0105241_106076882 163
193 3300026116 Ga0207674_10298033 Ga0207674_102980332 163
194 3300031995 Ga0307409_100845266 Ga0307409_1008452661 163
195 3300032126 Ga0307415_101621540 Ga0307415_1016215401 163
196 3300035117 Ga0373953_0442143 Ga0373953_0442143_31_525 163
197 3300035207 Ga0373942_0018270 Ga0373942_0018270_73_573 163
198 3300035725 Ga0373947_0339740 Ga0373947_0339740_264_758 163
199 3300036401 Ga0373937_0054128 Ga0373937_0054128_2786_3280 163
200 3300041452 Ga0451793_1844926 Ga0451793_1844926_22_516 163
201 3300046559 Ga0495667_0147219 Ga0495667_0147219_578_1072 163
202 3300050507 nmdc:mga05p37_123297_c1 nmdc:mga05p37_123297_c1_280_777 163
203 3300050507 nmdc:mga05p37_25797_c1 nmdc:mga05p37_25797_c1_2726_3220 163
204 3300050508 nmdc:mga09592_33389_c1 nmdc:mga09592_33389_c1_1503_1994 163
205 3300050508 nmdc:mga09592_693_c1 nmdc:mga09592_693_c1_18922_19416 163
206 3300050509 nmdc:mga0qj67_106_c1 nmdc:mga0qj67_106_c1_17866_18360 163
207 3300050509 nmdc:mga0qj67_33844_c1 nmdc:mga0qj67_33844_c1_1345_1836 163
208 3300050510 nmdc:mga06r32_17855_c1 nmdc:mga06r32_17855_c1_1622_2113 163
209 3300050510 nmdc:mga06r32_3172_c2 nmdc:mga06r32_3172_c2_2831_3325 163
210 3300050510 nmdc:mga06r32_378114_c1 nmdc:mga06r32_378114_c1_308_805 163
211 3300050510 nmdc:mga06r32_832008_c1 nmdc:mga06r32_832008_c1_272_769 163
212 3300053085 Ga0495619_0194072 Ga0495619_0194072_541_1035 163
213 3300053088 Ga0500644_0028617 Ga0500644_0028617_815_1321 163
214 3300020080 Ga0206350_10124477 Ga0206350_101244771 165
215 3300020610 Ga0154015_1709930 Ga0154015_17099301 165
216 3300026121 Ga0207683_11331636 Ga0207683_113316361 165
217 3300044765 Ga0466970_0576252 Ga0466970_0576252_115_621 165
218 3300049590 Ga0501074_0536248 Ga0501074_0536248_210_716 165
219 3300001990 JGI24737J22298_10022234 JGI24737J22298_100222342 166
220 3300002074 JGI24748J21848_1015178 JGI24748J21848_10151781 166
221 3300003203 JGI25406J46586_10005808 JGI25406J46586_100058083 166
222 3300003911 JGI25405J52794_10037970 JGI25405J52794_100379701 166
223 3300005329 Ga0070683_100291298 Ga0070683_1002912982 166
224 3300005330 Ga0070690_100737001 Ga0070690_1007370011 166
225 3300005337 Ga0070682_100083369 Ga0070682_1000833693 166
226 3300005337 Ga0070682_100178088 Ga0070682_1001780881 166
227 3300005337 Ga0070682_100755209 Ga0070682_1007552091 166
228 3300005337 Ga0070682_100852579 Ga0070682_1008525791 166
229 3300005345 Ga0070692_10303370 Ga0070692_103033702 166
230 3300005347 Ga0070668_100070930 Ga0070668_1000709302 166
231 3300005355 Ga0070671_100043473 Ga0070671_1000434734 166
232 3300005365 Ga0070688_100709555 Ga0070688_1007095551 166
233 3300005367 Ga0070667_100013536 Ga0070667_1000135363 166
234 3300005435 Ga0070714_100000701 Ga0070714_10000070118 166
235 3300005435 Ga0070714_100005205 Ga0070714_1000052057 166
236 3300005435 Ga0070714_100011815 Ga0070714_1000118156 166
237 3300005436 Ga0070713_100527263 Ga0070713_1005272632 166
238 3300005466 Ga0070685_10818795 Ga0070685_108187951 166
239 3300005535 Ga0070684_100364310 Ga0070684_1003643102 166
240 3300005547 Ga0070693_100717615 Ga0070693_1007176151 166
241 3300005548 Ga0070665_100652231 Ga0070665_1006522312 166
242 3300005564 Ga0070664_100932362 Ga0070664_1009323622 166
243 3300005614 Ga0068856_100007511 Ga0068856_1000075119 166
244 3300005616 Ga0068852_100054959 Ga0068852_1000549592 166
245 3300005617 Ga0068859_100000301 Ga0068859_10000030124 166
246 3300005617 Ga0068859_100003956 Ga0068859_10000395612 166
247 3300005618 Ga0068864_100462482 Ga0068864_1004624822 166
248 3300005618 Ga0068864_101859878 Ga0068864_1018598781 166
249 3300005841 Ga0068863_100000163 Ga0068863_10000016361 166
250 3300005841 Ga0068863_100139312 Ga0068863_1001393122 166
251 3300005842 Ga0068858_100000010 Ga0068858_100000010224 166
252 3300005843 Ga0068860_100064334 Ga0068860_1000643342 166
253 3300005844 Ga0068862_100000049 Ga0068862_10000004926 166
254 3300005937 Ga0081455_10000544 Ga0081455_1000054432 166
255 3300005937 Ga0081455_10259492 Ga0081455_102594922 166
256 3300005983 Ga0081540_1164447 Ga0081540_11644472 166
257 3300005985 Ga0081539_10000094 Ga0081539_1000009484 166
258 3300006028 Ga0070717_10001308 Ga0070717_100013085 166
259 3300006028 Ga0070717_10488027 Ga0070717_104880273 166
260 3300006173 Ga0070716_100121795 Ga0070716_1001217952 166
261 3300006846 Ga0075430_100250134 Ga0075430_1002501342 166
262 3300006880 Ga0075429_100031061 Ga0075429_1000310616 166
263 3300006931 Ga0097620_100000301 Ga0097620_10000030126 166
264 3300006931 Ga0097620_100003956 Ga0097620_1000039565 166
265 3300007076 Ga0075435_100663325 Ga0075435_1006633251 166
266 3300009011 Ga0105251_10036456 Ga0105251_100364563 166
267 3300009092 Ga0105250_10155234 Ga0105250_101552342 166
268 3300009092 Ga0105250_10241967 Ga0105250_102419671 166
269 3300009093 Ga0105240_10037718 Ga0105240_100377182 166
270 3300009094 Ga0111539_11176431 Ga0111539_111764311 166
271 3300009098 Ga0105245_10109792 Ga0105245_101097924 166
272 3300009098 Ga0105245_11168492 Ga0105245_111684921 166
273 3300009101 Ga0105247_10000834 Ga0105247_1000083410 166
274 3300009148 Ga0105243_10383916 Ga0105243_103839162 166
275 3300009177 Ga0105248_10000147 Ga0105248_1000014714 166
276 3300009177 Ga0105248_10000377 Ga0105248_1000037736 166
277 3300009177 Ga0105248_11022731 Ga0105248_110227312 166
278 3300009545 Ga0105237_10013119 Ga0105237_100131193 166
279 3300009545 Ga0105237_10040024 Ga0105237_100400241 166
280 3300009545 Ga0105237_10808569 Ga0105237_108085691 166
281 3300009553 Ga0105249_10165031 Ga0105249_101650312 166
282 3300009553 Ga0105249_10277011 Ga0105249_102770111 166
283 3300009986 Ga0105033_103522 Ga0105033_1035221 166
284 3300010375 Ga0105239_10018684 Ga0105239_100186845 166
285 3300010375 Ga0105239_10702747 Ga0105239_107027472 166
286 3300012492 Ga0157335_1004676 Ga0157335_10046761 166
287 3300013105 Ga0157369_10023576 Ga0157369_100235763 166
288 3300013105 Ga0157369_10718874 Ga0157369_107188741 166
289 3300013296 Ga0157374_10187916 Ga0157374_101879162 166
290 3300013308 Ga0157375_10018285 Ga0157375_100182852 166
291 3300013308 Ga0157375_10184847 Ga0157375_101848473 166
292 3300013308 Ga0157375_10525782 Ga0157375_105257822 166
293 3300014325 Ga0163163_10002172 Ga0163163_100021726 166
294 3300014325 Ga0163163_10010694 Ga0163163_100106949 166
295 3300014325 Ga0163163_10102206 Ga0163163_101022064 166
296 3300014325 Ga0163163_10363312 Ga0163163_103633122 166
297 3300014325 Ga0163163_10450650 Ga0163163_104506502 166
298 3300014325 Ga0163163_10710561 Ga0163163_107105612 166
299 3300014968 Ga0157379_10000149 Ga0157379_1000014938 166
300 3300020069 Ga0197907_10830029 Ga0197907_108300292 166
301 3300020077 Ga0206351_10215200 Ga0206351_102152001 166
302 3300022467 Ga0224712_10210574 Ga0224712_102105742 166
303 3300025711 Ga0207696_1117897 Ga0207696_11178971 166
304 3300025900 Ga0207710_10000107 Ga0207710_100001078 166
305 3300025900 Ga0207710_10000144 Ga0207710_1000014428 166
306 3300025904 Ga0207647_10055951 Ga0207647_100559513 166
307 3300025904 Ga0207647_10271449 Ga0207647_102714492 166
308 3300025906 Ga0207699_10000045 Ga0207699_10000045125 166
309 3300025911 Ga0207654_10107189 Ga0207654_101071891 166
310 3300025913 Ga0207695_10035602 Ga0207695_100356022 166
311 3300025914 Ga0207671_10119158 Ga0207671_101191582 166
312 3300025914 Ga0207671_10614849 Ga0207671_106148492 166
313 3300025914 Ga0207671_10682671 Ga0207671_106826711 166
314 3300025915 Ga0207693_10693463 Ga0207693_106934631 166
315 3300025915 Ga0207693_11209026 Ga0207693_112090261 166
316 3300025924 Ga0207694_10381039 Ga0207694_103810391 166
317 3300025927 Ga0207687_10528271 Ga0207687_105282712 166
318 3300025928 Ga0207700_10048409 Ga0207700_100484095 166
319 3300025928 Ga0207700_10128005 Ga0207700_101280052 166
320 3300025929 Ga0207664_10000641 Ga0207664_100006415 166
321 3300025929 Ga0207664_10046528 Ga0207664_100465282 166
322 3300025929 Ga0207664_10407463 Ga0207664_104074632 166
323 3300025929 Ga0207664_10924062 Ga0207664_109240621 166
324 3300025935 Ga0207709_10616358 Ga0207709_106163581 166
325 3300025939 Ga0207665_10114972 Ga0207665_101149722 166
326 3300025941 Ga0207711_10000056 Ga0207711_1000005613 166
327 3300025941 Ga0207711_10010080 Ga0207711_100100806 166
328 3300025941 Ga0207711_11169981 Ga0207711_111699812 166
329 3300025944 Ga0207661_10137783 Ga0207661_101377832 166
330 3300025949 Ga0207667_10003347 Ga0207667_1000334716 166
331 3300025961 Ga0207712_10119767 Ga0207712_101197672 166
332 3300025986 Ga0207658_10138354 Ga0207658_101383544 166
333 3300026023 Ga0207677_10186648 Ga0207677_101866482 166
334 3300026035 Ga0207703_10000002 Ga0207703_1000000251 166
335 3300026078 Ga0207702_10009578 Ga0207702_100095789 166
336 3300026078 Ga0207702_10022306 Ga0207702_100223065 166
337 3300026088 Ga0207641_10000877 Ga0207641_1000087728 166
338 3300026088 Ga0207641_10012501 Ga0207641_100125017 166
339 3300026088 Ga0207641_10256522 Ga0207641_102565222 166
340 3300026095 Ga0207676_10448950 Ga0207676_104489502 166
341 3300026121 Ga0207683_10489755 Ga0207683_104897552 166
342 3300026121 Ga0207683_10639308 Ga0207683_106393082 166
343 3300028379 Ga0268266_10035268 Ga0268266_100352683 166
344 3300028380 Ga0268265_10000017 Ga0268265_10000017132 166
345 3300028381 Ga0268264_10003187 Ga0268264_1000318710 166
346 3300031456 Ga0307513_10047714 Ga0307513_100477146 166
347 3300031456 Ga0307513_10287866 Ga0307513_102878662 166
348 3300031548 Ga0307408_100482781 Ga0307408_1004827812 166
349 3300031824 Ga0307413_10458006 Ga0307413_104580062 166
350 3300031852 Ga0307410_10001047 Ga0307410_100010475 166
351 3300031852 Ga0307410_10038534 Ga0307410_100385345 166
352 3300031852 Ga0307410_10321663 Ga0307410_103216632 166
353 3300031852 Ga0307410_10634507 Ga0307410_106345072 166
354 3300031901 Ga0307406_10096690 Ga0307406_100966903 166
355 3300031901 Ga0307406_10136734 Ga0307406_101367343 166
356 3300031903 Ga0307407_10257666 Ga0307407_102576662 166
357 3300031903 Ga0307407_10434125 Ga0307407_104341251 166
358 3300031911 Ga0307412_10251110 Ga0307412_102511102 166
359 3300031995 Ga0307409_100093287 Ga0307409_1000932874 166
360 3300031995 Ga0307409_100094104 Ga0307409_1000941042 166
361 3300031995 Ga0307409_100110011 Ga0307409_1001100113 166
362 3300031995 Ga0307409_100346646 Ga0307409_1003466462 166
363 3300031995 Ga0307409_100468656 Ga0307409_1004686562 166
364 3300032002 Ga0307416_100053043 Ga0307416_1000530433 166
365 3300032002 Ga0307416_100330506 Ga0307416_1003305061 166
366 3300032002 Ga0307416_100626013 Ga0307416_1006260132 166
367 3300032002 Ga0307416_100941587 Ga0307416_1009415872 166
368 3300032004 Ga0307414_10175222 Ga0307414_101752223 166
369 3300032005 Ga0307411_10673289 Ga0307411_106732892 166
370 3300032126 Ga0307415_100031514 Ga0307415_1000315142 166
371 3300032126 Ga0307415_100102430 Ga0307415_1001024303 166
372 3300032126 Ga0307415_100198226 Ga0307415_1001982262 166
373 3300032126 Ga0307415_100224594 Ga0307415_1002245942 166
374 3300032126 Ga0307415_100315906 Ga0307415_1003159061 166
375 3300032126 Ga0307415_100934863 Ga0307415_1009348631 166
376 3300033179 Ga0307507_10000113 Ga0307507_100001137 166
377 3300033179 Ga0307507_10004395 Ga0307507_100043952 166
378 3300035119 Ga0373956_0012279 Ga0373956_0012279_2286_2819 166
379 3300035695 Ga0373927_0125662 Ga0373927_0125662_477_980 166
380 3300037312 Ga0395899_0017796 Ga0395899_0017796_4744_5250 166
381 3300037418 Ga0395900_0015034 Ga0395900_0015034_3038_3544 166
382 3300037418 Ga0395900_0108490 Ga0395900_0108490_1856_2362 166
383 3300037418 Ga0395900_0138769 Ga0395900_0138769_1891_2433 166
384 3300037418 Ga0395900_0183497 Ga0395900_0183497_1198_1707 166
385 3300037466 Ga0395898_1051954 Ga0395898_1051954_63_605 166
386 3300037471 Ga0395905_0300418 Ga0395905_0300418_125_634 166
387 3300037471 Ga0395905_0448999 Ga0395905_0448999_489_1031 166
388 3300037471 Ga0395905_0515252 Ga0395905_0515252_122_643 166
389 3300038443 Ga0395901_0340924 Ga0395901_0340924_811_1353 166
390 3300041410 Ga0439461_0089488 Ga0439461_0089488_41_550 166
391 3300041452 Ga0451793_0219251 Ga0451793_0219251_10_516 166
392 3300042002 Ga0439442_030398 Ga0439442_030398_76_597 166
393 3300044656 Ga0466969_0012981 Ga0466969_0012981_459_962 166
394 3300044656 Ga0466969_0090528 Ga0466969_0090528_273_782 166
395 3300044656 Ga0466969_0094403 Ga0466969_0094403_522_1025 166
396 3300044656 Ga0466969_0096229 Ga0466969_0096229_343_852 166
397 3300044658 Ga0466972_0013425 Ga0466972_0013425_1575_2081 166
398 3300044658 Ga0466972_0031423 Ga0466972_0031423_316_825 166
399 3300044658 Ga0466972_0083717 Ga0466972_0083717_915_1421 166
400 3300044658 Ga0466972_0426056 Ga0466972_0426056_78_587 166
401 3300044683 Ga0466965_0023943 Ga0466965_0023943_993_1502 166
402 3300044683 Ga0466965_0433285 Ga0466965_0433285_208_714 166
403 3300044684 Ga0466966_0039381 Ga0466966_0039381_459_977 166
404 3300044684 Ga0466966_0059821 Ga0466966_0059821_1611_2114 166
405 3300044684 Ga0466966_0121075 Ga0466966_0121075_216_722 166
406 3300044684 Ga0466966_0403536 Ga0466966_0403536_275_784 166
407 3300044684 Ga0466966_0449776 Ga0466966_0449776_29_538 166
408 3300044693 Ga0466961_0003497 Ga0466961_0003497_4842_5342 166
409 3300044693 Ga0466961_0049856 Ga0466961_0049856_1658_2161 166
410 3300044693 Ga0466961_0066958 Ga0466961_0066958_1169_1675 166
411 3300044693 Ga0466961_0072924 Ga0466961_0072924_1382_1891 166
412 3300044693 Ga0466961_0088673 Ga0466961_0088673_437_949 166
413 3300044693 Ga0466961_0108177 Ga0466961_0108177_887_1402 166
414 3300044693 Ga0466961_0134902 Ga0466961_0134902_60_578 166
415 3300044693 Ga0466961_0189160 Ga0466961_0189160_224_733 166
416 3300044693 Ga0466961_0192442 Ga0466961_0192442_504_1013 166
417 3300044693 Ga0466961_0295475 Ga0466961_0295475_274_780 166
418 3300044694 Ga0466963_0002849 Ga0466963_0002849_5223_5735 166
419 3300044694 Ga0466963_0014159 Ga0466963_0014159_4146_4655 166
420 3300044694 Ga0466963_0029589 Ga0466963_0029589_1551_2057 166
421 3300044694 Ga0466963_0052305 Ga0466963_0052305_1915_2424 166
422 3300044694 Ga0466963_0086900 Ga0466963_0086900_1344_1853 166
423 3300044694 Ga0466963_0208994 Ga0466963_0208994_433_939 166
424 3300044706 Ga0466964_0007178 Ga0466964_0007178_1799_2308 166
425 3300044706 Ga0466964_0089676 Ga0466964_0089676_311_820 166
426 3300044706 Ga0466964_0426520 Ga0466964_0426520_154_663 166
427 3300044719 Ga0466971_0003719 Ga0466971_0003719_5254_5763 166
428 3300044719 Ga0466971_0007792 Ga0466971_0007792_1054_1566 166
429 3300044719 Ga0466971_0026619 Ga0466971_0026619_1131_1649 166
430 3300044719 Ga0466971_0044346 Ga0466971_0044346_1375_1884 166
431 3300044719 Ga0466971_0195562 Ga0466971_0195562_28_537 166
432 3300044719 Ga0466971_0393811 Ga0466971_0393811_22_528 166
433 3300044765 Ga0466970_0010596 Ga0466970_0010596_3481_4182 166
434 3300044765 Ga0466970_0020655 Ga0466970_0020655_2286_2801 166
435 3300044765 Ga0466970_0036349 Ga0466970_0036349_1436_1939 166
436 3300044765 Ga0466970_0048225 Ga0466970_0048225_800_1306 166
437 3300044765 Ga0466970_0091491 Ga0466970_0091491_305_814 166
438 3300044765 Ga0466970_0552196 Ga0466970_0552196_55_564 166
439 3300044842 Ga0466957_0014176 Ga0466957_0014176_3388_3897 166
440 3300044842 Ga0466957_0021338 Ga0466957_0021338_682_1191 166
441 3300044842 Ga0466957_0053914 Ga0466957_0053914_815_1321 166
442 3300044842 Ga0466957_0082117 Ga0466957_0082117_1303_1809 166
443 3300044842 Ga0466957_0130898 Ga0466957_0130898_703_1206 166
444 3300044842 Ga0466957_0177635 Ga0466957_0177635_203_715 166
445 3300044842 Ga0466957_0299987 Ga0466957_0299987_73_582 166
446 3300044842 Ga0466957_0700959 Ga0466957_0700959_60_566 166
447 3300044901 Ga0466960_0007075 Ga0466960_0007075_2598_3104 166
448 3300044901 Ga0466960_0072265 Ga0466960_0072265_348_857 166
449 3300044901 Ga0466960_0100153 Ga0466960_0100153_515_1021 166
450 3300044901 Ga0466960_0124142 Ga0466960_0124142_717_1223 166
451 3300044901 Ga0466960_0232322 Ga0466960_0232322_362_871 166
452 3300045049 Ga0466959_0044294 Ga0466959_0044294_2524_3027 166
453 3300045049 Ga0466959_0054045 Ga0466959_0054045_2307_2816 166
454 3300045049 Ga0466959_0058916 Ga0466959_0058916_1496_2008 166
455 3300045049 Ga0466959_0062173 Ga0466959_0062173_209_727 166
456 3300045049 Ga0466959_0136848 Ga0466959_0136848_546_1055 166
457 3300045049 Ga0466959_0150860 Ga0466959_0150860_1066_1569 166
458 3300045049 Ga0466959_0310694 Ga0466959_0310694_113_619 166
459 3300045836 Ga0466958_0006888 Ga0466958_0006888_1352_1861 166
460 3300045836 Ga0466958_0008606 Ga0466958_0008606_3237_3749 166
461 3300045836 Ga0466958_0015729 Ga0466958_0015729_3580_4098 166
462 3300045836 Ga0466958_0041210 Ga0466958_0041210_865_1383 166
463 3300045836 Ga0466958_0044573 Ga0466958_0044573_1080_1589 166
464 3300045836 Ga0466958_0067772 Ga0466958_0067772_316_825 166
465 3300045836 Ga0466958_0516432 Ga0466958_0516432_195_704 166
466 3300045836 Ga0466958_0552229 Ga0466958_0552229_146_652 166
467 3300045976 Ga0466967_0006716 Ga0466967_0006716_7396_7905 166
468 3300045976 Ga0466967_0032803 Ga0466967_0032803_1829_2338 166
469 3300045976 Ga0466967_0050747 Ga0466967_0050747_2518_3027 166
470 3300045976 Ga0466967_0056572 Ga0466967_0056572_1044_1553 166
471 3300045976 Ga0466967_0172559 Ga0466967_0172559_11_520 166
472 3300045976 Ga0466967_0227288 Ga0466967_0227288_830_1333 166
473 3300045976 Ga0466967_0267314 Ga0466967_0267314_192_698 166
474 3300045976 Ga0466967_0328650 Ga0466967_0328650_758_1261 166
475 3300045976 Ga0466967_0915111 Ga0466967_0915111_260_769 166
476 3300046454 Ga0495592_0010881 Ga0495592_0010881_1291_1794 166
477 3300046462 Ga0495651_0022043 Ga0495651_0022043_1103_1606 166
478 3300046462 Ga0495651_0087932 Ga0495651_0087932_121_624 166
479 3300046463 Ga0495653_0012957 Ga0495653_0012957_5188_5691 166
480 3300046473 Ga0495582_0418121 Ga0495582_0418121_68_574 166
481 3300046476 Ga0495662_0000796 Ga0495662_0000796_2195_2698 166
482 3300046477 Ga0495664_0002832 Ga0495664_0002832_6068_6571 166
483 3300046511 Ga0495608_0013736 Ga0495608_0013736_4682_5185 166
484 3300046511 Ga0495608_0574961 Ga0495608_0574961_35_538 166
485 3300046517 Ga0495630_0146698 Ga0495630_0146698_650_1153 166
486 3300046518 Ga0495631_0036896 Ga0495631_0036896_1062_1652 166
487 3300046525 Ga0495663_0044446 Ga0495663_0044446_119_709 166
488 3300046526 Ga0495666_0002368 Ga0495666_0002368_2999_3502 166
489 3300046529 Ga0495652_0050310 Ga0495652_0050310_1011_1514 166
490 3300046529 Ga0495652_0163446 Ga0495652_0163446_581_1084 166
491 3300046531 Ga0495665_0034897 Ga0495665_0034897_541_1044 166
492 3300046533 Ga0495640_0037412 Ga0495640_0037412_881_1384 166
493 3300046535 Ga0495586_0059979 Ga0495586_0059979_1310_1813 166
494 3300046543 Ga0495645_0015444 Ga0495645_0015444_4277_4780 166
495 3300046559 Ga0495667_0091129 Ga0495667_0091129_1107_1610 166
496 3300046615 Ga0495656_0130395 Ga0495656_0130395_132_641 166
497 3300046642 Ga0495634_0517677 Ga0495634_0517677_21_527 166
498 3300046674 Ga0495588_0324046 Ga0495588_0324046_250_753 166
499 3300046675 Ga0495657_0009221 Ga0495657_0009221_1211_1714 166
500 3300046678 Ga0495599_0166206 Ga0495599_0166206_542_1045 166
501 3300046679 Ga0495623_0140179 Ga0495623_0140179_545_1048 166
502 3300046679 Ga0495623_0226480 Ga0495623_0226480_38_541 166
503 3300046680 Ga0495646_0116180 Ga0495646_0116180_650_1153 166
504 3300046683 Ga0495658_0434872 Ga0495658_0434872_315_824 166
505 3300046689 Ga0495613_0012604 Ga0495613_0012604_2254_2757 166
506 3300046809 Ga0495600_0135863 Ga0495600_0135863_642_1145 166
507 3300047315 Ga0495581_0074152 Ga0495581_0074152_1355_1858 166
508 3300047317 Ga0495604_0000925 Ga0495604_0000925_8680_9183 166
509 3300047317 Ga0495604_0001249 Ga0495604_0001249_8590_9093 166
510 3300047318 Ga0495636_0362954 Ga0495636_0362954_36_539 166
511 3300047319 Ga0495674_0048596 Ga0495674_0048596_650_1153 166
512 3300047320 Ga0495672_0371186 Ga0495672_0371186_138_641 166
513 3300047321 Ga0495676_0065421 Ga0495676_0065421_416_925 166
514 3300047321 Ga0495676_0455294 Ga0495676_0455294_190_696 166
515 3300047444 Ga0495675_0017354 Ga0495675_0017354_862_1365 166
516 3300047444 Ga0495675_0044672 Ga0495675_0044672_650_1153 166
517 3300047447 Ga0495685_080450 Ga0495685_080450_336_839 166
518 3300047471 Ga0495684_0040950 Ga0495684_0040950_542_1045 166
519 3300048088 Ga0495602_0082865 Ga0495602_0082865_896_1399 166
520 3300048903 Ga0496100_0068828 Ga0496100_0068828_454_1008 166
521 3300048904 Ga0496101_0014011 Ga0496101_0014011_1860_2414 166
522 3300048905 Ga0496102_0043034 Ga0496102_0043034_2597_3151 166
523 3300048905 Ga0496102_0140265 Ga0496102_0140265_236_742 166
524 3300048906 Ga0496103_0004537 Ga0496103_0004537_3002_3556 166
525 3300048907 Ga0496104_0105303 Ga0496104_0105303_2175_2681 166
526 3300048908 Ga0496105_0012010 Ga0496105_0012010_3052_3606 166
527 3300048908 Ga0496105_0381119 Ga0496105_0381119_374_883 166
528 3300048909 Ga0496106_0248893 Ga0496106_0248893_16_522 166
529 3300048909 Ga0496106_0290875 Ga0496106_0290875_214_768 166
530 3300048910 Ga0496107_0092600 Ga0496107_0092600_857_1411 166
531 3300048910 Ga0496107_1166132 Ga0496107_1166132_11_514 166
532 3300048911 Ga0496108_0023473 Ga0496108_0023473_2178_2684 166
533 3300048911 Ga0496108_0263228 Ga0496108_0263228_930_1484 166
534 3300048911 Ga0496108_1549591 Ga0496108_1549591_24_527 166
535 3300048912 Ga0496109_0021128 Ga0496109_0021128_4407_4913 166
536 3300048913 Ga0496110_0059045 Ga0496110_0059045_2839_3345 166
537 3300048913 Ga0496110_0473448 Ga0496110_0473448_103_657 166
538 3300048914 Ga0496111_0122063 Ga0496111_0122063_482_988 166
539 3300048914 Ga0496111_0569856 Ga0496111_0569856_159_713 166
540 3300048915 Ga0496112_0022266 Ga0496112_0022266_4779_5285 166
541 3300048915 Ga0496112_0528758 Ga0496112_0528758_513_1019 166
542 3300048916 Ga0496113_0306186 Ga0496113_0306186_255_785 166
543 3300048917 Ga0496114_0020831 Ga0496114_0020831_2878_3432 166
544 3300048917 Ga0496114_0046107 Ga0496114_0046107_2749_3255 166
545 3300048917 Ga0496114_1021545 Ga0496114_1021545_95_601 166
546 3300048919 Ga0496116_0000578 Ga0496116_0000578_23566_24072 166
547 3300048920 Ga0496117_0021178 Ga0496117_0021178_2900_3406 166
548 3300048921 Ga0496118_0002249 Ga0496118_0002249_21677_22183 166
549 3300048922 Ga0496119_0000282 Ga0496119_0000282_67079_67600 166
550 3300048922 Ga0496119_0007110 Ga0496119_0007110_2021_2527 166
551 3300048922 Ga0496119_0008226 Ga0496119_0008226_6448_6957 166
552 3300048922 Ga0496119_0052315 Ga0496119_0052315_323_826 166
553 3300048923 Ga0496120_0000250 Ga0496120_0000250_53944_54453 166
554 3300048923 Ga0496120_0001391 Ga0496120_0001391_22288_22809 166
555 3300048924 Ga0496121_0021638 Ga0496121_0021638_319_825 166
556 3300048929 Ga0496126_0000026 Ga0496126_0000026_364432_364968 166
557 3300049568 Ga0501031_0067790 Ga0501031_0067790_935_1447 166
558 3300049568 Ga0501031_0226057 Ga0501031_0226057_341_853 166
559 3300049571 Ga0501034_0104075 Ga0501034_0104075_332_844 166
560 3300049572 Ga0501036_0547054 Ga0501036_0547054_40_552 166
561 3300049573 Ga0501037_0011562 Ga0501037_0011562_4872_5384 166
562 3300049574 Ga0501038_0002533 Ga0501038_0002533_15550_16062 166
563 3300049576 Ga0501040_0090451 Ga0501040_0090451_1025_1531 166
564 3300049577 Ga0501041_0462748 Ga0501041_0462748_216_722 166
565 3300049580 Ga0501046_0449821 Ga0501046_0449821_329_841 166
566 3300049581 Ga0501047_0135253 Ga0501047_0135253_193_705 166
567 3300049582 Ga0501048_0012241 Ga0501048_0012241_1219_1731 166
568 3300049582 Ga0501048_0053299 Ga0501048_0053299_1578_2084 166
569 3300049586 Ga0501070_0015355 Ga0501070_0015355_4551_5063 166
570 3300049587 Ga0501071_0616265 Ga0501071_0616265_116_622 166
571 3300049588 Ga0501072_0029969 Ga0501072_0029969_2985_3491 166
572 3300049590 Ga0501074_0304667 Ga0501074_0304667_59_571 166
573 3300049591 Ga0501075_0278015 Ga0501075_0278015_85_591 166
574 3300049592 Ga0501076_0602312 Ga0501076_0602312_100_606 166
575 3300049653 Ga0501206_057952 Ga0501206_057952_58_564 166
576 3300049656 Ga0501209_090588 Ga0501209_090588_352_858 166
577 3300049660 Ga0501216_106095 Ga0501216_106095_69_575 166
578 3300049743 Ga0501081_0254201 Ga0501081_0254201_192_698 166
579 3300049778 Ga0501282_007663 Ga0501282_007663_45_566 166
580 3300049822 Ga0501035_0081641 Ga0501035_0081641_710_1222 166
581 3300049822 Ga0501035_0176571 Ga0501035_0176571_97_603 166
582 3300049823 Ga0501044_0117519 Ga0501044_0117519_1453_1965 166
583 3300049823 Ga0501044_0265276 Ga0501044_0265276_728_1240 166
584 3300049823 Ga0501044_0436615 Ga0501044_0436615_333_839 166
585 3300049824 Ga0501045_0144777 Ga0501045_0144777_1127_1633 166
586 3300050508 nmdc:mga09592_77618_c1 nmdc:mga09592_77618_c1_1327_1833 166
587 3300050509 nmdc:mga0qj67_132318_c1 nmdc:mga0qj67_132318_c1_873_1391 166
588 3300053077 Ga0495601_0029692 Ga0495601_0029692_1148_1651 166
589 3300053077 Ga0495601_0050539 Ga0495601_0050539_1134_1637 166
590 3300053078 Ga0495612_0007799 Ga0495612_0007799_198_701 166
591 3300053083 Ga0495655_0059930 Ga0495655_0059930_113_619 166
592 3300053085 Ga0495619_0078602 Ga0495619_0078602_1596_2099 166
593 3300053085 Ga0495619_0199896 Ga0495619_0199896_445_948 166
594 3300053140 Ga0500573_0120348 Ga0500573_0120348_681_1184 166
595 3300054114 Ga0501084_0176176 Ga0501084_0176176_1025_1531 166
596 3300059493 Ga0587077_158362 Ga0587077_158362_41_553 166
597 3300059508 Ga0587088_110876 Ga0587088_110876_52_582 166
598 3300059642 Ga0587069_006763 Ga0587069_006763_22_531 166
599 3300060353 Ga0501082_0075352 Ga0501082_0075352_2378_2884 166
600 3300060353 Ga0501082_0447342 Ga0501082_0447342_405_917 166
601 3300060353 Ga0501082_1271232 Ga0501082_1271232_77_583 166
602 3300061719 Ga0466962_0013903 Ga0466962_0013903_2701_3204 166
603 3300061719 Ga0466962_0085017 Ga0466962_0085017_642_1151 166
604 3300061719 Ga0466962_0112347 Ga0466962_0112347_594_1103 166
605 3300061719 Ga0466962_0152541 Ga0466962_0152541_118_630 166
606 3300061719 Ga0466962_0215155 Ga0466962_0215155_386_892 166
607 3300061719 Ga0466962_0445708 Ga0466962_0445708_134_640 166
608 3300061719 Ga0466962_0542272 Ga0466962_0542272_17_520 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19315

MC_hydratase

Mesaconyl-CoA hydratase

18

192

0.93

PF01575

MaoC_dehydratas

MaoC like domain

37

158

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.9285 5 147
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.9138 5 148
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8945 6 147
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.878 4 147
6jql-assembly1.cif.gz_A structure of paaz, a bifunctional enzyme 0.8738 2 147
ID Description Score Start End Superfamily
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9573 1 147 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8945 6 147 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8925 1 147 3.10.129.10
af_P77455_520_674_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8851 2 145 3.10.129.10
4ffuI00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8752 4 147 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7V9F7M3-F1-model_v4 MaoC family dehydratase 0.9903 1 145 GO:0016829
AF-A0A7C1UID5-F1-model_v4 MaoC family dehydratase 0.9889 2 138
AF-A0A3D3Q9H8-F1-model_v4 Dehydratase 0.9888 3 101
AF-A0A2X3KSH4-F1-model_v4 deleted 0.9871 1 147
AF-A0A6B3H865-F1-model_v4 MaoC family dehydratase 0.9852 29 146

Feature Viewer

pLDDT pTM Quality
92.76 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map