F468760

General Info

Members Datasets Scaffolds Average Seq Length
608 320 593 301

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1000474|Ga0065165_100047422
Length 334
Sequence VAKLAGLPDRSPTMTDITLQNFEADLLQASMQQPVLLDIWAPWCGPCRTLGPMLEKLEVAYAGRWKLTKLNSDDQPEIATQLSQAFGVRSIPFCVMFVGGQPVDGFVGAIPEAQIREFLDRHVPTGEALEAEEDLAEAQALMEEGDADGALEKLQAAVQADPSNEVARFDLIRALLEDDQLAHAKAAFAPVAHLAADTITPHARFQALAAWIAAAERAEQGLDPAGLQAAIASNKRDFDARFALAQGLFAGRDFTGAMDELLEIIMRDKTWNDQLARKTYVAILEIMTKPAQPAHGHGAGAPQAGGLQLSGPSTVAPADPLIDQYRRKLSMALF

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
10 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
11 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
12 2643221656 Pelomonas sp. Root405 Isolate Unclassified
13 2643221660 Methylibium sp. Root1272 Isolate Unclassified
14 2738541337 Pelomonas sp. BT06 Isolate Unclassified
15 2831864461 Roseateles noduli HZ7 Isolate Nodule
16 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
183 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
222 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
223 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
224 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
225 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
226 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
227 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
289 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
290 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
291 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
292 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
293 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
307 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
308 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
309 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
314 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
315 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
316 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
317 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
318 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
319 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 0.16
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.46
Nodule 0.33
Rhizoplane 1.81
Rhizosphere 72.04
Stem 0
Stem Tuber 0
Unclassified 10.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000273 3300002705 Bacteria 35022
2 JGI25157J39369_1000141 3300002741 Bacteria 61029
3 JGI25152J39213_1002392 3300002773 Bacteria 7183
4 JGI25150J39212_1010797 3300002774 Bacteria 1682
5 JGI25153J46596_10001676 3300003215 Bacteria 13140
6 JGI25153J46596_10003840 3300003215 Bacteria 8278
7 rootH1_10007856 3300003316 Bacteria 4332
8 rootH1_10007856 3300003323 Bacteria 7740
9 rootL2_10001066 3300003322 Bacteria 89444
10 rootL2_10027257 3300003322 Bacteria 4377
11 rootH1_10006249 3300003323 Bacteria 5699
12 rootH1_10024534 3300003323 Bacteria 1223
13 Ga0055533_1000008 3300003756 Bacteria 575861
14 Ga0055525_1001100 3300003759 Bacteria 6698
15 Ga0055535_1000271 3300003761 Bacteria 54319
16 Ga0055529_1000321 3300003763 Bacteria 54307
17 Ga0055526_1001240 3300003771 Bacteria 18300
18 Ga0055524_1000550 3300003775 Bacteria 28332
19 Ga0055524_1024981 3300003775 Bacteria 1881
20 Ga0055531_10000469 3300003794 Bacteria 37355
21 Ga0055531_10003310 3300003794 Bacteria 10312
22 Ga0055531_10012397 3300003794 Bacteria 4014
23 Ga0055543_1019323 3300004625 Bacteria 1262
24 Ga0065165_1000474 3300005262 Bacteria 62687
25 Ga0065165_1000621 3300005262 Bacteria 51523
26 Ga0065707_10087442 3300005295 Bacteria 5023
27 Ga0070676_10038439 3300005328 Bacteria 2765
28 Ga0070676_10125822 3300005328 Bacteria 1614
29 Ga0070683_100049963 3300005329 Bacteria 3869
30 Ga0070690_100013442 3300005330 Bacteria 4837
31 Ga0070690_100043749 3300005330 Bacteria 2841
32 Ga0070670_100001482 3300005331 Bacteria 18900
33 Ga0070670_100015553 3300005331 Bacteria 6535
34 Ga0070670_100038140 3300005331 Bacteria 4131
35 Ga0070670_100055150 3300005331 Bacteria 3411
36 Ga0070670_100492060 3300005331 Bacteria 1090
37 Ga0068869_100007008 3300005334 Bacteria 7178
38 Ga0068869_100032973 3300005334 Bacteria 3654
39 Ga0068869_100349062 3300005334 Bacteria 1206
40 Ga0070666_10015366 3300005335 Bacteria 4882
41 Ga0070666_10064003 3300005335 Bacteria 2494
42 Ga0070682_100100347 3300005337 Bacteria 1910
43 Ga0068868_100023935 3300005338 Bacteria 4628
44 Ga0068868_100044251 3300005338 Bacteria 3481
45 Ga0068868_100049639 3300005338 Bacteria 3293
46 Ga0068868_100122638 3300005338 Bacteria 2121
47 Ga0068868_100376041 3300005338 Bacteria 1221
48 Ga0070660_100131055 3300005339 Bacteria 2006
49 Ga0070660_100277679 3300005339 Bacteria 1370
50 Ga0070687_100005681 3300005343 Bacteria 5061
51 Ga0070661_100145250 3300005344 Bacteria 1790
52 Ga0070668_100011810 3300005347 Bacteria 6504
53 Ga0070668_100020579 3300005347 Bacteria 4981
54 Ga0070668_100376733 3300005347 Bacteria 1207
55 Ga0070669_100002640 3300005353 Bacteria 12947
56 Ga0070669_100005862 3300005353 Bacteria 8863
57 Ga0070675_100006197 3300005354 Bacteria 9173
58 Ga0070675_100015423 3300005354 Bacteria 6040
59 Ga0070675_100032317 3300005354 Bacteria 4235
60 Ga0070675_100062941 3300005354 Bacteria 3066
61 Ga0070675_100414501 3300005354 Bacteria 1204
62 Ga0070671_100020190 3300005355 Bacteria 5430
63 Ga0070671_100023028 3300005355 Bacteria 5091
64 Ga0070671_100042567 3300005355 Bacteria 3775
65 Ga0070671_100056944 3300005355 Bacteria 3252
66 Ga0070671_100111697 3300005355 Bacteria 2296
67 Ga0070671_100122107 3300005355 Bacteria 2192
68 Ga0070674_100017795 3300005356 Bacteria 4478
69 Ga0070674_100037861 3300005356 Bacteria 3247
70 Ga0070674_100154401 3300005356 Bacteria 1735
71 Ga0070673_100014291 3300005364 Bacteria 5522
72 Ga0070673_100018380 3300005364 Bacteria 4991
73 Ga0070673_100034883 3300005364 Bacteria 3811
74 Ga0070673_100075393 3300005364 Bacteria 2720
75 Ga0070673_100301129 3300005364 Bacteria 1411
76 Ga0070659_100172033 3300005366 Bacteria 1775
77 Ga0070667_100007594 3300005367 Bacteria 8991
78 Ga0070667_100076606 3300005367 Bacteria 2856
79 Ga0070667_100087141 3300005367 Bacteria 2680
80 Ga0070667_100169098 3300005367 Bacteria 1929
81 Ga0070667_100267146 3300005367 Bacteria 1533
82 Ga0070667_100305577 3300005367 Bacteria 1433
83 Ga0070667_100359261 3300005367 Bacteria 1320
84 Ga0070708_100109977 3300005445 Bacteria 2532
85 Ga0070678_100026426 3300005456 Bacteria 3924
86 Ga0070678_100042645 3300005456 Bacteria 3227
87 Ga0070678_100047132 3300005456 Bacteria 3095
88 Ga0070678_100104996 3300005456 Bacteria 2198
89 Ga0070678_100353794 3300005456 Bacteria 1263
90 Ga0070662_100283668 3300005457 Bacteria 1341
91 Ga0068867_100000605 3300005459 Bacteria 23775
92 Ga0068867_100000894 3300005459 Bacteria 20205
93 Ga0068867_100021133 3300005459 Bacteria 4643
94 Ga0068867_100254403 3300005459 Bacteria 1429
95 Ga0070685_10056448 3300005466 Bacteria 2283
96 Ga0070707_100232859 3300005468 Bacteria 1793
97 Ga0070698_100236216 3300005471 Bacteria 1761
98 Ga0068853_100033463 3300005539 Bacteria 4362
99 Ga0070672_100007091 3300005543 Bacteria 7582
100 Ga0070672_100010703 3300005543 Bacteria 6372
101 Ga0070672_100025245 3300005543 Bacteria 4405
102 Ga0070672_100029290 3300005543 Bacteria 4128
103 Ga0070672_100057538 3300005543 Bacteria 3052
104 Ga0070672_100261860 3300005543 Bacteria 1458
105 Ga0070665_100043957 3300005548 Bacteria 4487
106 Ga0070665_100144258 3300005548 Bacteria 2384
107 Ga0068855_100387551 3300005563 Bacteria 1533
108 Ga0068855_100603894 3300005563 Bacteria 1183
109 Ga0070664_100059502 3300005564 Bacteria 3250
110 Ga0068857_100028700 3300005577 Bacteria 4909
111 Ga0068854_100047028 3300005578 Bacteria 3074
112 Ga0068854_100122843 3300005578 Bacteria 1974
113 Ga0068854_100292743 3300005578 Bacteria 1314
114 Ga0068856_100000135 3300005614 Bacteria 74419
115 Ga0068856_100363585 3300005614 Bacteria 1466
116 Ga0070702_100142839 3300005615 Bacteria 1527
117 Ga0068852_100008007 3300005616 Bacteria 7750
118 Ga0068852_100056475 3300005616 Bacteria 3393
119 Ga0068852_100096238 3300005616 Bacteria 2661
120 Ga0068852_100215107 3300005616 Bacteria 1825
121 Ga0068859_100009696 3300005617 Bacteria 9722
122 Ga0068859_100028192 3300005617 Bacteria 5630
123 Ga0068859_100032738 3300005617 Bacteria 5222
124 Ga0068859_100217279 3300005617 Bacteria 1999
125 Ga0068859_100246619 3300005617 Bacteria 1876
126 Ga0068859_100487773 3300005617 Bacteria 1327
127 Ga0068864_100000417 3300005618 Bacteria 36778
128 Ga0068864_100030569 3300005618 Bacteria 4565
129 Ga0068864_100039478 3300005618 Bacteria 4035
130 Ga0068864_100055221 3300005618 Bacteria 3428
131 Ga0068861_100019088 3300005719 Bacteria 4895
132 Ga0068851_10098115 3300005834 Bacteria 1551
133 Ga0068863_100002056 3300005841 Bacteria 19934
134 Ga0068863_100067684 3300005841 Bacteria 3378
135 Ga0068863_100085003 3300005841 Bacteria 2998
136 Ga0068863_100238659 3300005841 Bacteria 1754
137 Ga0068858_100000623 3300005842 Bacteria 36873
138 Ga0068858_100003411 3300005842 Bacteria 15804
139 Ga0068860_100000384 3300005843 Bacteria 57893
140 Ga0068860_100022528 3300005843 Bacteria 6092
141 Ga0068860_100159526 3300005843 Bacteria 2174
142 Ga0068860_100189057 3300005843 Bacteria 1992
143 Ga0068862_100037567 3300005844 Bacteria 4104
144 Ga0068862_100052355 3300005844 Bacteria 3492
145 Ga0068862_100119832 3300005844 Bacteria 2318
146 Ga0075364_10188644 3300006051 Bacteria 1396
147 Ga0075362_10014222 3300006177 Bacteria 3207
148 Ga0075366_10037604 3300006195 Bacteria 2858
149 Ga0097621_100017545 3300006237 Bacteria 5438
150 Ga0097621_100060883 3300006237 Bacteria 3095
151 Ga0075370_10002303 3300006353 Bacteria 8807
152 Ga0075370_10011470 3300006353 Bacteria 4658
153 Ga0075370_10012670 3300006353 Bacteria 4463
154 Ga0075370_10031800 3300006353 Bacteria 2947
155 Ga0075370_10063470 3300006353 Bacteria 2106
156 Ga0068871_100088309 3300006358 Bacteria 2579
157 Ga0068871_100241557 3300006358 Bacteria 1570
158 Ga0068871_100341752 3300006358 Bacteria 1322
159 Ga0068865_100002745 3300006881 Bacteria 10461
160 Ga0068865_100015159 3300006881 Bacteria 4911
161 Ga0068865_100299383 3300006881 Bacteria 1287
162 Ga0097620_100009697 3300006931 Bacteria 9722
163 Ga0097620_100028192 3300006931 Bacteria 5630
164 Ga0097620_100032737 3300006931 Bacteria 5222
165 Ga0097620_100217284 3300006931 Bacteria 1999
166 Ga0097620_100246607 3300006931 Bacteria 1876
167 Ga0097620_100487784 3300006931 Bacteria 1327
168 Ga0099823_1000005 3300006944 Bacteria 139631
169 Ga0105240_10021539 3300009093 Bacteria 8571
170 Ga0105240_10075146 3300009093 Bacteria 4168
171 Ga0105240_10588401 3300009093 Bacteria 1227
172 Ga0105245_10036547 3300009098 Bacteria 4363
173 Ga0114129_10307047 3300009147 Bacteria 2113
174 Ga0105243_10041667 3300009148 Bacteria 3590
175 Ga0105248_10001355 3300009177 Bacteria 27299
176 Ga0105248_10135531 3300009177 Bacteria 2777
177 Ga0105248_10277354 3300009177 Bacteria 1887
178 Ga0105237_10040414 3300009545 Bacteria 4703
179 Ga0105238_10371942 3300009551 Bacteria 1419
180 Ga0105249_10009800 3300009553 Bacteria 8395
181 Ga0105249_10017117 3300009553 Bacteria 6433
182 Ga0105249_10143456 3300009553 Bacteria 2292
183 Ga0105239_10032539 3300010375 Bacteria 5730
184 Ga0105246_10038570 3300011119 Bacteria 3214
185 Ga0105246_10066071 3300011119 Bacteria 2531
186 Ga0157319_1000005 3300012497 Bacteria 372810
187 Ga0157371_10119517 3300013102 Bacteria 1873
188 Ga0157369_10267036 3300013105 Bacteria 1784
189 Ga0157374_10045256 3300013296 Bacteria 4073
190 Ga0157378_10047529 3300013297 Bacteria 3816
191 Ga0157378_10294993 3300013297 Bacteria 1567
192 Ga0163162_10001355 3300013306 Bacteria 22806
193 Ga0163162_10253456 3300013306 Bacteria 1892
194 Ga0163162_10437556 3300013306 Bacteria 1440
195 Ga0157372_10140135 3300013307 Bacteria 2785
196 Ga0157375_10002767 3300013308 Bacteria 15170
197 Ga0157375_10040833 3300013308 Bacteria 4475
198 Ga0157375_10228383 3300013308 Bacteria 2020
199 Ga0157375_10342988 3300013308 Bacteria 1659
200 Ga0163163_10003807 3300014325 Bacteria 12851
201 Ga0163163_10108170 3300014325 Bacteria 2807
202 Ga0157380_10000770 3300014326 Bacteria 20027
203 Ga0157380_10012894 3300014326 Bacteria 6076
204 Ga0157377_10092392 3300014745 Bacteria 1789
205 Ga0157379_10004392 3300014968 Bacteria 12073
206 Ga0157379_10032133 3300014968 Bacteria 4678
207 Ga0157379_10193293 3300014968 Bacteria 1839
208 Ga0157379_10254376 3300014968 Bacteria 1595
209 Ga0157376_10025992 3300014969 Bacteria 4620
210 Ga0157376_10121960 3300014969 Bacteria 2312
211 Ga0163161_10021715 3300017792 Bacteria 4512
212 Ga0163161_10117770 3300017792 Bacteria 1993
213 Ga0163161_10214086 3300017792 Bacteria 1489
214 Ga0213872_10000033 3300021361 Bacteria 135667
215 Ga0213872_10000258 3300021361 Bacteria 46050
216 Ga0213872_10001003 3300021361 Bacteria 19713
217 Ga0213872_10004509 3300021361 Bacteria 7376
218 Ga0213872_10012188 3300021361 Bacteria 4053
219 Ga0213872_10021274 3300021361 Bacteria 2987
220 Ga0209674_100015 3300025226 Bacteria 697299
221 Ga0209563_100017 3300025230 Bacteria 796449
222 Ga0207427_100444 3300025231 Bacteria 22994
223 Ga0209258_100025 3300025242 Bacteria 534777
224 Ga0209258_100726 3300025242 Bacteria 21958
225 Ga0207425_1000570 3300025245 Bacteria 21658
226 Ga0209646_1000438 3300025246 Bacteria 22604
227 Ga0209026_1000028 3300025250 Bacteria 341399
228 Ga0209677_100037 3300025253 Bacteria 286702
229 Ga0209677_100113 3300025253 Bacteria 84174
230 Ga0209148_1002792 3300025254 Bacteria 5458
231 Ga0209759_1000021 3300025256 Bacteria 341399
232 Ga0209759_1001016 3300025256 Bacteria 18856
233 Ga0209759_1005783 3300025256 Bacteria 4254
234 Ga0209129_1000158 3300025258 Bacteria 103711
235 Ga0209455_1000166 3300025272 Bacteria 113101
236 Ga0209673_1008551 3300025273 Bacteria 4544
237 Ga0209673_1008988 3300025273 Bacteria 4388
238 Ga0209673_1023905 3300025273 Bacteria 2067
239 Ga0209564_1000021 3300025295 Bacteria 571316
240 Ga0209564_1000282 3300025295 Bacteria 103837
241 Ga0209758_1000910 3300025297 Bacteria 40059
242 Ga0209050_1000223 3300025298 Bacteria 125465
243 Ga0209050_1001406 3300025298 Bacteria 26103
244 Ga0209050_1002179 3300025298 Bacteria 17697
245 Ga0209256_1000309 3300025299 Bacteria 85294
246 Ga0209256_1001207 3300025299 Bacteria 28954
247 Ga0209051_1000621 3300025303 Bacteria 40763
248 Ga0209051_1023640 3300025303 Bacteria 2549
249 Ga0209051_1026424 3300025303 Bacteria 2340
250 Ga0209257_1000016 3300025304 Bacteria 908015
251 Ga0209257_1000981 3300025304 Bacteria 38736
252 Ga0209257_1003138 3300025304 Bacteria 14743
253 Ga0207697_10014915 3300025315 Bacteria 3217
254 Ga0207697_10077095 3300025315 Bacteria 1401
255 Ga0207682_10013002 3300025893 Bacteria 3245
256 Ga0207682_10051761 3300025893 Bacteria 1701
257 Ga0207682_10115245 3300025893 Bacteria 1187
258 Ga0207680_10031399 3300025903 Bacteria 3008
259 Ga0207645_10026636 3300025907 Bacteria 3735
260 Ga0207645_10064121 3300025907 Bacteria 2348
261 Ga0207645_10117738 3300025907 Bacteria 1723
262 Ga0207645_10161951 3300025907 Bacteria 1464
263 Ga0207705_10057983 3300025909 Bacteria 2794
264 Ga0207705_10127801 3300025909 Bacteria 1890
265 Ga0207695_10007014 3300025913 Bacteria 14454
266 Ga0207662_10013189 3300025918 Bacteria 4619
267 Ga0207657_10063014 3300025919 Bacteria 3172
268 Ga0207681_10003110 3300025923 Bacteria 10434
269 Ga0207681_10009514 3300025923 Bacteria 5939
270 Ga0207681_10033819 3300025923 Bacteria 3356
271 Ga0207681_10044386 3300025923 Bacteria 2978
272 Ga0207650_10003543 3300025925 Bacteria 10711
273 Ga0207650_10003734 3300025925 Bacteria 10416
274 Ga0207650_10026247 3300025925 Bacteria 4154
275 Ga0207650_10056215 3300025925 Bacteria 2923
276 Ga0207650_10197233 3300025925 Bacteria 1611
277 Ga0207659_10003530 3300025926 Bacteria 9403
278 Ga0207659_10035289 3300025926 Bacteria 3455
279 Ga0207659_10231274 3300025926 Bacteria 1491
280 Ga0207687_10078434 3300025927 Bacteria 2378
281 Ga0207644_10004378 3300025931 Bacteria 9165
282 Ga0207644_10017792 3300025931 Bacteria 4806
283 Ga0207644_10030001 3300025931 Bacteria 3776
284 Ga0207644_10049302 3300025931 Bacteria 3014
285 Ga0207644_10077953 3300025931 Bacteria 2441
286 Ga0207644_10158005 3300025931 Bacteria 1760
287 Ga0207690_10009309 3300025932 Bacteria 5835
288 Ga0207706_10022227 3300025933 Bacteria 5692
289 Ga0207709_10018575 3300025935 Bacteria 3895
290 Ga0207669_10003005 3300025937 Bacteria 7255
291 Ga0207669_10007396 3300025937 Bacteria 5076
292 Ga0207669_10161409 3300025937 Bacteria 1583
293 Ga0207704_10005637 3300025938 Bacteria 5780
294 Ga0207665_10198954 3300025939 Bacteria 1459
295 Ga0207691_10001767 3300025940 Bacteria 21287
296 Ga0207691_10030328 3300025940 Bacteria 5055
297 Ga0207691_10108313 3300025940 Bacteria 2473
298 Ga0207691_10129705 3300025940 Bacteria 2228
299 Ga0207691_10139772 3300025940 Bacteria 2135
300 Ga0207691_10354139 3300025940 Bacteria 1256
301 Ga0207711_10044865 3300025941 Bacteria 3775
302 Ga0207711_10115954 3300025941 Bacteria 2387
303 Ga0207689_10012906 3300025942 Bacteria 7135
304 Ga0207689_10030198 3300025942 Bacteria 4516
305 Ga0207689_10037320 3300025942 Bacteria 4030
306 Ga0207661_10206010 3300025944 Bacteria 1731
307 Ga0207679_10128306 3300025945 Bacteria 2030
308 Ga0207667_10003517 3300025949 Bacteria 19368
309 Ga0207651_10006968 3300025960 Bacteria 5982
310 Ga0207651_10051694 3300025960 Bacteria 2797
311 Ga0207651_10173828 3300025960 Bacteria 1701
312 Ga0207712_10009930 3300025961 Bacteria 6033
313 Ga0207712_10036308 3300025961 Bacteria 3355
314 Ga0207668_10004050 3300025972 Bacteria 8618
315 Ga0207668_10012878 3300025972 Bacteria 5133
316 Ga0207640_10054762 3300025981 Bacteria 2609
317 Ga0207640_10252651 3300025981 Bacteria 1369
318 Ga0207658_10041491 3300025986 Bacteria 3332
319 Ga0207658_10046347 3300025986 Bacteria 3174
320 Ga0207658_10053839 3300025986 Bacteria 2975
321 Ga0207658_10136908 3300025986 Bacteria 1976
322 Ga0207677_10001217 3300026023 Bacteria 13897
323 Ga0207677_10314377 3300026023 Bacteria 1299
324 Ga0207703_10001480 3300026035 Bacteria 21402
325 Ga0207703_10003280 3300026035 Bacteria 13574
326 Ga0207703_10041044 3300026035 Bacteria 3706
327 Ga0207639_10384146 3300026041 Bacteria 1262
328 Ga0207678_10075599 3300026067 Bacteria 2885
329 Ga0207708_10071425 3300026075 Bacteria 2659
330 Ga0207702_10001523 3300026078 Bacteria 22929
331 Ga0207641_10001533 3300026088 Bacteria 22637
332 Ga0207641_10084659 3300026088 Bacteria 2761
333 Ga0207641_10122414 3300026088 Bacteria 2323
334 Ga0207641_10211186 3300026088 Bacteria 1795
335 Ga0207648_10002852 3300026089 Bacteria 18291
336 Ga0207648_10004823 3300026089 Bacteria 13753
337 Ga0207648_10309506 3300026089 Bacteria 1418
338 Ga0207676_10001762 3300026095 Bacteria 15863
339 Ga0207676_10016482 3300026095 Bacteria 5351
340 Ga0207676_10027619 3300026095 Bacteria 4229
341 Ga0207676_10176523 3300026095 Bacteria 1866
342 Ga0207676_10326529 3300026095 Bacteria 1410
343 Ga0207674_10016268 3300026116 Bacteria 8147
344 Ga0207675_100022931 3300026118 Bacteria 5806
345 Ga0207675_100025649 3300026118 Bacteria 5486
346 Ga0207675_100029708 3300026118 Bacteria 5090
347 Ga0207683_10035185 3300026121 Bacteria 4356
348 Ga0207683_10051334 3300026121 Bacteria 3613
349 Ga0207683_10080447 3300026121 Bacteria 2891
350 Ga0207683_10209698 3300026121 Bacteria 1773
351 Ga0207683_10437389 3300026121 Bacteria 1205
352 Ga0207698_10090138 3300026142 Bacteria 2507
353 Ga0207698_10119948 3300026142 Bacteria 2224
354 Ga0207698_10120403 3300026142 Bacteria 2220
355 Ga0207698_10413613 3300026142 Bacteria 1292
356 Ga0209371_1010421 3300027312 Bacteria 2859
357 Ga0268266_10030341 3300028379 Bacteria 4593
358 Ga0268266_10496090 3300028379 Bacteria 1165
359 Ga0268265_10003306 3300028380 Bacteria 11674
360 Ga0268265_10014091 3300028380 Bacteria 5449
361 Ga0268265_10027800 3300028380 Bacteria 4041
362 Ga0268265_10397931 3300028380 Bacteria 1272
363 Ga0268264_10001034 3300028381 Bacteria 27952
364 Ga0268264_10019856 3300028381 Bacteria 5490
365 Ga0265336_10000274 3300028666 Bacteria 36140
366 Ga0307517_10004429 3300028786 Bacteria 21580
367 Ga0307517_10058934 3300028786 Bacteria 3687
368 Ga0307517_10072069 3300028786 Bacteria 3085
369 Ga0307517_10149179 3300028786 Bacteria 1611
370 Ga0307515_10000139 3300028794 Bacteria 173074
371 Ga0307515_10005664 3300028794 Bacteria 25227
372 Ga0307515_10005936 3300028794 Bacteria 24621
373 Ga0307515_10007880 3300028794 Bacteria 20929
374 Ga0307515_10011641 3300028794 Bacteria 16669
375 Ga0307515_10117134 3300028794 Bacteria 3052
376 Ga0268256_1013843 3300030500 Bacteria 2421
377 Ga0307512_10010416 3300030522 Bacteria 8867
378 Ga0265328_10037268 3300031239 Bacteria 1796
379 Ga0265327_10000080 3300031251 Bacteria 206086
380 Ga0265327_10000925 3300031251 Bacteria 42948
381 Ga0265316_10000176 3300031344 Bacteria 72297
382 Ga0307513_10005821 3300031456 Bacteria 16188
383 Ga0307513_10046962 3300031456 Bacteria 4702
384 Ga0307513_10078619 3300031456 Bacteria 3411
385 Ga0307513_10084122 3300031456 Bacteria 3269
386 Ga0307513_10139805 3300031456 Bacteria 2350
387 Ga0307513_10361315 3300031456 Bacteria 1197
388 Ga0307509_10000698 3300031507 Bacteria 57430
389 Ga0307509_10012484 3300031507 Bacteria 10158
390 Ga0307509_10020734 3300031507 Bacteria 7456
391 Ga0307509_10024647 3300031507 Bacteria 6733
392 Ga0307509_10039083 3300031507 Bacteria 5172
393 Ga0307408_100000012 3300031548 Bacteria 408153
394 Ga0307408_100021576 3300031548 Bacteria 4361
395 Ga0307408_100032641 3300031548 Bacteria 3631
396 Ga0307408_100111052 3300031548 Bacteria 2106
397 Ga0307408_100140014 3300031548 Bacteria 1898
398 Ga0307508_10000144 3300031616 Bacteria 84437
399 Ga0307508_10000504 3300031616 Bacteria 46711
400 Ga0307508_10010113 3300031616 Bacteria 8641
401 Ga0307514_10000339 3300031649 Bacteria 111130
402 Ga0307514_10002566 3300031649 Bacteria 18663
403 Ga0307514_10088726 3300031649 Bacteria 2262
404 Ga0307514_10125861 3300031649 Bacteria 1776
405 Ga0307514_10207005 3300031649 Bacteria 1224
406 Ga0307516_10000107 3300031730 Bacteria 95288
407 Ga0307516_10006214 3300031730 Bacteria 14051
408 Ga0307516_10053910 3300031730 Bacteria 3931
409 Ga0307405_10005943 3300031731 Bacteria 5954
410 Ga0307405_10012518 3300031731 Bacteria 4495
411 Ga0307405_10016930 3300031731 Bacteria 3989
412 Ga0307413_10019690 3300031824 Bacteria 3572
413 Ga0307413_10024211 3300031824 Bacteria 3306
414 Ga0307410_10044932 3300031852 Bacteria 2937
415 Ga0307410_10298618 3300031852 Bacteria 1270
416 Ga0307406_10000570 3300031901 Bacteria 21267
417 Ga0307406_10031616 3300031901 Bacteria 3224
418 Ga0307406_10041963 3300031901 Bacteria 2854
419 Ga0307407_10049525 3300031903 Bacteria 2398
420 Ga0307412_10005099 3300031911 Bacteria 7347
421 Ga0307412_10043869 3300031911 Bacteria 2915
422 Ga0307409_100001339 3300031995 Bacteria 11962
423 Ga0307409_100002252 3300031995 Bacteria 9977
424 Ga0307409_100003361 3300031995 Bacteria 8671
425 Ga0307416_100004764 3300032002 Bacteria 8238
426 Ga0307416_100019414 3300032002 Bacteria 4818
427 Ga0307416_100019721 3300032002 Bacteria 4789
428 Ga0307414_10035032 3300032004 Bacteria 3336
429 Ga0307414_10287164 3300032004 Bacteria 1385
430 Ga0307411_10002089 3300032005 Bacteria 8612
431 Ga0307411_10011812 3300032005 Bacteria 4733
432 Ga0307415_100000470 3300032126 Bacteria 17433
433 Ga0307507_10027415 3300033179 Bacteria 6106
434 Ga0307510_10000426 3300033180 Bacteria 40466
435 Ga0307510_10033683 3300033180 Bacteria 5750
436 Ga0373959_0004852 3300034820 Bacteria 2186
437 Ga0373940_0005138 3300035088 Bacteria 2819
438 Ga0373936_0106403 3300035113 Bacteria 1188
439 Ga0373939_0000047 3300035114 Bacteria 43790
440 Ga0373960_0001152 3300035121 Bacteria 5741
441 Ga0373955_0041338 3300035172 Bacteria 2471
442 Ga0373961_0034780 3300035241 Bacteria 1426
443 Ga0373931_0000579 3300035691 Bacteria 15108
444 Ga0373947_0031882 3300035725 Bacteria 3104
445 Ga0395898_0028823 3300037466 Bacteria 5565
446 Ga0395905_0000504 3300037471 Bacteria 53598
447 Ga0395905_0005103 3300037471 Bacteria 13496
448 Ga0395905_0005387 3300037471 Bacteria 13076
449 Ga0395905_0034159 3300037471 Bacteria 4774
450 Ga0395901_0006507 3300038443 Bacteria 11821
451 Ga0436361_0027317 3300039447 Bacteria 79578
452 Ga0436361_0156562 3300039447 Bacteria 6162
453 Ga0436361_0264437 3300039447 Bacteria 60444
454 Ga0436361_0272384 3300039447 Bacteria 13210
455 Ga0436361_0301682 3300039447 Bacteria 5184
456 Ga0436361_0430065 3300039447 Bacteria 23088
457 Ga0439437_003678 3300042000 Bacteria 1657
458 Ga0439449_0034397 3300042007 Bacteria 1887
459 Ga0450917_002083 3300042120 Bacteria 1425
460 Ga0450888_000258 3300042126 Bacteria 4916
461 Ga0450890_000482 3300042127 Bacteria 5846
462 Ga0450894_010305 3300042131 Bacteria 1213
463 Ga0450900_004838 3300042136 Bacteria 1567
464 Ga0450889_000025 3300042144 Bacteria 12924
465 Ga0439444_0003978 3300042437 Bacteria 2118
466 Ga0439459_0000990 3300042438 Bacteria 4030
467 Ga0450901_008153 3300042533 Bacteria 1078
468 Ga0451577_0018745 3300042876 Bacteria 6367
469 Ga0466969_0000018 3300044656 Bacteria 102911
470 Ga0466969_0020123 3300044656 Bacteria 3459
471 Ga0466972_0000630 3300044658 Bacteria 17098
472 Ga0466965_0031086 3300044683 Bacteria 2602
473 Ga0466966_0038581 3300044684 Bacteria 3078
474 Ga0466961_0015398 3300044693 Bacteria 4910
475 Ga0466961_0016802 3300044693 Bacteria 4704
476 Ga0466963_0017494 3300044694 Bacteria 4469
477 Ga0466964_0003947 3300044706 Bacteria 5451
478 Ga0453684_0008286 3300044712 Bacteria 18722
479 Ga0453684_0026097 3300044712 Bacteria 8456
480 Ga0453684_0249527 3300044712 Bacteria 2039
481 Ga0453684_0280678 3300044712 Bacteria 1900
482 Ga0466968_0092433 3300044735 Bacteria 1343
483 Ga0466970_0095863 3300044765 Bacteria 1613
484 Ga0466960_0088834 3300044901 Bacteria 1571
485 Ga0466959_0031472 3300045049 Bacteria 3924
486 Ga0466959_0044206 3300045049 Bacteria 3282
487 Ga0451576_0065287 3300045051 Bacteria 3790
488 Ga0451576_0085485 3300045051 Bacteria 3281
489 Ga0466958_0009242 3300045836 Bacteria 5487
490 Ga0466967_0104287 3300045976 Bacteria 2595
491 Ga0495592_0000499 3300046454 Bacteria 28648
492 Ga0495629_0009172 3300046459 Bacteria 7243
493 Ga0495641_0136091 3300046461 Bacteria 1097
494 Ga0495650_0015475 3300046471 Bacteria 3910
495 Ga0495580_0110869 3300046472 Bacteria 1906
496 Ga0495582_0140188 3300046473 Bacteria 1370
497 Ga0495583_0000428 3300046506 Bacteria 63526
498 Ga0495606_0000821 3300046507 Bacteria 47099
499 Ga0495610_0077809 3300046512 Bacteria 1531
500 Ga0495632_0002352 3300046519 Bacteria 14499
501 Ga0495643_0062508 3300046522 Bacteria 1971
502 Ga0495652_0086062 3300046529 Bacteria 2582
503 Ga0495640_0137503 3300046533 Bacteria 1577
504 Ga0495621_0100844 3300046539 Bacteria 1098
505 Ga0495645_0037182 3300046543 Bacteria 3548
506 Ga0495667_0091710 3300046559 Bacteria 1968
507 Ga0495668_0021362 3300046616 Bacteria 3713
508 Ga0495668_0036997 3300046616 Bacteria 2733
509 Ga0495625_0000827 3300046660 Bacteria 42621
510 Ga0495625_0025677 3300046660 Bacteria 4465
511 Ga0495624_0060379 3300046690 Bacteria 2377
512 Ga0495671_0099716 3300046692 Bacteria 1420
513 Ga0495649_0003008 3300046694 Bacteria 11564
514 Ga0495589_0015574 3300046794 Bacteria 3910
515 Ga0495676_0018846 3300047321 Bacteria 6083
516 Ga0495684_0054704 3300047471 Bacteria 3044
517 Ga0495686_0023279 3300047472 Bacteria 4087
518 Ga0495686_0068182 3300047472 Bacteria 2195
519 Ga0495602_0099403 3300048088 Bacteria 2392
520 Ga0496106_0274144 3300048909 Bacteria 1351
521 Ga0496108_0018647 3300048911 Bacteria 5685
522 Ga0496108_0167965 3300048911 Bacteria 1897
523 Ga0496108_0187634 3300048911 Bacteria 1791
524 Ga0496109_0005617 3300048912 Bacteria 10495
525 Ga0496109_0117465 3300048912 Bacteria 2476
526 Ga0496109_0192421 3300048912 Bacteria 1917
527 Ga0496109_0594894 3300048912 Bacteria 1042
528 Ga0496110_0079834 3300048913 Bacteria 2914
529 Ga0496112_0009640 3300048915 Bacteria 8713
530 Ga0496115_0484767 3300048918 Bacteria 995
531 Ga0496121_0003335 3300048924 Bacteria 23043
532 Ga0496123_0196881 3300048926 Bacteria 1037
533 Ga0496124_0000733 3300048927 Bacteria 53604
534 Ga0496124_0184562 3300048927 Bacteria 1602
535 Ga0496125_0017746 3300048928 Bacteria 6774
536 Ga0501310_002947 3300049130 Bacteria 1646
537 Ga0501032_0126057 3300049569 Bacteria 1691
538 Ga0501043_0000058 3300049579 Bacteria 102030
539 Ga0501046_0000051 3300049580 Bacteria 133545
540 Ga0501047_0000003 3300049581 Bacteria 508375
541 Ga0501047_0139862 3300049581 Bacteria 2300
542 Ga0501048_0001358 3300049582 Bacteria 18540
543 Ga0501222_002025 3300049662 Bacteria 2805
544 Ga0501227_026095 3300049665 Bacteria 1375
545 Ga0501249_028108 3300049679 Bacteria 1246
546 Ga0501257_036739 3300049686 Bacteria 1194
547 Ga0501221_001011 3300049704 Bacteria 4615
548 Ga0501272_001114 3300049769 Bacteria 2483
549 Ga0501044_0103166 3300049823 Bacteria 2867
550 Ga0501045_0015123 3300049824 Bacteria 5477
551 nmdc:mga03683_21281_c1 3300050489 Bacteria 2497
552 nmdc:mga00v17_66258_c1 3300050491 Bacteria 2229
553 nmdc:mga0k408_21949_c1 3300050493 Bacteria 3591
554 nmdc:mga0k408_53141_c1 3300050493 Bacteria 2347
555 nmdc:mga0k408_63486_c1 3300050493 Bacteria 2149
556 nmdc:mga06z11_286471_c1 3300050494 Bacteria 977
557 nmdc:mga07m45_2998_c2 3300050496 Bacteria 6530
558 nmdc:mga07m45_3233_c1 3300050496 Bacteria 7824
559 nmdc:mga07m45_4373_c1 3300050496 Bacteria 6914
560 nmdc:mga07m45_51896_c1 3300050496 Bacteria 2314
561 nmdc:mga07m45_54858_c1 3300050496 Bacteria 2252
562 nmdc:mga07m45_56544_c1 3300050496 Bacteria 2218
563 nmdc:mga07m45_58492_c1 3300050496 Bacteria 2181
564 Ga0495601_0307002 3300053077 Bacteria 1033
565 Ga0500635_0000070 3300053080 Bacteria 67480
566 Ga0500635_0052561 3300053080 Bacteria 1399
567 Ga0500578_0000417 3300053086 Bacteria 52045
568 Ga0500578_0008111 3300053086 Bacteria 6880
569 Ga0500644_0003385 3300053088 Bacteria 3942
570 Ga0500651_0081697 3300053093 Bacteria 2001
571 Ga0500651_0266064 3300053093 Bacteria 992
572 Ga0500650_0022212 3300053098 Bacteria 2806
573 Ga0500562_015491 3300053108 Bacteria 1956
574 Ga0500652_001084 3300053131 Bacteria 8794
575 Ga0500652_035357 3300053131 Bacteria 1984
576 Ga0500652_089641 3300053131 Bacteria 1284
577 Ga0500655_010765 3300053133 Bacteria 1653
578 Ga0500655_010982 3300053133 Bacteria 1637
579 Ga0500658_0128773 3300053134 Bacteria 1127
580 Ga0500559_0000097 3300053136 Bacteria 70124
581 Ga0500568_0006967 3300053139 Bacteria 5601
582 Ga0500568_0007565 3300053139 Bacteria 5316
583 Ga0500577_0030338 3300053142 Bacteria 1881
584 Ga0500604_0044551 3300053151 Bacteria 1351
585 Ga0500604_0066152 3300053151 Bacteria 1144
586 Ga0500619_005187 3300053154 Bacteria 2879
587 Ga0500622_0000198 3300053156 Bacteria 63633
588 Ga0500622_0005699 3300053156 Bacteria 7404
589 Ga0500622_0008142 3300053156 Bacteria 5890
590 Ga0500636_0032479 3300053177 Bacteria 3089
591 Ga0500587_000996 3300053739 Bacteria 3825
592 Ga0500661_016932 3300055283 Bacteria 1302
593 Ga0466962_0029907 3300061719 Bacteria 2607

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10006249 rootH1_100062494 229
2 3300053093 Ga0500651_0081697 Ga0500651_0081697_23_808 234
3 3300048926 Ga0496123_0196881 Ga0496123_0196881_29_883 249
4 3300031548 Ga0307408_100032641 Ga0307408_1000326415 251
5 3300031731 Ga0307405_10005943 Ga0307405_100059437 251
6 3300031824 Ga0307413_10024211 Ga0307413_100242112 251
7 3300031852 Ga0307410_10044932 Ga0307410_100449322 251
8 3300031901 Ga0307406_10000570 Ga0307406_1000057010 251
9 3300031911 Ga0307412_10043869 Ga0307412_100438692 251
10 3300031995 Ga0307409_100003361 Ga0307409_1000033612 251
11 3300032002 Ga0307416_100004764 Ga0307416_1000047643 251
12 3300032005 Ga0307411_10002089 Ga0307411_100020893 251
13 3300032126 Ga0307415_100000470 Ga0307415_10000047014 251
14 3300046539 Ga0495621_0100844 Ga0495621_0100844_32_856 252
15 3300048912 Ga0496109_0594894 Ga0496109_0594894_161_991 253
16 3300053156 Ga0500622_0005699 Ga0500622_0005699_28_873 253
17 3300048918 Ga0496115_0484767 Ga0496115_0484767_106_963 261
18 3300003794 Ga0055531_10000469 Ga0055531_100004691 270
19 3300025298 Ga0209050_1002179 Ga0209050_100217920 270
20 3300025303 Ga0209051_1026424 Ga0209051_10264243 270
21 3300025304 Ga0209257_1000016 Ga0209257_1000016150 270
22 3300005468 Ga0070707_100232859 Ga0070707_1002328592 271
23 3300005471 Ga0070698_100236216 Ga0070698_1002362161 271
24 3300035725 Ga0373947_0031882 Ga0373947_0031882_298_1239 271
25 3300048912 Ga0496109_0005617 Ga0496109_0005617_3945_4925 273
26 3300048913 Ga0496110_0079834 Ga0496110_0079834_673_1653 273
27 3300042131 Ga0450894_010305 Ga0450894_010305_198_1139 274
28 3300046461 Ga0495641_0136091 Ga0495641_0136091_85_1023 275
29 3300005328 Ga0070676_10038439 Ga0070676_100384393 276
30 3300005330 Ga0070690_100043749 Ga0070690_1000437493 276
31 3300005334 Ga0068869_100032973 Ga0068869_1000329732 276
32 3300005335 Ga0070666_10015366 Ga0070666_100153663 276
33 3300005338 Ga0068868_100023935 Ga0068868_1000239354 276
34 3300005354 Ga0070675_100062941 Ga0070675_1000629413 276
35 3300005355 Ga0070671_100056944 Ga0070671_1000569442 276
36 3300005364 Ga0070673_100075393 Ga0070673_1000753933 276
37 3300005456 Ga0070678_100047132 Ga0070678_1000471323 276
38 3300005466 Ga0070685_10056448 Ga0070685_100564482 276
39 3300005543 Ga0070672_100261860 Ga0070672_1002618602 276
40 3300005615 Ga0070702_100142839 Ga0070702_1001428392 276
41 3300005616 Ga0068852_100008007 Ga0068852_1000080072 276
42 3300005617 Ga0068859_100009696 Ga0068859_10000969610 276
43 3300005618 Ga0068864_100000417 Ga0068864_10000041710 276
44 3300005834 Ga0068851_10098115 Ga0068851_100981152 276
45 3300005841 Ga0068863_100067684 Ga0068863_1000676842 276
46 3300005842 Ga0068858_100003411 Ga0068858_10000341113 276
47 3300006237 Ga0097621_100060883 Ga0097621_1000608832 276
48 3300006931 Ga0097620_100009697 Ga0097620_10000969710 276
49 3300009177 Ga0105248_10135531 Ga0105248_101355313 276
50 3300013296 Ga0157374_10045256 Ga0157374_100452563 276
51 3300013308 Ga0157375_10342988 Ga0157375_103429882 276
52 3300014325 Ga0163163_10003807 Ga0163163_1000380712 276
53 3300014745 Ga0157377_10092392 Ga0157377_100923922 276
54 3300014968 Ga0157379_10004392 Ga0157379_1000439211 276
55 3300014969 Ga0157376_10121960 Ga0157376_101219601 276
56 3300017792 Ga0163161_10214086 Ga0163161_102140862 276
57 3300025903 Ga0207680_10031399 Ga0207680_100313993 276
58 3300025907 Ga0207645_10161951 Ga0207645_101619512 276
59 3300025926 Ga0207659_10035289 Ga0207659_100352893 276
60 3300025931 Ga0207644_10004378 Ga0207644_100043788 276
61 3300025941 Ga0207711_10044865 Ga0207711_100448653 276
62 3300025942 Ga0207689_10030198 Ga0207689_100301983 276
63 3300025960 Ga0207651_10051694 Ga0207651_100516943 276
64 3300025986 Ga0207658_10046347 Ga0207658_100463473 276
65 3300026023 Ga0207677_10001217 Ga0207677_1000121714 276
66 3300026035 Ga0207703_10003280 Ga0207703_100032803 276
67 3300026088 Ga0207641_10122414 Ga0207641_101224142 276
68 3300026095 Ga0207676_10001762 Ga0207676_1000176213 276
69 3300026121 Ga0207683_10035185 Ga0207683_100351853 276
70 3300026142 Ga0207698_10090138 Ga0207698_100901383 276
71 3300048911 Ga0496108_0187634 Ga0496108_0187634_592_1542 276
72 3300048912 Ga0496109_0117465 Ga0496109_0117465_793_1743 276
73 3300044712 Ga0453684_0026097 Ga0453684_0026097_617_1567 277
74 3300021361 Ga0213872_10000258 Ga0213872_1000025830 278
75 3300039447 Ga0436361_0430065 Ga0436361_0430065_21336_22286 278
76 3300044658 Ga0466972_0000630 Ga0466972_0000630_294_1238 280
77 3300005295 Ga0065707_10087442 Ga0065707_100874425 281
78 3300009553 Ga0105249_10143456 Ga0105249_101434562 281
79 3300025923 Ga0207681_10044386 Ga0207681_100443863 281
80 3300026075 Ga0207708_10071425 Ga0207708_100714252 281
81 3300026118 Ga0207675_100022931 Ga0207675_1000229314 281
82 3300028380 Ga0268265_10397931 Ga0268265_103979311 281
83 3300031456 Ga0307513_10361315 Ga0307513_103613151 281
84 3300042876 Ga0451577_0018745 Ga0451577_0018745_2805_3746 282
85 3300044712 Ga0453684_0280678 Ga0453684_0280678_316_1257 282
86 3300045051 Ga0451576_0085485 Ga0451576_0085485_2166_3107 282
87 3300046454 Ga0495592_0000499 Ga0495592_0000499_6938_7879 282
88 3300053154 Ga0500619_005187 Ga0500619_005187_282_1223 282
89 3300028786 Ga0307517_10058934 Ga0307517_100589341 283
90 3300031456 Ga0307513_10046962 Ga0307513_100469624 283
91 3300037471 Ga0395905_0005103 Ga0395905_0005103_6139_7122 283
92 3300046519 Ga0495632_0002352 Ga0495632_0002352_607_1545 283
93 3300053108 Ga0500562_015491 Ga0500562_015491_100_1038 283
94 3300053139 Ga0500568_0006967 Ga0500568_0006967_476_1414 283
95 3300053151 Ga0500604_0044551 Ga0500604_0044551_340_1278 283
96 3300006353 Ga0075370_10063470 Ga0075370_100634702 284
97 3300034820 Ga0373959_0004852 Ga0373959_0004852_229_1179 284
98 3300035088 Ga0373940_0005138 Ga0373940_0005138_1703_2653 284
99 3300035114 Ga0373939_0000047 Ga0373939_0000047_20572_21522 284
100 3300035121 Ga0373960_0001152 Ga0373960_0001152_2097_3047 284
101 3300035241 Ga0373961_0034780 Ga0373961_0034780_37_987 284
102 3300035691 Ga0373931_0000579 Ga0373931_0000579_11576_12526 284
103 3300044683 Ga0466965_0031086 Ga0466965_0031086_1254_2198 284
104 3300050496 nmdc:mga07m45_54858_c1 nmdc:mga07m45_54858_c1_622_1566 284
105 iso_pu_bacteria 2643221544 2643744051 284
106 3300005354 Ga0070675_100414501 Ga0070675_1004145012 285
107 3300005616 Ga0068852_100096238 Ga0068852_1000962383 285
108 3300005617 Ga0068859_100487773 Ga0068859_1004877732 285
109 3300005841 Ga0068863_100085003 Ga0068863_1000850033 285
110 3300005843 Ga0068860_100189057 Ga0068860_1001890573 285
111 3300005844 Ga0068862_100052355 Ga0068862_1000523552 285
112 3300006177 Ga0075362_10014222 Ga0075362_100142223 285
113 3300006931 Ga0097620_100487784 Ga0097620_1004877842 285
114 3300014968 Ga0157379_10032133 Ga0157379_100321333 285
115 3300025931 Ga0207644_10030001 Ga0207644_100300013 285
116 3300025940 Ga0207691_10139772 Ga0207691_101397721 285
117 3300026142 Ga0207698_10119948 Ga0207698_101199482 285
118 3300028380 Ga0268265_10014091 Ga0268265_100140914 285
119 3300044735 Ga0466968_0092433 Ga0466968_0092433_131_1072 285
120 3300048911 Ga0496108_0018647 Ga0496108_0018647_4433_5380 285
121 3300050489 nmdc:mga03683_21281_c1 nmdc:mga03683_21281_c1_789_1730 285
122 3300005331 Ga0070670_100001482 Ga0070670_10000148218 286
123 3300005355 Ga0070671_100111697 Ga0070671_1001116973 286
124 3300005364 Ga0070673_100018380 Ga0070673_1000183802 286
125 3300005367 Ga0070667_100087141 Ga0070667_1000871412 286
126 3300005456 Ga0070678_100042645 Ga0070678_1000426453 286
127 3300005543 Ga0070672_100025245 Ga0070672_1000252454 286
128 3300005618 Ga0068864_100030569 Ga0068864_1000305693 286
129 3300006237 Ga0097621_100017545 Ga0097621_1000175453 286
130 3300006358 Ga0068871_100088309 Ga0068871_1000883093 286
131 3300014969 Ga0157376_10025992 Ga0157376_100259925 286
132 3300025909 Ga0207705_10057983 Ga0207705_100579833 286
133 3300025925 Ga0207650_10003543 Ga0207650_100035434 286
134 3300025940 Ga0207691_10001767 Ga0207691_100017674 286
135 3300025960 Ga0207651_10006968 Ga0207651_100069684 286
136 3300026095 Ga0207676_10016482 Ga0207676_100164824 286
137 3300026121 Ga0207683_10080447 Ga0207683_100804472 286
138 3300026142 Ga0207698_10413613 Ga0207698_104136132 286
139 3300031507 Ga0307509_10000698 Ga0307509_1000069828 286
140 3300033180 Ga0307510_10033683 Ga0307510_100336832 286
141 3300035113 Ga0373936_0106403 Ga0373936_0106403_180_1127 286
142 3300042007 Ga0439449_0034397 Ga0439449_0034397_912_1856 286
143 3300049581 Ga0501047_0139862 Ga0501047_0139862_1085_2038 286
144 iso_pu_bacteria 2585428057 2587725947 286
145 iso_pu_bacteria 2585428058 2587735598 286
146 iso_pu_bacteria 2588253510 2588292840 286
147 iso_pu_bacteria 2643221585 2643932476 286
148 iso_pu_bacteria 2643221639 2644219890 286
149 iso_pu_bacteria 2643221646 2644260992 286
150 iso_pu_bacteria 2643221656 2644313727 286
151 iso_pu_bacteria 2738541337 2739054793 286
152 3300002773 JGI25152J39213_1002392 JGI25152J39213_10023923 287
153 3300002774 JGI25150J39212_1010797 JGI25150J39212_10107972 287
154 3300003215 JGI25153J46596_10001676 JGI25153J46596_1000167612 287
155 3300003771 Ga0055526_1001240 Ga0055526_10012408 287
156 3300006051 Ga0075364_10188644 Ga0075364_101886442 287
157 3300006195 Ga0075366_10037604 Ga0075366_100376042 287
158 3300013102 Ga0157371_10119517 Ga0157371_101195172 287
159 3300025245 Ga0207425_1000570 Ga0207425_10005702 287
160 3300025258 Ga0209129_1000158 Ga0209129_100015820 287
161 3300025273 Ga0209673_1008551 Ga0209673_10085513 287
162 3300025273 Ga0209673_1023905 Ga0209673_10239052 287
163 3300025295 Ga0209564_1000282 Ga0209564_100028220 287
164 3300025297 Ga0209758_1000910 Ga0209758_100091035 287
165 3300025298 Ga0209050_1000223 Ga0209050_100022345 287
166 3300025303 Ga0209051_1023640 Ga0209051_10236403 287
167 3300028786 Ga0307517_10072069 Ga0307517_100720694 287
168 3300031239 Ga0265328_10037268 Ga0265328_100372682 287
169 3300031251 Ga0265327_10000925 Ga0265327_1000092513 287
170 3300031344 Ga0265316_10000176 Ga0265316_1000017635 287
171 3300031649 Ga0307514_10088726 Ga0307514_100887262 287
172 3300035172 Ga0373955_0041338 Ga0373955_0041338_1295_2245 287
173 3300046459 Ga0495629_0009172 Ga0495629_0009172_3064_4014 287
174 3300046472 Ga0495580_0110869 Ga0495580_0110869_669_1619 287
175 3300046529 Ga0495652_0086062 Ga0495652_0086062_752_1702 287
176 3300046533 Ga0495640_0137503 Ga0495640_0137503_566_1516 287
177 3300046543 Ga0495645_0037182 Ga0495645_0037182_698_1648 287
178 3300046559 Ga0495667_0091710 Ga0495667_0091710_41_991 287
179 3300047471 Ga0495684_0054704 Ga0495684_0054704_922_1872 287
180 3300049569 Ga0501032_0126057 Ga0501032_0126057_160_1110 287
181 3300049579 Ga0501043_0000058 Ga0501043_0000058_34503_35453 287
182 3300049580 Ga0501046_0000051 Ga0501046_0000051_66625_67575 287
183 3300049581 Ga0501047_0000003 Ga0501047_0000003_440829_441779 287
184 3300049582 Ga0501048_0001358 Ga0501048_0001358_1233_2183 287
185 3300049823 Ga0501044_0103166 Ga0501044_0103166_550_1500 287
186 3300049824 Ga0501045_0015123 Ga0501045_0015123_534_1484 287
187 3300050491 nmdc:mga00v17_66258_c1 nmdc:mga00v17_66258_c1_1121_2059 287
188 3300050493 nmdc:mga0k408_21949_c1 nmdc:mga0k408_21949_c1_909_1847 287
189 3300050494 nmdc:mga06z11_286471_c1 nmdc:mga06z11_286471_c1_13_951 287
190 3300050496 nmdc:mga07m45_2998_c2 nmdc:mga07m45_2998_c2_388_1326 287
191 3300053077 Ga0495601_0307002 Ga0495601_0307002_14_964 287
192 3300053086 Ga0500578_0000417 Ga0500578_0000417_6542_7483 287
193 3300053093 Ga0500651_0266064 Ga0500651_0266064_37_975 287
194 3300053098 Ga0500650_0022212 Ga0500650_0022212_1356_2294 287
195 3300053131 Ga0500652_001084 Ga0500652_001084_5484_6422 287
196 3300053133 Ga0500655_010982 Ga0500655_010982_419_1357 287
197 3300053142 Ga0500577_0030338 Ga0500577_0030338_650_1588 287
198 3300053151 Ga0500604_0066152 Ga0500604_0066152_168_1109 287
199 3300053156 Ga0500622_0000198 Ga0500622_0000198_60324_61262 287
200 iso_pu_bacteria 2585428062 2587759112 287
201 iso_pu_bacteria 2643221592 2643967949 287
202 iso_pu_bacteria 2643221625 2644143151 287
203 iso_pu_bacteria 2643221648 2644271761 287
204 3300005328 Ga0070676_10125822 Ga0070676_101258221 288
205 3300005330 Ga0070690_100013442 Ga0070690_1000134422 288
206 3300005331 Ga0070670_100015553 Ga0070670_1000155531 288
207 3300005331 Ga0070670_100038140 Ga0070670_1000381405 288
208 3300005334 Ga0068869_100007008 Ga0068869_1000070087 288
209 3300005335 Ga0070666_10064003 Ga0070666_100640031 288
210 3300005338 Ga0068868_100044251 Ga0068868_1000442511 288
211 3300005338 Ga0068868_100049639 Ga0068868_1000496392 288
212 3300005343 Ga0070687_100005681 Ga0070687_1000056814 288
213 3300005347 Ga0070668_100011810 Ga0070668_1000118103 288
214 3300005353 Ga0070669_100002640 Ga0070669_1000026406 288
215 3300005353 Ga0070669_100005862 Ga0070669_1000058621 288
216 3300005354 Ga0070675_100006197 Ga0070675_1000061971 288
217 3300005354 Ga0070675_100015423 Ga0070675_1000154234 288
218 3300005355 Ga0070671_100042567 Ga0070671_1000425674 288
219 3300005356 Ga0070674_100017795 Ga0070674_1000177953 288
220 3300005356 Ga0070674_100154401 Ga0070674_1001544011 288
221 3300005364 Ga0070673_100034883 Ga0070673_1000348831 288
222 3300005367 Ga0070667_100007594 Ga0070667_1000075946 288
223 3300005456 Ga0070678_100026426 Ga0070678_1000264264 288
224 3300005456 Ga0070678_100353794 Ga0070678_1003537941 288
225 3300005457 Ga0070662_100283668 Ga0070662_1002836681 288
226 3300005459 Ga0068867_100000894 Ga0068867_10000089415 288
227 3300005459 Ga0068867_100254403 Ga0068867_1002544032 288
228 3300005543 Ga0070672_100007091 Ga0070672_1000070913 288
229 3300005543 Ga0070672_100010703 Ga0070672_1000107031 288
230 3300005548 Ga0070665_100144258 Ga0070665_1001442583 288
231 3300005616 Ga0068852_100056475 Ga0068852_1000564754 288
232 3300005617 Ga0068859_100032738 Ga0068859_1000327385 288
233 3300005618 Ga0068864_100055221 Ga0068864_1000552211 288
234 3300005719 Ga0068861_100019088 Ga0068861_1000190883 288
235 3300005841 Ga0068863_100002056 Ga0068863_1000020566 288
236 3300005842 Ga0068858_100000623 Ga0068858_10000062330 288
237 3300005843 Ga0068860_100022528 Ga0068860_1000225286 288
238 3300005844 Ga0068862_100119832 Ga0068862_1001198322 288
239 3300006358 Ga0068871_100241557 Ga0068871_1002415571 288
240 3300006881 Ga0068865_100015159 Ga0068865_1000151593 288
241 3300006881 Ga0068865_100299383 Ga0068865_1002993831 288
242 3300006931 Ga0097620_100032737 Ga0097620_1000327375 288
243 3300009148 Ga0105243_10041667 Ga0105243_100416673 288
244 3300009177 Ga0105248_10277354 Ga0105248_102773542 288
245 3300009553 Ga0105249_10009800 Ga0105249_100098006 288
246 3300013306 Ga0163162_10253456 Ga0163162_102534563 288
247 3300013308 Ga0157375_10002767 Ga0157375_1000276715 288
248 3300014326 Ga0157380_10000770 Ga0157380_100007701 288
249 3300014968 Ga0157379_10254376 Ga0157379_102543761 288
250 3300021361 Ga0213872_10004509 Ga0213872_100045099 288
251 3300025315 Ga0207697_10014915 Ga0207697_100149153 288
252 3300025315 Ga0207697_10077095 Ga0207697_100770952 288
253 3300025893 Ga0207682_10051761 Ga0207682_100517612 288
254 3300025893 Ga0207682_10115245 Ga0207682_101152451 288
255 3300025907 Ga0207645_10026636 Ga0207645_100266361 288
256 3300025918 Ga0207662_10013189 Ga0207662_100131895 288
257 3300025923 Ga0207681_10003110 Ga0207681_100031107 288
258 3300025923 Ga0207681_10009514 Ga0207681_100095146 288
259 3300025925 Ga0207650_10003734 Ga0207650_1000373411 288
260 3300025926 Ga0207659_10003530 Ga0207659_100035303 288
261 3300025926 Ga0207659_10231274 Ga0207659_102312741 288
262 3300025931 Ga0207644_10077953 Ga0207644_100779532 288
263 3300025933 Ga0207706_10022227 Ga0207706_100222274 288
264 3300025935 Ga0207709_10018575 Ga0207709_100185753 288
265 3300025937 Ga0207669_10003005 Ga0207669_100030057 288
266 3300025937 Ga0207669_10007396 Ga0207669_100073961 288
267 3300025940 Ga0207691_10108313 Ga0207691_101083132 288
268 3300025940 Ga0207691_10354139 Ga0207691_103541391 288
269 3300025942 Ga0207689_10012906 Ga0207689_100129066 288
270 3300025960 Ga0207651_10173828 Ga0207651_101738282 288
271 3300025961 Ga0207712_10036308 Ga0207712_100363081 288
272 3300025972 Ga0207668_10004050 Ga0207668_100040509 288
273 3300025986 Ga0207658_10041491 Ga0207658_100414915 288
274 3300026035 Ga0207703_10001480 Ga0207703_100014807 288
275 3300026088 Ga0207641_10001533 Ga0207641_1000153319 288
276 3300026089 Ga0207648_10309506 Ga0207648_103095061 288
277 3300026095 Ga0207676_10176523 Ga0207676_101765231 288
278 3300026095 Ga0207676_10326529 Ga0207676_103265291 288
279 3300026118 Ga0207675_100029708 Ga0207675_1000297083 288
280 3300026121 Ga0207683_10437389 Ga0207683_104373891 288
281 3300028379 Ga0268266_10496090 Ga0268266_104960901 288
282 3300028380 Ga0268265_10027800 Ga0268265_100278003 288
283 3300028381 Ga0268264_10019856 Ga0268264_100198563 288
284 3300028794 Ga0307515_10005936 Ga0307515_100059369 288
285 3300028794 Ga0307515_10011641 Ga0307515_1001164115 288
286 3300031456 Ga0307513_10005821 Ga0307513_1000582114 288
287 3300031507 Ga0307509_10039083 Ga0307509_100390833 288
288 3300031548 Ga0307408_100021576 Ga0307408_1000215764 288
289 3300031548 Ga0307408_100140014 Ga0307408_1001400142 288
290 3300031616 Ga0307508_10000504 Ga0307508_1000050414 288
291 3300031649 Ga0307514_10002566 Ga0307514_1000256613 288
292 3300031731 Ga0307405_10012518 Ga0307405_100125181 288
293 3300031731 Ga0307405_10016930 Ga0307405_100169304 288
294 3300031824 Ga0307413_10019690 Ga0307413_100196903 288
295 3300031901 Ga0307406_10031616 Ga0307406_100316163 288
296 3300031901 Ga0307406_10041963 Ga0307406_100419633 288
297 3300031903 Ga0307407_10049525 Ga0307407_100495253 288
298 3300031911 Ga0307412_10005099 Ga0307412_100050996 288
299 3300031995 Ga0307409_100001339 Ga0307409_1000013395 288
300 3300031995 Ga0307409_100002252 Ga0307409_10000225211 288
301 3300032002 Ga0307416_100019414 Ga0307416_1000194143 288
302 3300032002 Ga0307416_100019721 Ga0307416_1000197213 288
303 3300032004 Ga0307414_10035032 Ga0307414_100350324 288
304 3300032004 Ga0307414_10287164 Ga0307414_102871642 288
305 3300032005 Ga0307411_10011812 Ga0307411_100118125 288
306 3300039447 Ga0436361_0264437 Ga0436361_0264437_54195_55133 288
307 3300044712 Ga0453684_0008286 Ga0453684_0008286_11212_12168 288
308 3300046512 Ga0495610_0077809 Ga0495610_0077809_428_1369 288
309 3300046522 Ga0495643_0062508 Ga0495643_0062508_129_1070 288
310 3300046660 Ga0495625_0000827 Ga0495625_0000827_8287_9228 288
311 3300047472 Ga0495686_0068182 Ga0495686_0068182_1060_2001 288
312 3300050493 nmdc:mga0k408_63486_c1 nmdc:mga0k408_63486_c1_1185_2126 288
313 3300050496 nmdc:mga07m45_56544_c1 nmdc:mga07m45_56544_c1_1111_2052 288
314 3300050496 nmdc:mga07m45_58492_c1 nmdc:mga07m45_58492_c1_1223_2164 288
315 3300053134 Ga0500658_0128773 Ga0500658_0128773_54_995 288
316 iso_pu_bacteria 2643221660 2644339816 288
317 iso_pu_bacteria 2831864461 2831867633 288
318 iso_pu_bacteria 2886848708 2886854916 288
319 3300005344 Ga0070661_100145250 Ga0070661_1001452502 289
320 3300005355 Ga0070671_100122107 Ga0070671_1001221073 289
321 3300005456 Ga0070678_100104996 Ga0070678_1001049962 289
322 3300005459 Ga0068867_100021133 Ga0068867_1000211333 289
323 3300005539 Ga0068853_100033463 Ga0068853_1000334632 289
324 3300005578 Ga0068854_100122843 Ga0068854_1001228433 289
325 3300009093 Ga0105240_10021539 Ga0105240_100215394 289
326 3300009545 Ga0105237_10040414 Ga0105237_100404144 289
327 3300009551 Ga0105238_10371942 Ga0105238_103719421 289
328 3300021361 Ga0213872_10000033 Ga0213872_1000003328 289
329 3300021361 Ga0213872_10021274 Ga0213872_100212742 289
330 3300025907 Ga0207645_10117738 Ga0207645_101177382 289
331 3300025925 Ga0207650_10056215 Ga0207650_100562153 289
332 3300025931 Ga0207644_10158005 Ga0207644_101580052 289
333 3300025981 Ga0207640_10252651 Ga0207640_102526512 289
334 3300026089 Ga0207648_10004823 Ga0207648_1000482311 289
335 3300026121 Ga0207683_10209698 Ga0207683_102096982 289
336 3300039447 Ga0436361_0027317 Ga0436361_0027317_20826_21776 289
337 3300039447 Ga0436361_0301682 Ga0436361_0301682_2001_2951 289
338 3300042000 Ga0439437_003678 Ga0439437_003678_334_1284 289
339 3300042120 Ga0450917_002083 Ga0450917_002083_104_1054 289
340 3300042126 Ga0450888_000258 Ga0450888_000258_106_1056 289
341 3300042136 Ga0450900_004838 Ga0450900_004838_14_964 289
342 3300042144 Ga0450889_000025 Ga0450889_000025_8557_9507 289
343 3300042533 Ga0450901_008153 Ga0450901_008153_34_984 289
344 3300049665 Ga0501227_026095 Ga0501227_026095_354_1304 289
345 3300003316 rootH1_10007856 rootH1_100078562 290
346 3300003322 rootL2_10027257 rootL2_100272575 290
347 3300005262 Ga0065165_1000621 Ga0065165_100062148 290
348 3300005329 Ga0070683_100049963 Ga0070683_1000499633 290
349 3300005331 Ga0070670_100055150 Ga0070670_1000551501 290
350 3300005337 Ga0070682_100100347 Ga0070682_1001003471 290
351 3300005338 Ga0068868_100376041 Ga0068868_1003760411 290
352 3300005364 Ga0070673_100301129 Ga0070673_1003011292 290
353 3300005366 Ga0070659_100172033 Ga0070659_1001720332 290
354 3300005367 Ga0070667_100305577 Ga0070667_1003055771 290
355 3300005445 Ga0070708_100109977 Ga0070708_1001099773 290
356 3300005564 Ga0070664_100059502 Ga0070664_1000595024 290
357 3300005578 Ga0068854_100292743 Ga0068854_1002927431 290
358 3300005617 Ga0068859_100217279 Ga0068859_1002172792 290
359 3300005843 Ga0068860_100159526 Ga0068860_1001595262 290
360 3300006353 Ga0075370_10011470 Ga0075370_100114704 290
361 3300006358 Ga0068871_100341752 Ga0068871_1003417522 290
362 3300006931 Ga0097620_100217284 Ga0097620_1002172843 290
363 3300009147 Ga0114129_10307047 Ga0114129_103070473 290
364 3300013306 Ga0163162_10437556 Ga0163162_104375562 290
365 3300014325 Ga0163163_10108170 Ga0163163_101081704 290
366 3300017792 Ga0163161_10117770 Ga0163161_101177702 290
367 3300025893 Ga0207682_10013002 Ga0207682_100130024 290
368 3300025907 Ga0207645_10064121 Ga0207645_100641213 290
369 3300025925 Ga0207650_10026247 Ga0207650_100262472 290
370 3300025944 Ga0207661_10206010 Ga0207661_102060102 290
371 3300025945 Ga0207679_10128306 Ga0207679_101283062 290
372 3300031251 Ga0265327_10000080 Ga0265327_1000008086 290
373 3300031548 Ga0307408_100000012 Ga0307408_100000012260 290
374 3300031548 Ga0307408_100111052 Ga0307408_1001110522 290
375 3300037471 Ga0395905_0005387 Ga0395905_0005387_8900_9850 290
376 3300044712 Ga0453684_0249527 Ga0453684_0249527_868_1818 290
377 3300045051 Ga0451576_0065287 Ga0451576_0065287_2123_3073 290
378 3300049130 Ga0501310_002947 Ga0501310_002947_369_1319 290
379 3300049662 Ga0501222_002025 Ga0501222_002025_168_1118 290
380 3300049679 Ga0501249_028108 Ga0501249_028108_30_980 290
381 3300049686 Ga0501257_036739 Ga0501257_036739_64_1014 290
382 3300049704 Ga0501221_001011 Ga0501221_001011_181_1131 290
383 3300049769 Ga0501272_001114 Ga0501272_001114_387_1337 290
384 3300050496 nmdc:mga07m45_51896_c1 nmdc:mga07m45_51896_c1_1258_2202 290
385 3300003215 JGI25153J46596_10003840 JGI25153J46596_100038408 291
386 3300005347 Ga0070668_100020579 Ga0070668_1000205793 291
387 3300005347 Ga0070668_100376733 Ga0070668_1003767332 291
388 3300005354 Ga0070675_100032317 Ga0070675_1000323174 291
389 3300005367 Ga0070667_100076606 Ga0070667_1000766062 291
390 3300005367 Ga0070667_100169098 Ga0070667_1001690982 291
391 3300005367 Ga0070667_100359261 Ga0070667_1003592612 291
392 3300005459 Ga0068867_100000605 Ga0068867_1000006053 291
393 3300005543 Ga0070672_100029290 Ga0070672_1000292904 291
394 3300005543 Ga0070672_100057538 Ga0070672_1000575382 291
395 3300005563 Ga0068855_100603894 Ga0068855_1006038942 291
396 3300005617 Ga0068859_100246619 Ga0068859_1002466193 291
397 3300005843 Ga0068860_100000384 Ga0068860_10000038436 291
398 3300005844 Ga0068862_100037567 Ga0068862_1000375673 291
399 3300006881 Ga0068865_100002745 Ga0068865_1000027454 291
400 3300006931 Ga0097620_100246607 Ga0097620_1002466073 291
401 3300009553 Ga0105249_10017117 Ga0105249_100171174 291
402 3300013297 Ga0157378_10047529 Ga0157378_100475293 291
403 3300013306 Ga0163162_10001355 Ga0163162_1000135517 291
404 3300013308 Ga0157375_10040833 Ga0157375_100408333 291
405 3300014326 Ga0157380_10012894 Ga0157380_100128946 291
406 3300017792 Ga0163161_10021715 Ga0163161_100217152 291
407 3300025923 Ga0207681_10033819 Ga0207681_100338192 291
408 3300025938 Ga0207704_10005637 Ga0207704_100056374 291
409 3300025939 Ga0207665_10198954 Ga0207665_101989542 291
410 3300025940 Ga0207691_10030328 Ga0207691_100303285 291
411 3300025940 Ga0207691_10129705 Ga0207691_101297052 291
412 3300025961 Ga0207712_10009930 Ga0207712_100099304 291
413 3300025972 Ga0207668_10012878 Ga0207668_100128784 291
414 3300025986 Ga0207658_10053839 Ga0207658_100538392 291
415 3300025986 Ga0207658_10136908 Ga0207658_101369082 291
416 3300026035 Ga0207703_10041044 Ga0207703_100410442 291
417 3300026067 Ga0207678_10075599 Ga0207678_100755993 291
418 3300026089 Ga0207648_10002852 Ga0207648_100028523 291
419 3300026121 Ga0207683_10051334 Ga0207683_100513342 291
420 3300028380 Ga0268265_10003306 Ga0268265_100033068 291
421 3300028381 Ga0268264_10001034 Ga0268264_1000103421 291
422 3300028786 Ga0307517_10004429 Ga0307517_1000442912 291
423 3300028794 Ga0307515_10000139 Ga0307515_10000139162 291
424 3300028794 Ga0307515_10117134 Ga0307515_101171341 291
425 3300030522 Ga0307512_10010416 Ga0307512_100104164 291
426 3300031456 Ga0307513_10078619 Ga0307513_100786193 291
427 3300031456 Ga0307513_10084122 Ga0307513_100841226 291
428 3300031456 Ga0307513_10139805 Ga0307513_101398053 291
429 3300031507 Ga0307509_10012484 Ga0307509_100124844 291
430 3300031616 Ga0307508_10000144 Ga0307508_100001449 291
431 3300031616 Ga0307508_10010113 Ga0307508_100101136 291
432 3300031649 Ga0307514_10125861 Ga0307514_101258612 291
433 3300031649 Ga0307514_10207005 Ga0307514_102070052 291
434 3300031730 Ga0307516_10053910 Ga0307516_100539102 291
435 3300033180 Ga0307510_10000426 Ga0307510_1000042621 291
436 3300037471 Ga0395905_0000504 Ga0395905_0000504_27008_27985 291
437 3300044656 Ga0466969_0000018 Ga0466969_0000018_52979_53920 291
438 3300044656 Ga0466969_0020123 Ga0466969_0020123_2281_3222 291
439 3300044684 Ga0466966_0038581 Ga0466966_0038581_422_1363 291
440 3300044693 Ga0466961_0015398 Ga0466961_0015398_2367_3308 291
441 3300044693 Ga0466961_0016802 Ga0466961_0016802_266_1207 291
442 3300044706 Ga0466964_0003947 Ga0466964_0003947_958_1899 291
443 3300044765 Ga0466970_0095863 Ga0466970_0095863_278_1219 291
444 3300044901 Ga0466960_0088834 Ga0466960_0088834_189_1130 291
445 3300045049 Ga0466959_0031472 Ga0466959_0031472_2045_2986 291
446 3300045049 Ga0466959_0044206 Ga0466959_0044206_1537_2478 291
447 3300045836 Ga0466958_0009242 Ga0466958_0009242_737_1678 291
448 3300045976 Ga0466967_0104287 Ga0466967_0104287_220_1161 291
449 3300046471 Ga0495650_0015475 Ga0495650_0015475_409_1350 291
450 3300046690 Ga0495624_0060379 Ga0495624_0060379_981_1928 291
451 3300047321 Ga0495676_0018846 Ga0495676_0018846_3550_4497 291
452 3300048088 Ga0495602_0099403 Ga0495602_0099403_1209_2156 291
453 3300048924 Ga0496121_0003335 Ga0496121_0003335_21341_22282 291
454 3300048927 Ga0496124_0000733 Ga0496124_0000733_31260_32201 291
455 3300048927 Ga0496124_0184562 Ga0496124_0184562_505_1446 291
456 3300048928 Ga0496125_0017746 Ga0496125_0017746_2017_2958 291
457 3300053088 Ga0500644_0003385 Ga0500644_0003385_368_1315 291
458 3300053131 Ga0500652_035357 Ga0500652_035357_597_1544 291
459 3300053133 Ga0500655_010765 Ga0500655_010765_141_1088 291
460 3300053136 Ga0500559_0000097 Ga0500559_0000097_61212_62159 291
461 3300053156 Ga0500622_0008142 Ga0500622_0008142_3986_4933 291
462 3300053739 Ga0500587_000996 Ga0500587_000996_1987_2934 291
463 3300061719 Ga0466962_0029907 Ga0466962_0029907_211_1152 291
464 3300003322 rootL2_10001066 rootL2_1000106628 292
465 3300003775 Ga0055524_1000550 Ga0055524_10005502 292
466 3300003775 Ga0055524_1024981 Ga0055524_10249812 292
467 3300003794 Ga0055531_10003310 Ga0055531_1000331010 292
468 3300003794 Ga0055531_10012397 Ga0055531_100123972 292
469 3300004625 Ga0055543_1019323 Ga0055543_10193231 292
470 3300005262 Ga0065165_1000474 Ga0065165_100047422 292
471 3300005331 Ga0070670_100492060 Ga0070670_1004920601 292
472 3300005355 Ga0070671_100020190 Ga0070671_1000201904 292
473 3300005355 Ga0070671_100023028 Ga0070671_1000230285 292
474 3300005356 Ga0070674_100037861 Ga0070674_1000378613 292
475 3300005548 Ga0070665_100043957 Ga0070665_1000439573 292
476 3300005617 Ga0068859_100028192 Ga0068859_1000281925 292
477 3300005618 Ga0068864_100039478 Ga0068864_1000394782 292
478 3300005841 Ga0068863_100238659 Ga0068863_1002386592 292
479 3300006353 Ga0075370_10031800 Ga0075370_100318003 292
480 3300006931 Ga0097620_100028192 Ga0097620_1000281925 292
481 3300006944 Ga0099823_1000005 Ga0099823_100000572 292
482 3300009098 Ga0105245_10036547 Ga0105245_100365474 292
483 3300009177 Ga0105248_10001355 Ga0105248_1000135513 292
484 3300011119 Ga0105246_10066071 Ga0105246_100660713 292
485 3300012497 Ga0157319_1000005 Ga0157319_100000593 292
486 3300013308 Ga0157375_10228383 Ga0157375_102283832 292
487 3300021361 Ga0213872_10001003 Ga0213872_1000100321 292
488 3300021361 Ga0213872_10012188 Ga0213872_100121882 292
489 3300025273 Ga0209673_1008988 Ga0209673_10089883 292
490 3300025295 Ga0209564_1000021 Ga0209564_100002143 292
491 3300025298 Ga0209050_1001406 Ga0209050_100140616 292
492 3300025299 Ga0209256_1000309 Ga0209256_100030927 292
493 3300025299 Ga0209256_1001207 Ga0209256_10012072 292
494 3300025303 Ga0209051_1000621 Ga0209051_10006216 292
495 3300025304 Ga0209257_1000981 Ga0209257_10009813 292
496 3300025304 Ga0209257_1003138 Ga0209257_100313813 292
497 3300025925 Ga0207650_10197233 Ga0207650_101972331 292
498 3300025927 Ga0207687_10078434 Ga0207687_100784343 292
499 3300025931 Ga0207644_10017792 Ga0207644_100177925 292
500 3300025931 Ga0207644_10049302 Ga0207644_100493022 292
501 3300025937 Ga0207669_10161409 Ga0207669_101614092 292
502 3300025941 Ga0207711_10115954 Ga0207711_101159543 292
503 3300026088 Ga0207641_10084659 Ga0207641_100846593 292
504 3300026088 Ga0207641_10211186 Ga0207641_102111862 292
505 3300026095 Ga0207676_10027619 Ga0207676_100276195 292
506 3300026142 Ga0207698_10120403 Ga0207698_101204032 292
507 3300027312 Ga0209371_1010421 Ga0209371_10104212 292
508 3300028379 Ga0268266_10030341 Ga0268266_100303414 292
509 3300028786 Ga0307517_10149179 Ga0307517_101491792 292
510 3300028794 Ga0307515_10007880 Ga0307515_1000788018 292
511 3300030500 Ga0268256_1013843 Ga0268256_10138433 292
512 3300031507 Ga0307509_10020734 Ga0307509_100207347 292
513 3300031507 Ga0307509_10024647 Ga0307509_100246474 292
514 3300031852 Ga0307410_10298618 Ga0307410_102986182 292
515 3300033179 Ga0307507_10027415 Ga0307507_100274151 292
516 3300039447 Ga0436361_0156562 Ga0436361_0156562_3030_3989 292
517 3300039447 Ga0436361_0272384 Ga0436361_0272384_3901_4860 292
518 3300042127 Ga0450890_000482 Ga0450890_000482_3450_4415 292
519 3300042437 Ga0439444_0003978 Ga0439444_0003978_59_1024 292
520 3300042438 Ga0439459_0000990 Ga0439459_0000990_438_1403 292
521 3300046616 Ga0495668_0021362 Ga0495668_0021362_263_1207 292
522 3300046692 Ga0495671_0099716 Ga0495671_0099716_197_1141 292
523 3300048911 Ga0496108_0167965 Ga0496108_0167965_48_995 292
524 3300048915 Ga0496112_0009640 Ga0496112_0009640_7117_8064 292
525 3300050493 nmdc:mga0k408_53141_c1 nmdc:mga0k408_53141_c1_1363_2328 292
526 3300053086 Ga0500578_0008111 Ga0500578_0008111_4317_5261 292
527 3300053139 Ga0500568_0007565 Ga0500568_0007565_1178_2131 292
528 3300005614 Ga0068856_100363585 Ga0068856_1003635852 293
529 3300048912 Ga0496109_0192421 Ga0496109_0192421_662_1681 293
530 3300046473 Ga0495582_0140188 Ga0495582_0140188_111_1061 294
531 3300031649 Ga0307514_10000339 Ga0307514_1000033910 295
532 3300037471 Ga0395905_0034159 Ga0395905_0034159_11_979 295
533 3300025256 Ga0209759_1001016 Ga0209759_100101611 296
534 3300031730 Ga0307516_10006214 Ga0307516_100062143 296
535 3300006353 Ga0075370_10012670 Ga0075370_100126704 297
536 3300028794 Ga0307515_10005664 Ga0307515_100056643 297
537 3300050496 nmdc:mga07m45_3233_c1 nmdc:mga07m45_3233_c1_4475_5443 297
538 3300025909 Ga0207705_10127801 Ga0207705_101278012 300
539 3300046506 Ga0495583_0000428 Ga0495583_0000428_12022_12996 300
540 3300046507 Ga0495606_0000821 Ga0495606_0000821_32597_33571 300
541 3300046616 Ga0495668_0036997 Ga0495668_0036997_260_1234 300
542 3300046660 Ga0495625_0025677 Ga0495625_0025677_1799_2773 300
543 3300046694 Ga0495649_0003008 Ga0495649_0003008_2296_3270 300
544 3300046794 Ga0495589_0015574 Ga0495589_0015574_2705_3679 300
545 3300053080 Ga0500635_0052561 Ga0500635_0052561_251_1225 300
546 3300053131 Ga0500652_089641 Ga0500652_089641_154_1122 300
547 3300053177 Ga0500636_0032479 Ga0500636_0032479_1867_2841 300
548 3300055283 Ga0500661_016932 Ga0500661_016932_201_1175 300
549 3300002705 JGI25156J39149_1000273 JGI25156J39149_100027330 301
550 3300002741 JGI25157J39369_1000141 JGI25157J39369_100014130 301
551 3300003323 rootH1_10024534 rootH1_100245341 301
552 3300003756 Ga0055533_1000008 Ga0055533_1000008153 301
553 3300003759 Ga0055525_1001100 Ga0055525_10011003 301
554 3300003761 Ga0055535_1000271 Ga0055535_10002715 301
555 3300003763 Ga0055529_1000321 Ga0055529_100032144 301
556 3300005334 Ga0068869_100349062 Ga0068869_1003490621 301
557 3300005338 Ga0068868_100122638 Ga0068868_1001226383 301
558 3300005339 Ga0070660_100131055 Ga0070660_1001310551 301
559 3300005339 Ga0070660_100277679 Ga0070660_1002776792 301
560 3300005364 Ga0070673_100014291 Ga0070673_1000142914 301
561 3300005367 Ga0070667_100267146 Ga0070667_1002671461 301
562 3300005563 Ga0068855_100387551 Ga0068855_1003875511 301
563 3300005577 Ga0068857_100028700 Ga0068857_1000287004 301
564 3300005578 Ga0068854_100047028 Ga0068854_1000470283 301
565 3300005614 Ga0068856_100000135 Ga0068856_10000013562 301
566 3300005616 Ga0068852_100215107 Ga0068852_1002151072 301
567 3300006353 Ga0075370_10002303 Ga0075370_100023038 301
568 3300009093 Ga0105240_10075146 Ga0105240_100751464 301
569 3300009093 Ga0105240_10588401 Ga0105240_105884011 301
570 3300010375 Ga0105239_10032539 Ga0105239_100325394 301
571 3300011119 Ga0105246_10038570 Ga0105246_100385704 301
572 3300013105 Ga0157369_10267036 Ga0157369_102670362 301
573 3300013297 Ga0157378_10294993 Ga0157378_102949932 301
574 3300013307 Ga0157372_10140135 Ga0157372_101401351 301
575 3300014968 Ga0157379_10193293 Ga0157379_101932932 301
576 3300025226 Ga0209674_100015 Ga0209674_100015511 301
577 3300025230 Ga0209563_100017 Ga0209563_100017608 301
578 3300025231 Ga0207427_100444 Ga0207427_1004449 301
579 3300025242 Ga0209258_100025 Ga0209258_1000256 301
580 3300025242 Ga0209258_100726 Ga0209258_1007264 301
581 3300025246 Ga0209646_1000438 Ga0209646_100043812 301
582 3300025250 Ga0209026_1000028 Ga0209026_1000028115 301
583 3300025253 Ga0209677_100037 Ga0209677_100037108 301
584 3300025253 Ga0209677_100113 Ga0209677_10011328 301
585 3300025254 Ga0209148_1002792 Ga0209148_10027925 301
586 3300025256 Ga0209759_1000021 Ga0209759_1000021171 301
587 3300025256 Ga0209759_1005783 Ga0209759_10057832 301
588 3300025272 Ga0209455_1000166 Ga0209455_100016691 301
589 3300025913 Ga0207695_10007014 Ga0207695_100070144 301
590 3300025919 Ga0207657_10063014 Ga0207657_100630143 301
591 3300025932 Ga0207690_10009309 Ga0207690_100093092 301
592 3300025942 Ga0207689_10037320 Ga0207689_100373203 301
593 3300025949 Ga0207667_10003517 Ga0207667_1000351716 301
594 3300025981 Ga0207640_10054762 Ga0207640_100547621 301
595 3300026023 Ga0207677_10314377 Ga0207677_103143772 301
596 3300026041 Ga0207639_10384146 Ga0207639_103841462 301
597 3300026078 Ga0207702_10001523 Ga0207702_1000152315 301
598 3300026116 Ga0207674_10016268 Ga0207674_100162683 301
599 3300026118 Ga0207675_100025649 Ga0207675_1000256491 301
600 3300028666 Ga0265336_10000274 Ga0265336_1000027411 301
601 3300031730 Ga0307516_10000107 Ga0307516_1000010779 301
602 3300037466 Ga0395898_0028823 Ga0395898_0028823_2066_3034 301
603 3300038443 Ga0395901_0006507 Ga0395901_0006507_6695_7663 301
604 3300044694 Ga0466963_0017494 Ga0466963_0017494_1447_2415 301
605 3300047472 Ga0495686_0023279 Ga0495686_0023279_246_1214 301
606 3300048909 Ga0496106_0274144 Ga0496106_0274144_20_988 301
607 3300050496 nmdc:mga07m45_4373_c1 nmdc:mga07m45_4373_c1_545_1513 301
608 3300053080 Ga0500635_0000070 Ga0500635_0000070_52394_53362 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14561

TPR_20

Tetratricopeptide repeat

217

294

0.94

PF14559

TPR_19

Tetratricopeptide repeat

141

212

0.93

PF00085

Thioredoxin

Thioredoxin

13

121

0.91

PF03704

BTAD

Bacterial transcriptional activator domain

108

213

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yj7-assembly2.cif.gz_B crystal structure of a hyperstable protein from the precambrian period 0.9412 1 110
7c3f-assembly4.cif.gz_L crystal structure of ferredoxin: thioredoxin reductase and thioredoxin m2 complex 0.9402 1 110
4ulx-assembly1.cif.gz_A crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant. 0.9342 1 110
2fch-assembly5.cif.gz_E crystal structure of thioredoxin mutant g74s 0.9319 1 111
5hr2-assembly1.cif.gz_A crystal structure of thioredoxin l94a mutant 0.9317 2 110
ID Description Score Start End Superfamily
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9342 1 110 3.40.30.10
af_Q54NX3_19_129_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9318 3 108 3.40.30.10
3vfiA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9284 1 110 3.40.30.10
3vfiA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.92 1 110 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9174 1 110 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A520BEP6-F1-model_v4 Co-chaperone YbbN 1.002 1 112 GO:0005829
GO:0015035
GO:0045454
AF-A0A520H0B7-F1-model_v4 Co-chaperone YbbN 1.001 1 105 GO:0005829
GO:0015035
GO:0045454
AF-A0A4Q5WIQ6-F1-model_v4 deleted 0.9988 1 120
AF-A0A520H0B7-F1-model_v4 Co-chaperone YbbN 0.9918 1 105 GO:0005829
GO:0015035
GO:0045454
AF-A0A7Y1UPT9-F1-model_v4 Thioredoxin 0.9796 1 112 GO:0005829
GO:0015035
GO:0045454

Feature Viewer

pLDDT pTM Quality
83.84 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map