F468760
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 608 | 320 | 593 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300005262|Ga0065165_1000474|Ga0065165_100047422 |
| Length | 334 |
| Sequence | VAKLAGLPDRSPTMTDITLQNFEADLLQASMQQPVLLDIWAPWCGPCRTLGPMLEKLEVAYAGRWKLTKLNSDDQPEIATQLSQAFGVRSIPFCVMFVGGQPVDGFVGAIPEAQIREFLDRHVPTGEALEAEEDLAEAQALMEEGDADGALEKLQAAVQADPSNEVARFDLIRALLEDDQLAHAKAAFAPVAHLAADTITPHARFQALAAWIAAAERAEQGLDPAGLQAAIASNKRDFDARFALAQGLFAGRDFTGAMDELLEIIMRDKTWNDQLARKTYVAILEIMTKPAQPAHGHGAGAPQAGGLQLSGPSTVAPADPLIDQYRRKLSMALF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 8 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 9 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 10 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 11 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 12 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 13 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 14 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 15 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 16 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 17 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 18 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 19 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 20 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 184 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 222 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 223 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 224 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 225 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 226 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 227 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 228 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 229 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 240 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 289 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 292 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 293 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 299 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 303 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 306 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 307 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 308 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 309 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 310 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 312 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 313 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 315 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 316 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 317 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 319 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 320 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.2 |
| Metatranscriptomes | 0.16 |
| Isolates | 2.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.46 |
| Nodule | 0.33 |
| Rhizoplane | 1.81 |
| Rhizosphere | 72.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000273 | 3300002705 | Bacteria | 35022 |
| 2 | JGI25157J39369_1000141 | 3300002741 | Bacteria | 61029 |
| 3 | JGI25152J39213_1002392 | 3300002773 | Bacteria | 7183 |
| 4 | JGI25150J39212_1010797 | 3300002774 | Bacteria | 1682 |
| 5 | JGI25153J46596_10001676 | 3300003215 | Bacteria | 13140 |
| 6 | JGI25153J46596_10003840 | 3300003215 | Bacteria | 8278 |
| 7 | rootH1_10007856 | 3300003316 | Bacteria | 4332 |
| 8 | rootH1_10007856 | 3300003323 | Bacteria | 7740 |
| 9 | rootL2_10001066 | 3300003322 | Bacteria | 89444 |
| 10 | rootL2_10027257 | 3300003322 | Bacteria | 4377 |
| 11 | rootH1_10006249 | 3300003323 | Bacteria | 5699 |
| 12 | rootH1_10024534 | 3300003323 | Bacteria | 1223 |
| 13 | Ga0055533_1000008 | 3300003756 | Bacteria | 575861 |
| 14 | Ga0055525_1001100 | 3300003759 | Bacteria | 6698 |
| 15 | Ga0055535_1000271 | 3300003761 | Bacteria | 54319 |
| 16 | Ga0055529_1000321 | 3300003763 | Bacteria | 54307 |
| 17 | Ga0055526_1001240 | 3300003771 | Bacteria | 18300 |
| 18 | Ga0055524_1000550 | 3300003775 | Bacteria | 28332 |
| 19 | Ga0055524_1024981 | 3300003775 | Bacteria | 1881 |
| 20 | Ga0055531_10000469 | 3300003794 | Bacteria | 37355 |
| 21 | Ga0055531_10003310 | 3300003794 | Bacteria | 10312 |
| 22 | Ga0055531_10012397 | 3300003794 | Bacteria | 4014 |
| 23 | Ga0055543_1019323 | 3300004625 | Bacteria | 1262 |
| 24 | Ga0065165_1000474 | 3300005262 | Bacteria | 62687 |
| 25 | Ga0065165_1000621 | 3300005262 | Bacteria | 51523 |
| 26 | Ga0065707_10087442 | 3300005295 | Bacteria | 5023 |
| 27 | Ga0070676_10038439 | 3300005328 | Bacteria | 2765 |
| 28 | Ga0070676_10125822 | 3300005328 | Bacteria | 1614 |
| 29 | Ga0070683_100049963 | 3300005329 | Bacteria | 3869 |
| 30 | Ga0070690_100013442 | 3300005330 | Bacteria | 4837 |
| 31 | Ga0070690_100043749 | 3300005330 | Bacteria | 2841 |
| 32 | Ga0070670_100001482 | 3300005331 | Bacteria | 18900 |
| 33 | Ga0070670_100015553 | 3300005331 | Bacteria | 6535 |
| 34 | Ga0070670_100038140 | 3300005331 | Bacteria | 4131 |
| 35 | Ga0070670_100055150 | 3300005331 | Bacteria | 3411 |
| 36 | Ga0070670_100492060 | 3300005331 | Bacteria | 1090 |
| 37 | Ga0068869_100007008 | 3300005334 | Bacteria | 7178 |
| 38 | Ga0068869_100032973 | 3300005334 | Bacteria | 3654 |
| 39 | Ga0068869_100349062 | 3300005334 | Bacteria | 1206 |
| 40 | Ga0070666_10015366 | 3300005335 | Bacteria | 4882 |
| 41 | Ga0070666_10064003 | 3300005335 | Bacteria | 2494 |
| 42 | Ga0070682_100100347 | 3300005337 | Bacteria | 1910 |
| 43 | Ga0068868_100023935 | 3300005338 | Bacteria | 4628 |
| 44 | Ga0068868_100044251 | 3300005338 | Bacteria | 3481 |
| 45 | Ga0068868_100049639 | 3300005338 | Bacteria | 3293 |
| 46 | Ga0068868_100122638 | 3300005338 | Bacteria | 2121 |
| 47 | Ga0068868_100376041 | 3300005338 | Bacteria | 1221 |
| 48 | Ga0070660_100131055 | 3300005339 | Bacteria | 2006 |
| 49 | Ga0070660_100277679 | 3300005339 | Bacteria | 1370 |
| 50 | Ga0070687_100005681 | 3300005343 | Bacteria | 5061 |
| 51 | Ga0070661_100145250 | 3300005344 | Bacteria | 1790 |
| 52 | Ga0070668_100011810 | 3300005347 | Bacteria | 6504 |
| 53 | Ga0070668_100020579 | 3300005347 | Bacteria | 4981 |
| 54 | Ga0070668_100376733 | 3300005347 | Bacteria | 1207 |
| 55 | Ga0070669_100002640 | 3300005353 | Bacteria | 12947 |
| 56 | Ga0070669_100005862 | 3300005353 | Bacteria | 8863 |
| 57 | Ga0070675_100006197 | 3300005354 | Bacteria | 9173 |
| 58 | Ga0070675_100015423 | 3300005354 | Bacteria | 6040 |
| 59 | Ga0070675_100032317 | 3300005354 | Bacteria | 4235 |
| 60 | Ga0070675_100062941 | 3300005354 | Bacteria | 3066 |
| 61 | Ga0070675_100414501 | 3300005354 | Bacteria | 1204 |
| 62 | Ga0070671_100020190 | 3300005355 | Bacteria | 5430 |
| 63 | Ga0070671_100023028 | 3300005355 | Bacteria | 5091 |
| 64 | Ga0070671_100042567 | 3300005355 | Bacteria | 3775 |
| 65 | Ga0070671_100056944 | 3300005355 | Bacteria | 3252 |
| 66 | Ga0070671_100111697 | 3300005355 | Bacteria | 2296 |
| 67 | Ga0070671_100122107 | 3300005355 | Bacteria | 2192 |
| 68 | Ga0070674_100017795 | 3300005356 | Bacteria | 4478 |
| 69 | Ga0070674_100037861 | 3300005356 | Bacteria | 3247 |
| 70 | Ga0070674_100154401 | 3300005356 | Bacteria | 1735 |
| 71 | Ga0070673_100014291 | 3300005364 | Bacteria | 5522 |
| 72 | Ga0070673_100018380 | 3300005364 | Bacteria | 4991 |
| 73 | Ga0070673_100034883 | 3300005364 | Bacteria | 3811 |
| 74 | Ga0070673_100075393 | 3300005364 | Bacteria | 2720 |
| 75 | Ga0070673_100301129 | 3300005364 | Bacteria | 1411 |
| 76 | Ga0070659_100172033 | 3300005366 | Bacteria | 1775 |
| 77 | Ga0070667_100007594 | 3300005367 | Bacteria | 8991 |
| 78 | Ga0070667_100076606 | 3300005367 | Bacteria | 2856 |
| 79 | Ga0070667_100087141 | 3300005367 | Bacteria | 2680 |
| 80 | Ga0070667_100169098 | 3300005367 | Bacteria | 1929 |
| 81 | Ga0070667_100267146 | 3300005367 | Bacteria | 1533 |
| 82 | Ga0070667_100305577 | 3300005367 | Bacteria | 1433 |
| 83 | Ga0070667_100359261 | 3300005367 | Bacteria | 1320 |
| 84 | Ga0070708_100109977 | 3300005445 | Bacteria | 2532 |
| 85 | Ga0070678_100026426 | 3300005456 | Bacteria | 3924 |
| 86 | Ga0070678_100042645 | 3300005456 | Bacteria | 3227 |
| 87 | Ga0070678_100047132 | 3300005456 | Bacteria | 3095 |
| 88 | Ga0070678_100104996 | 3300005456 | Bacteria | 2198 |
| 89 | Ga0070678_100353794 | 3300005456 | Bacteria | 1263 |
| 90 | Ga0070662_100283668 | 3300005457 | Bacteria | 1341 |
| 91 | Ga0068867_100000605 | 3300005459 | Bacteria | 23775 |
| 92 | Ga0068867_100000894 | 3300005459 | Bacteria | 20205 |
| 93 | Ga0068867_100021133 | 3300005459 | Bacteria | 4643 |
| 94 | Ga0068867_100254403 | 3300005459 | Bacteria | 1429 |
| 95 | Ga0070685_10056448 | 3300005466 | Bacteria | 2283 |
| 96 | Ga0070707_100232859 | 3300005468 | Bacteria | 1793 |
| 97 | Ga0070698_100236216 | 3300005471 | Bacteria | 1761 |
| 98 | Ga0068853_100033463 | 3300005539 | Bacteria | 4362 |
| 99 | Ga0070672_100007091 | 3300005543 | Bacteria | 7582 |
| 100 | Ga0070672_100010703 | 3300005543 | Bacteria | 6372 |
| 101 | Ga0070672_100025245 | 3300005543 | Bacteria | 4405 |
| 102 | Ga0070672_100029290 | 3300005543 | Bacteria | 4128 |
| 103 | Ga0070672_100057538 | 3300005543 | Bacteria | 3052 |
| 104 | Ga0070672_100261860 | 3300005543 | Bacteria | 1458 |
| 105 | Ga0070665_100043957 | 3300005548 | Bacteria | 4487 |
| 106 | Ga0070665_100144258 | 3300005548 | Bacteria | 2384 |
| 107 | Ga0068855_100387551 | 3300005563 | Bacteria | 1533 |
| 108 | Ga0068855_100603894 | 3300005563 | Bacteria | 1183 |
| 109 | Ga0070664_100059502 | 3300005564 | Bacteria | 3250 |
| 110 | Ga0068857_100028700 | 3300005577 | Bacteria | 4909 |
| 111 | Ga0068854_100047028 | 3300005578 | Bacteria | 3074 |
| 112 | Ga0068854_100122843 | 3300005578 | Bacteria | 1974 |
| 113 | Ga0068854_100292743 | 3300005578 | Bacteria | 1314 |
| 114 | Ga0068856_100000135 | 3300005614 | Bacteria | 74419 |
| 115 | Ga0068856_100363585 | 3300005614 | Bacteria | 1466 |
| 116 | Ga0070702_100142839 | 3300005615 | Bacteria | 1527 |
| 117 | Ga0068852_100008007 | 3300005616 | Bacteria | 7750 |
| 118 | Ga0068852_100056475 | 3300005616 | Bacteria | 3393 |
| 119 | Ga0068852_100096238 | 3300005616 | Bacteria | 2661 |
| 120 | Ga0068852_100215107 | 3300005616 | Bacteria | 1825 |
| 121 | Ga0068859_100009696 | 3300005617 | Bacteria | 9722 |
| 122 | Ga0068859_100028192 | 3300005617 | Bacteria | 5630 |
| 123 | Ga0068859_100032738 | 3300005617 | Bacteria | 5222 |
| 124 | Ga0068859_100217279 | 3300005617 | Bacteria | 1999 |
| 125 | Ga0068859_100246619 | 3300005617 | Bacteria | 1876 |
| 126 | Ga0068859_100487773 | 3300005617 | Bacteria | 1327 |
| 127 | Ga0068864_100000417 | 3300005618 | Bacteria | 36778 |
| 128 | Ga0068864_100030569 | 3300005618 | Bacteria | 4565 |
| 129 | Ga0068864_100039478 | 3300005618 | Bacteria | 4035 |
| 130 | Ga0068864_100055221 | 3300005618 | Bacteria | 3428 |
| 131 | Ga0068861_100019088 | 3300005719 | Bacteria | 4895 |
| 132 | Ga0068851_10098115 | 3300005834 | Bacteria | 1551 |
| 133 | Ga0068863_100002056 | 3300005841 | Bacteria | 19934 |
| 134 | Ga0068863_100067684 | 3300005841 | Bacteria | 3378 |
| 135 | Ga0068863_100085003 | 3300005841 | Bacteria | 2998 |
| 136 | Ga0068863_100238659 | 3300005841 | Bacteria | 1754 |
| 137 | Ga0068858_100000623 | 3300005842 | Bacteria | 36873 |
| 138 | Ga0068858_100003411 | 3300005842 | Bacteria | 15804 |
| 139 | Ga0068860_100000384 | 3300005843 | Bacteria | 57893 |
| 140 | Ga0068860_100022528 | 3300005843 | Bacteria | 6092 |
| 141 | Ga0068860_100159526 | 3300005843 | Bacteria | 2174 |
| 142 | Ga0068860_100189057 | 3300005843 | Bacteria | 1992 |
| 143 | Ga0068862_100037567 | 3300005844 | Bacteria | 4104 |
| 144 | Ga0068862_100052355 | 3300005844 | Bacteria | 3492 |
| 145 | Ga0068862_100119832 | 3300005844 | Bacteria | 2318 |
| 146 | Ga0075364_10188644 | 3300006051 | Bacteria | 1396 |
| 147 | Ga0075362_10014222 | 3300006177 | Bacteria | 3207 |
| 148 | Ga0075366_10037604 | 3300006195 | Bacteria | 2858 |
| 149 | Ga0097621_100017545 | 3300006237 | Bacteria | 5438 |
| 150 | Ga0097621_100060883 | 3300006237 | Bacteria | 3095 |
| 151 | Ga0075370_10002303 | 3300006353 | Bacteria | 8807 |
| 152 | Ga0075370_10011470 | 3300006353 | Bacteria | 4658 |
| 153 | Ga0075370_10012670 | 3300006353 | Bacteria | 4463 |
| 154 | Ga0075370_10031800 | 3300006353 | Bacteria | 2947 |
| 155 | Ga0075370_10063470 | 3300006353 | Bacteria | 2106 |
| 156 | Ga0068871_100088309 | 3300006358 | Bacteria | 2579 |
| 157 | Ga0068871_100241557 | 3300006358 | Bacteria | 1570 |
| 158 | Ga0068871_100341752 | 3300006358 | Bacteria | 1322 |
| 159 | Ga0068865_100002745 | 3300006881 | Bacteria | 10461 |
| 160 | Ga0068865_100015159 | 3300006881 | Bacteria | 4911 |
| 161 | Ga0068865_100299383 | 3300006881 | Bacteria | 1287 |
| 162 | Ga0097620_100009697 | 3300006931 | Bacteria | 9722 |
| 163 | Ga0097620_100028192 | 3300006931 | Bacteria | 5630 |
| 164 | Ga0097620_100032737 | 3300006931 | Bacteria | 5222 |
| 165 | Ga0097620_100217284 | 3300006931 | Bacteria | 1999 |
| 166 | Ga0097620_100246607 | 3300006931 | Bacteria | 1876 |
| 167 | Ga0097620_100487784 | 3300006931 | Bacteria | 1327 |
| 168 | Ga0099823_1000005 | 3300006944 | Bacteria | 139631 |
| 169 | Ga0105240_10021539 | 3300009093 | Bacteria | 8571 |
| 170 | Ga0105240_10075146 | 3300009093 | Bacteria | 4168 |
| 171 | Ga0105240_10588401 | 3300009093 | Bacteria | 1227 |
| 172 | Ga0105245_10036547 | 3300009098 | Bacteria | 4363 |
| 173 | Ga0114129_10307047 | 3300009147 | Bacteria | 2113 |
| 174 | Ga0105243_10041667 | 3300009148 | Bacteria | 3590 |
| 175 | Ga0105248_10001355 | 3300009177 | Bacteria | 27299 |
| 176 | Ga0105248_10135531 | 3300009177 | Bacteria | 2777 |
| 177 | Ga0105248_10277354 | 3300009177 | Bacteria | 1887 |
| 178 | Ga0105237_10040414 | 3300009545 | Bacteria | 4703 |
| 179 | Ga0105238_10371942 | 3300009551 | Bacteria | 1419 |
| 180 | Ga0105249_10009800 | 3300009553 | Bacteria | 8395 |
| 181 | Ga0105249_10017117 | 3300009553 | Bacteria | 6433 |
| 182 | Ga0105249_10143456 | 3300009553 | Bacteria | 2292 |
| 183 | Ga0105239_10032539 | 3300010375 | Bacteria | 5730 |
| 184 | Ga0105246_10038570 | 3300011119 | Bacteria | 3214 |
| 185 | Ga0105246_10066071 | 3300011119 | Bacteria | 2531 |
| 186 | Ga0157319_1000005 | 3300012497 | Bacteria | 372810 |
| 187 | Ga0157371_10119517 | 3300013102 | Bacteria | 1873 |
| 188 | Ga0157369_10267036 | 3300013105 | Bacteria | 1784 |
| 189 | Ga0157374_10045256 | 3300013296 | Bacteria | 4073 |
| 190 | Ga0157378_10047529 | 3300013297 | Bacteria | 3816 |
| 191 | Ga0157378_10294993 | 3300013297 | Bacteria | 1567 |
| 192 | Ga0163162_10001355 | 3300013306 | Bacteria | 22806 |
| 193 | Ga0163162_10253456 | 3300013306 | Bacteria | 1892 |
| 194 | Ga0163162_10437556 | 3300013306 | Bacteria | 1440 |
| 195 | Ga0157372_10140135 | 3300013307 | Bacteria | 2785 |
| 196 | Ga0157375_10002767 | 3300013308 | Bacteria | 15170 |
| 197 | Ga0157375_10040833 | 3300013308 | Bacteria | 4475 |
| 198 | Ga0157375_10228383 | 3300013308 | Bacteria | 2020 |
| 199 | Ga0157375_10342988 | 3300013308 | Bacteria | 1659 |
| 200 | Ga0163163_10003807 | 3300014325 | Bacteria | 12851 |
| 201 | Ga0163163_10108170 | 3300014325 | Bacteria | 2807 |
| 202 | Ga0157380_10000770 | 3300014326 | Bacteria | 20027 |
| 203 | Ga0157380_10012894 | 3300014326 | Bacteria | 6076 |
| 204 | Ga0157377_10092392 | 3300014745 | Bacteria | 1789 |
| 205 | Ga0157379_10004392 | 3300014968 | Bacteria | 12073 |
| 206 | Ga0157379_10032133 | 3300014968 | Bacteria | 4678 |
| 207 | Ga0157379_10193293 | 3300014968 | Bacteria | 1839 |
| 208 | Ga0157379_10254376 | 3300014968 | Bacteria | 1595 |
| 209 | Ga0157376_10025992 | 3300014969 | Bacteria | 4620 |
| 210 | Ga0157376_10121960 | 3300014969 | Bacteria | 2312 |
| 211 | Ga0163161_10021715 | 3300017792 | Bacteria | 4512 |
| 212 | Ga0163161_10117770 | 3300017792 | Bacteria | 1993 |
| 213 | Ga0163161_10214086 | 3300017792 | Bacteria | 1489 |
| 214 | Ga0213872_10000033 | 3300021361 | Bacteria | 135667 |
| 215 | Ga0213872_10000258 | 3300021361 | Bacteria | 46050 |
| 216 | Ga0213872_10001003 | 3300021361 | Bacteria | 19713 |
| 217 | Ga0213872_10004509 | 3300021361 | Bacteria | 7376 |
| 218 | Ga0213872_10012188 | 3300021361 | Bacteria | 4053 |
| 219 | Ga0213872_10021274 | 3300021361 | Bacteria | 2987 |
| 220 | Ga0209674_100015 | 3300025226 | Bacteria | 697299 |
| 221 | Ga0209563_100017 | 3300025230 | Bacteria | 796449 |
| 222 | Ga0207427_100444 | 3300025231 | Bacteria | 22994 |
| 223 | Ga0209258_100025 | 3300025242 | Bacteria | 534777 |
| 224 | Ga0209258_100726 | 3300025242 | Bacteria | 21958 |
| 225 | Ga0207425_1000570 | 3300025245 | Bacteria | 21658 |
| 226 | Ga0209646_1000438 | 3300025246 | Bacteria | 22604 |
| 227 | Ga0209026_1000028 | 3300025250 | Bacteria | 341399 |
| 228 | Ga0209677_100037 | 3300025253 | Bacteria | 286702 |
| 229 | Ga0209677_100113 | 3300025253 | Bacteria | 84174 |
| 230 | Ga0209148_1002792 | 3300025254 | Bacteria | 5458 |
| 231 | Ga0209759_1000021 | 3300025256 | Bacteria | 341399 |
| 232 | Ga0209759_1001016 | 3300025256 | Bacteria | 18856 |
| 233 | Ga0209759_1005783 | 3300025256 | Bacteria | 4254 |
| 234 | Ga0209129_1000158 | 3300025258 | Bacteria | 103711 |
| 235 | Ga0209455_1000166 | 3300025272 | Bacteria | 113101 |
| 236 | Ga0209673_1008551 | 3300025273 | Bacteria | 4544 |
| 237 | Ga0209673_1008988 | 3300025273 | Bacteria | 4388 |
| 238 | Ga0209673_1023905 | 3300025273 | Bacteria | 2067 |
| 239 | Ga0209564_1000021 | 3300025295 | Bacteria | 571316 |
| 240 | Ga0209564_1000282 | 3300025295 | Bacteria | 103837 |
| 241 | Ga0209758_1000910 | 3300025297 | Bacteria | 40059 |
| 242 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 243 | Ga0209050_1001406 | 3300025298 | Bacteria | 26103 |
| 244 | Ga0209050_1002179 | 3300025298 | Bacteria | 17697 |
| 245 | Ga0209256_1000309 | 3300025299 | Bacteria | 85294 |
| 246 | Ga0209256_1001207 | 3300025299 | Bacteria | 28954 |
| 247 | Ga0209051_1000621 | 3300025303 | Bacteria | 40763 |
| 248 | Ga0209051_1023640 | 3300025303 | Bacteria | 2549 |
| 249 | Ga0209051_1026424 | 3300025303 | Bacteria | 2340 |
| 250 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 251 | Ga0209257_1000981 | 3300025304 | Bacteria | 38736 |
| 252 | Ga0209257_1003138 | 3300025304 | Bacteria | 14743 |
| 253 | Ga0207697_10014915 | 3300025315 | Bacteria | 3217 |
| 254 | Ga0207697_10077095 | 3300025315 | Bacteria | 1401 |
| 255 | Ga0207682_10013002 | 3300025893 | Bacteria | 3245 |
| 256 | Ga0207682_10051761 | 3300025893 | Bacteria | 1701 |
| 257 | Ga0207682_10115245 | 3300025893 | Bacteria | 1187 |
| 258 | Ga0207680_10031399 | 3300025903 | Bacteria | 3008 |
| 259 | Ga0207645_10026636 | 3300025907 | Bacteria | 3735 |
| 260 | Ga0207645_10064121 | 3300025907 | Bacteria | 2348 |
| 261 | Ga0207645_10117738 | 3300025907 | Bacteria | 1723 |
| 262 | Ga0207645_10161951 | 3300025907 | Bacteria | 1464 |
| 263 | Ga0207705_10057983 | 3300025909 | Bacteria | 2794 |
| 264 | Ga0207705_10127801 | 3300025909 | Bacteria | 1890 |
| 265 | Ga0207695_10007014 | 3300025913 | Bacteria | 14454 |
| 266 | Ga0207662_10013189 | 3300025918 | Bacteria | 4619 |
| 267 | Ga0207657_10063014 | 3300025919 | Bacteria | 3172 |
| 268 | Ga0207681_10003110 | 3300025923 | Bacteria | 10434 |
| 269 | Ga0207681_10009514 | 3300025923 | Bacteria | 5939 |
| 270 | Ga0207681_10033819 | 3300025923 | Bacteria | 3356 |
| 271 | Ga0207681_10044386 | 3300025923 | Bacteria | 2978 |
| 272 | Ga0207650_10003543 | 3300025925 | Bacteria | 10711 |
| 273 | Ga0207650_10003734 | 3300025925 | Bacteria | 10416 |
| 274 | Ga0207650_10026247 | 3300025925 | Bacteria | 4154 |
| 275 | Ga0207650_10056215 | 3300025925 | Bacteria | 2923 |
| 276 | Ga0207650_10197233 | 3300025925 | Bacteria | 1611 |
| 277 | Ga0207659_10003530 | 3300025926 | Bacteria | 9403 |
| 278 | Ga0207659_10035289 | 3300025926 | Bacteria | 3455 |
| 279 | Ga0207659_10231274 | 3300025926 | Bacteria | 1491 |
| 280 | Ga0207687_10078434 | 3300025927 | Bacteria | 2378 |
| 281 | Ga0207644_10004378 | 3300025931 | Bacteria | 9165 |
| 282 | Ga0207644_10017792 | 3300025931 | Bacteria | 4806 |
| 283 | Ga0207644_10030001 | 3300025931 | Bacteria | 3776 |
| 284 | Ga0207644_10049302 | 3300025931 | Bacteria | 3014 |
| 285 | Ga0207644_10077953 | 3300025931 | Bacteria | 2441 |
| 286 | Ga0207644_10158005 | 3300025931 | Bacteria | 1760 |
| 287 | Ga0207690_10009309 | 3300025932 | Bacteria | 5835 |
| 288 | Ga0207706_10022227 | 3300025933 | Bacteria | 5692 |
| 289 | Ga0207709_10018575 | 3300025935 | Bacteria | 3895 |
| 290 | Ga0207669_10003005 | 3300025937 | Bacteria | 7255 |
| 291 | Ga0207669_10007396 | 3300025937 | Bacteria | 5076 |
| 292 | Ga0207669_10161409 | 3300025937 | Bacteria | 1583 |
| 293 | Ga0207704_10005637 | 3300025938 | Bacteria | 5780 |
| 294 | Ga0207665_10198954 | 3300025939 | Bacteria | 1459 |
| 295 | Ga0207691_10001767 | 3300025940 | Bacteria | 21287 |
| 296 | Ga0207691_10030328 | 3300025940 | Bacteria | 5055 |
| 297 | Ga0207691_10108313 | 3300025940 | Bacteria | 2473 |
| 298 | Ga0207691_10129705 | 3300025940 | Bacteria | 2228 |
| 299 | Ga0207691_10139772 | 3300025940 | Bacteria | 2135 |
| 300 | Ga0207691_10354139 | 3300025940 | Bacteria | 1256 |
| 301 | Ga0207711_10044865 | 3300025941 | Bacteria | 3775 |
| 302 | Ga0207711_10115954 | 3300025941 | Bacteria | 2387 |
| 303 | Ga0207689_10012906 | 3300025942 | Bacteria | 7135 |
| 304 | Ga0207689_10030198 | 3300025942 | Bacteria | 4516 |
| 305 | Ga0207689_10037320 | 3300025942 | Bacteria | 4030 |
| 306 | Ga0207661_10206010 | 3300025944 | Bacteria | 1731 |
| 307 | Ga0207679_10128306 | 3300025945 | Bacteria | 2030 |
| 308 | Ga0207667_10003517 | 3300025949 | Bacteria | 19368 |
| 309 | Ga0207651_10006968 | 3300025960 | Bacteria | 5982 |
| 310 | Ga0207651_10051694 | 3300025960 | Bacteria | 2797 |
| 311 | Ga0207651_10173828 | 3300025960 | Bacteria | 1701 |
| 312 | Ga0207712_10009930 | 3300025961 | Bacteria | 6033 |
| 313 | Ga0207712_10036308 | 3300025961 | Bacteria | 3355 |
| 314 | Ga0207668_10004050 | 3300025972 | Bacteria | 8618 |
| 315 | Ga0207668_10012878 | 3300025972 | Bacteria | 5133 |
| 316 | Ga0207640_10054762 | 3300025981 | Bacteria | 2609 |
| 317 | Ga0207640_10252651 | 3300025981 | Bacteria | 1369 |
| 318 | Ga0207658_10041491 | 3300025986 | Bacteria | 3332 |
| 319 | Ga0207658_10046347 | 3300025986 | Bacteria | 3174 |
| 320 | Ga0207658_10053839 | 3300025986 | Bacteria | 2975 |
| 321 | Ga0207658_10136908 | 3300025986 | Bacteria | 1976 |
| 322 | Ga0207677_10001217 | 3300026023 | Bacteria | 13897 |
| 323 | Ga0207677_10314377 | 3300026023 | Bacteria | 1299 |
| 324 | Ga0207703_10001480 | 3300026035 | Bacteria | 21402 |
| 325 | Ga0207703_10003280 | 3300026035 | Bacteria | 13574 |
| 326 | Ga0207703_10041044 | 3300026035 | Bacteria | 3706 |
| 327 | Ga0207639_10384146 | 3300026041 | Bacteria | 1262 |
| 328 | Ga0207678_10075599 | 3300026067 | Bacteria | 2885 |
| 329 | Ga0207708_10071425 | 3300026075 | Bacteria | 2659 |
| 330 | Ga0207702_10001523 | 3300026078 | Bacteria | 22929 |
| 331 | Ga0207641_10001533 | 3300026088 | Bacteria | 22637 |
| 332 | Ga0207641_10084659 | 3300026088 | Bacteria | 2761 |
| 333 | Ga0207641_10122414 | 3300026088 | Bacteria | 2323 |
| 334 | Ga0207641_10211186 | 3300026088 | Bacteria | 1795 |
| 335 | Ga0207648_10002852 | 3300026089 | Bacteria | 18291 |
| 336 | Ga0207648_10004823 | 3300026089 | Bacteria | 13753 |
| 337 | Ga0207648_10309506 | 3300026089 | Bacteria | 1418 |
| 338 | Ga0207676_10001762 | 3300026095 | Bacteria | 15863 |
| 339 | Ga0207676_10016482 | 3300026095 | Bacteria | 5351 |
| 340 | Ga0207676_10027619 | 3300026095 | Bacteria | 4229 |
| 341 | Ga0207676_10176523 | 3300026095 | Bacteria | 1866 |
| 342 | Ga0207676_10326529 | 3300026095 | Bacteria | 1410 |
| 343 | Ga0207674_10016268 | 3300026116 | Bacteria | 8147 |
| 344 | Ga0207675_100022931 | 3300026118 | Bacteria | 5806 |
| 345 | Ga0207675_100025649 | 3300026118 | Bacteria | 5486 |
| 346 | Ga0207675_100029708 | 3300026118 | Bacteria | 5090 |
| 347 | Ga0207683_10035185 | 3300026121 | Bacteria | 4356 |
| 348 | Ga0207683_10051334 | 3300026121 | Bacteria | 3613 |
| 349 | Ga0207683_10080447 | 3300026121 | Bacteria | 2891 |
| 350 | Ga0207683_10209698 | 3300026121 | Bacteria | 1773 |
| 351 | Ga0207683_10437389 | 3300026121 | Bacteria | 1205 |
| 352 | Ga0207698_10090138 | 3300026142 | Bacteria | 2507 |
| 353 | Ga0207698_10119948 | 3300026142 | Bacteria | 2224 |
| 354 | Ga0207698_10120403 | 3300026142 | Bacteria | 2220 |
| 355 | Ga0207698_10413613 | 3300026142 | Bacteria | 1292 |
| 356 | Ga0209371_1010421 | 3300027312 | Bacteria | 2859 |
| 357 | Ga0268266_10030341 | 3300028379 | Bacteria | 4593 |
| 358 | Ga0268266_10496090 | 3300028379 | Bacteria | 1165 |
| 359 | Ga0268265_10003306 | 3300028380 | Bacteria | 11674 |
| 360 | Ga0268265_10014091 | 3300028380 | Bacteria | 5449 |
| 361 | Ga0268265_10027800 | 3300028380 | Bacteria | 4041 |
| 362 | Ga0268265_10397931 | 3300028380 | Bacteria | 1272 |
| 363 | Ga0268264_10001034 | 3300028381 | Bacteria | 27952 |
| 364 | Ga0268264_10019856 | 3300028381 | Bacteria | 5490 |
| 365 | Ga0265336_10000274 | 3300028666 | Bacteria | 36140 |
| 366 | Ga0307517_10004429 | 3300028786 | Bacteria | 21580 |
| 367 | Ga0307517_10058934 | 3300028786 | Bacteria | 3687 |
| 368 | Ga0307517_10072069 | 3300028786 | Bacteria | 3085 |
| 369 | Ga0307517_10149179 | 3300028786 | Bacteria | 1611 |
| 370 | Ga0307515_10000139 | 3300028794 | Bacteria | 173074 |
| 371 | Ga0307515_10005664 | 3300028794 | Bacteria | 25227 |
| 372 | Ga0307515_10005936 | 3300028794 | Bacteria | 24621 |
| 373 | Ga0307515_10007880 | 3300028794 | Bacteria | 20929 |
| 374 | Ga0307515_10011641 | 3300028794 | Bacteria | 16669 |
| 375 | Ga0307515_10117134 | 3300028794 | Bacteria | 3052 |
| 376 | Ga0268256_1013843 | 3300030500 | Bacteria | 2421 |
| 377 | Ga0307512_10010416 | 3300030522 | Bacteria | 8867 |
| 378 | Ga0265328_10037268 | 3300031239 | Bacteria | 1796 |
| 379 | Ga0265327_10000080 | 3300031251 | Bacteria | 206086 |
| 380 | Ga0265327_10000925 | 3300031251 | Bacteria | 42948 |
| 381 | Ga0265316_10000176 | 3300031344 | Bacteria | 72297 |
| 382 | Ga0307513_10005821 | 3300031456 | Bacteria | 16188 |
| 383 | Ga0307513_10046962 | 3300031456 | Bacteria | 4702 |
| 384 | Ga0307513_10078619 | 3300031456 | Bacteria | 3411 |
| 385 | Ga0307513_10084122 | 3300031456 | Bacteria | 3269 |
| 386 | Ga0307513_10139805 | 3300031456 | Bacteria | 2350 |
| 387 | Ga0307513_10361315 | 3300031456 | Bacteria | 1197 |
| 388 | Ga0307509_10000698 | 3300031507 | Bacteria | 57430 |
| 389 | Ga0307509_10012484 | 3300031507 | Bacteria | 10158 |
| 390 | Ga0307509_10020734 | 3300031507 | Bacteria | 7456 |
| 391 | Ga0307509_10024647 | 3300031507 | Bacteria | 6733 |
| 392 | Ga0307509_10039083 | 3300031507 | Bacteria | 5172 |
| 393 | Ga0307408_100000012 | 3300031548 | Bacteria | 408153 |
| 394 | Ga0307408_100021576 | 3300031548 | Bacteria | 4361 |
| 395 | Ga0307408_100032641 | 3300031548 | Bacteria | 3631 |
| 396 | Ga0307408_100111052 | 3300031548 | Bacteria | 2106 |
| 397 | Ga0307408_100140014 | 3300031548 | Bacteria | 1898 |
| 398 | Ga0307508_10000144 | 3300031616 | Bacteria | 84437 |
| 399 | Ga0307508_10000504 | 3300031616 | Bacteria | 46711 |
| 400 | Ga0307508_10010113 | 3300031616 | Bacteria | 8641 |
| 401 | Ga0307514_10000339 | 3300031649 | Bacteria | 111130 |
| 402 | Ga0307514_10002566 | 3300031649 | Bacteria | 18663 |
| 403 | Ga0307514_10088726 | 3300031649 | Bacteria | 2262 |
| 404 | Ga0307514_10125861 | 3300031649 | Bacteria | 1776 |
| 405 | Ga0307514_10207005 | 3300031649 | Bacteria | 1224 |
| 406 | Ga0307516_10000107 | 3300031730 | Bacteria | 95288 |
| 407 | Ga0307516_10006214 | 3300031730 | Bacteria | 14051 |
| 408 | Ga0307516_10053910 | 3300031730 | Bacteria | 3931 |
| 409 | Ga0307405_10005943 | 3300031731 | Bacteria | 5954 |
| 410 | Ga0307405_10012518 | 3300031731 | Bacteria | 4495 |
| 411 | Ga0307405_10016930 | 3300031731 | Bacteria | 3989 |
| 412 | Ga0307413_10019690 | 3300031824 | Bacteria | 3572 |
| 413 | Ga0307413_10024211 | 3300031824 | Bacteria | 3306 |
| 414 | Ga0307410_10044932 | 3300031852 | Bacteria | 2937 |
| 415 | Ga0307410_10298618 | 3300031852 | Bacteria | 1270 |
| 416 | Ga0307406_10000570 | 3300031901 | Bacteria | 21267 |
| 417 | Ga0307406_10031616 | 3300031901 | Bacteria | 3224 |
| 418 | Ga0307406_10041963 | 3300031901 | Bacteria | 2854 |
| 419 | Ga0307407_10049525 | 3300031903 | Bacteria | 2398 |
| 420 | Ga0307412_10005099 | 3300031911 | Bacteria | 7347 |
| 421 | Ga0307412_10043869 | 3300031911 | Bacteria | 2915 |
| 422 | Ga0307409_100001339 | 3300031995 | Bacteria | 11962 |
| 423 | Ga0307409_100002252 | 3300031995 | Bacteria | 9977 |
| 424 | Ga0307409_100003361 | 3300031995 | Bacteria | 8671 |
| 425 | Ga0307416_100004764 | 3300032002 | Bacteria | 8238 |
| 426 | Ga0307416_100019414 | 3300032002 | Bacteria | 4818 |
| 427 | Ga0307416_100019721 | 3300032002 | Bacteria | 4789 |
| 428 | Ga0307414_10035032 | 3300032004 | Bacteria | 3336 |
| 429 | Ga0307414_10287164 | 3300032004 | Bacteria | 1385 |
| 430 | Ga0307411_10002089 | 3300032005 | Bacteria | 8612 |
| 431 | Ga0307411_10011812 | 3300032005 | Bacteria | 4733 |
| 432 | Ga0307415_100000470 | 3300032126 | Bacteria | 17433 |
| 433 | Ga0307507_10027415 | 3300033179 | Bacteria | 6106 |
| 434 | Ga0307510_10000426 | 3300033180 | Bacteria | 40466 |
| 435 | Ga0307510_10033683 | 3300033180 | Bacteria | 5750 |
| 436 | Ga0373959_0004852 | 3300034820 | Bacteria | 2186 |
| 437 | Ga0373940_0005138 | 3300035088 | Bacteria | 2819 |
| 438 | Ga0373936_0106403 | 3300035113 | Bacteria | 1188 |
| 439 | Ga0373939_0000047 | 3300035114 | Bacteria | 43790 |
| 440 | Ga0373960_0001152 | 3300035121 | Bacteria | 5741 |
| 441 | Ga0373955_0041338 | 3300035172 | Bacteria | 2471 |
| 442 | Ga0373961_0034780 | 3300035241 | Bacteria | 1426 |
| 443 | Ga0373931_0000579 | 3300035691 | Bacteria | 15108 |
| 444 | Ga0373947_0031882 | 3300035725 | Bacteria | 3104 |
| 445 | Ga0395898_0028823 | 3300037466 | Bacteria | 5565 |
| 446 | Ga0395905_0000504 | 3300037471 | Bacteria | 53598 |
| 447 | Ga0395905_0005103 | 3300037471 | Bacteria | 13496 |
| 448 | Ga0395905_0005387 | 3300037471 | Bacteria | 13076 |
| 449 | Ga0395905_0034159 | 3300037471 | Bacteria | 4774 |
| 450 | Ga0395901_0006507 | 3300038443 | Bacteria | 11821 |
| 451 | Ga0436361_0027317 | 3300039447 | Bacteria | 79578 |
| 452 | Ga0436361_0156562 | 3300039447 | Bacteria | 6162 |
| 453 | Ga0436361_0264437 | 3300039447 | Bacteria | 60444 |
| 454 | Ga0436361_0272384 | 3300039447 | Bacteria | 13210 |
| 455 | Ga0436361_0301682 | 3300039447 | Bacteria | 5184 |
| 456 | Ga0436361_0430065 | 3300039447 | Bacteria | 23088 |
| 457 | Ga0439437_003678 | 3300042000 | Bacteria | 1657 |
| 458 | Ga0439449_0034397 | 3300042007 | Bacteria | 1887 |
| 459 | Ga0450917_002083 | 3300042120 | Bacteria | 1425 |
| 460 | Ga0450888_000258 | 3300042126 | Bacteria | 4916 |
| 461 | Ga0450890_000482 | 3300042127 | Bacteria | 5846 |
| 462 | Ga0450894_010305 | 3300042131 | Bacteria | 1213 |
| 463 | Ga0450900_004838 | 3300042136 | Bacteria | 1567 |
| 464 | Ga0450889_000025 | 3300042144 | Bacteria | 12924 |
| 465 | Ga0439444_0003978 | 3300042437 | Bacteria | 2118 |
| 466 | Ga0439459_0000990 | 3300042438 | Bacteria | 4030 |
| 467 | Ga0450901_008153 | 3300042533 | Bacteria | 1078 |
| 468 | Ga0451577_0018745 | 3300042876 | Bacteria | 6367 |
| 469 | Ga0466969_0000018 | 3300044656 | Bacteria | 102911 |
| 470 | Ga0466969_0020123 | 3300044656 | Bacteria | 3459 |
| 471 | Ga0466972_0000630 | 3300044658 | Bacteria | 17098 |
| 472 | Ga0466965_0031086 | 3300044683 | Bacteria | 2602 |
| 473 | Ga0466966_0038581 | 3300044684 | Bacteria | 3078 |
| 474 | Ga0466961_0015398 | 3300044693 | Bacteria | 4910 |
| 475 | Ga0466961_0016802 | 3300044693 | Bacteria | 4704 |
| 476 | Ga0466963_0017494 | 3300044694 | Bacteria | 4469 |
| 477 | Ga0466964_0003947 | 3300044706 | Bacteria | 5451 |
| 478 | Ga0453684_0008286 | 3300044712 | Bacteria | 18722 |
| 479 | Ga0453684_0026097 | 3300044712 | Bacteria | 8456 |
| 480 | Ga0453684_0249527 | 3300044712 | Bacteria | 2039 |
| 481 | Ga0453684_0280678 | 3300044712 | Bacteria | 1900 |
| 482 | Ga0466968_0092433 | 3300044735 | Bacteria | 1343 |
| 483 | Ga0466970_0095863 | 3300044765 | Bacteria | 1613 |
| 484 | Ga0466960_0088834 | 3300044901 | Bacteria | 1571 |
| 485 | Ga0466959_0031472 | 3300045049 | Bacteria | 3924 |
| 486 | Ga0466959_0044206 | 3300045049 | Bacteria | 3282 |
| 487 | Ga0451576_0065287 | 3300045051 | Bacteria | 3790 |
| 488 | Ga0451576_0085485 | 3300045051 | Bacteria | 3281 |
| 489 | Ga0466958_0009242 | 3300045836 | Bacteria | 5487 |
| 490 | Ga0466967_0104287 | 3300045976 | Bacteria | 2595 |
| 491 | Ga0495592_0000499 | 3300046454 | Bacteria | 28648 |
| 492 | Ga0495629_0009172 | 3300046459 | Bacteria | 7243 |
| 493 | Ga0495641_0136091 | 3300046461 | Bacteria | 1097 |
| 494 | Ga0495650_0015475 | 3300046471 | Bacteria | 3910 |
| 495 | Ga0495580_0110869 | 3300046472 | Bacteria | 1906 |
| 496 | Ga0495582_0140188 | 3300046473 | Bacteria | 1370 |
| 497 | Ga0495583_0000428 | 3300046506 | Bacteria | 63526 |
| 498 | Ga0495606_0000821 | 3300046507 | Bacteria | 47099 |
| 499 | Ga0495610_0077809 | 3300046512 | Bacteria | 1531 |
| 500 | Ga0495632_0002352 | 3300046519 | Bacteria | 14499 |
| 501 | Ga0495643_0062508 | 3300046522 | Bacteria | 1971 |
| 502 | Ga0495652_0086062 | 3300046529 | Bacteria | 2582 |
| 503 | Ga0495640_0137503 | 3300046533 | Bacteria | 1577 |
| 504 | Ga0495621_0100844 | 3300046539 | Bacteria | 1098 |
| 505 | Ga0495645_0037182 | 3300046543 | Bacteria | 3548 |
| 506 | Ga0495667_0091710 | 3300046559 | Bacteria | 1968 |
| 507 | Ga0495668_0021362 | 3300046616 | Bacteria | 3713 |
| 508 | Ga0495668_0036997 | 3300046616 | Bacteria | 2733 |
| 509 | Ga0495625_0000827 | 3300046660 | Bacteria | 42621 |
| 510 | Ga0495625_0025677 | 3300046660 | Bacteria | 4465 |
| 511 | Ga0495624_0060379 | 3300046690 | Bacteria | 2377 |
| 512 | Ga0495671_0099716 | 3300046692 | Bacteria | 1420 |
| 513 | Ga0495649_0003008 | 3300046694 | Bacteria | 11564 |
| 514 | Ga0495589_0015574 | 3300046794 | Bacteria | 3910 |
| 515 | Ga0495676_0018846 | 3300047321 | Bacteria | 6083 |
| 516 | Ga0495684_0054704 | 3300047471 | Bacteria | 3044 |
| 517 | Ga0495686_0023279 | 3300047472 | Bacteria | 4087 |
| 518 | Ga0495686_0068182 | 3300047472 | Bacteria | 2195 |
| 519 | Ga0495602_0099403 | 3300048088 | Bacteria | 2392 |
| 520 | Ga0496106_0274144 | 3300048909 | Bacteria | 1351 |
| 521 | Ga0496108_0018647 | 3300048911 | Bacteria | 5685 |
| 522 | Ga0496108_0167965 | 3300048911 | Bacteria | 1897 |
| 523 | Ga0496108_0187634 | 3300048911 | Bacteria | 1791 |
| 524 | Ga0496109_0005617 | 3300048912 | Bacteria | 10495 |
| 525 | Ga0496109_0117465 | 3300048912 | Bacteria | 2476 |
| 526 | Ga0496109_0192421 | 3300048912 | Bacteria | 1917 |
| 527 | Ga0496109_0594894 | 3300048912 | Bacteria | 1042 |
| 528 | Ga0496110_0079834 | 3300048913 | Bacteria | 2914 |
| 529 | Ga0496112_0009640 | 3300048915 | Bacteria | 8713 |
| 530 | Ga0496115_0484767 | 3300048918 | Bacteria | 995 |
| 531 | Ga0496121_0003335 | 3300048924 | Bacteria | 23043 |
| 532 | Ga0496123_0196881 | 3300048926 | Bacteria | 1037 |
| 533 | Ga0496124_0000733 | 3300048927 | Bacteria | 53604 |
| 534 | Ga0496124_0184562 | 3300048927 | Bacteria | 1602 |
| 535 | Ga0496125_0017746 | 3300048928 | Bacteria | 6774 |
| 536 | Ga0501310_002947 | 3300049130 | Bacteria | 1646 |
| 537 | Ga0501032_0126057 | 3300049569 | Bacteria | 1691 |
| 538 | Ga0501043_0000058 | 3300049579 | Bacteria | 102030 |
| 539 | Ga0501046_0000051 | 3300049580 | Bacteria | 133545 |
| 540 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 541 | Ga0501047_0139862 | 3300049581 | Bacteria | 2300 |
| 542 | Ga0501048_0001358 | 3300049582 | Bacteria | 18540 |
| 543 | Ga0501222_002025 | 3300049662 | Bacteria | 2805 |
| 544 | Ga0501227_026095 | 3300049665 | Bacteria | 1375 |
| 545 | Ga0501249_028108 | 3300049679 | Bacteria | 1246 |
| 546 | Ga0501257_036739 | 3300049686 | Bacteria | 1194 |
| 547 | Ga0501221_001011 | 3300049704 | Bacteria | 4615 |
| 548 | Ga0501272_001114 | 3300049769 | Bacteria | 2483 |
| 549 | Ga0501044_0103166 | 3300049823 | Bacteria | 2867 |
| 550 | Ga0501045_0015123 | 3300049824 | Bacteria | 5477 |
| 551 | nmdc:mga03683_21281_c1 | 3300050489 | Bacteria | 2497 |
| 552 | nmdc:mga00v17_66258_c1 | 3300050491 | Bacteria | 2229 |
| 553 | nmdc:mga0k408_21949_c1 | 3300050493 | Bacteria | 3591 |
| 554 | nmdc:mga0k408_53141_c1 | 3300050493 | Bacteria | 2347 |
| 555 | nmdc:mga0k408_63486_c1 | 3300050493 | Bacteria | 2149 |
| 556 | nmdc:mga06z11_286471_c1 | 3300050494 | Bacteria | 977 |
| 557 | nmdc:mga07m45_2998_c2 | 3300050496 | Bacteria | 6530 |
| 558 | nmdc:mga07m45_3233_c1 | 3300050496 | Bacteria | 7824 |
| 559 | nmdc:mga07m45_4373_c1 | 3300050496 | Bacteria | 6914 |
| 560 | nmdc:mga07m45_51896_c1 | 3300050496 | Bacteria | 2314 |
| 561 | nmdc:mga07m45_54858_c1 | 3300050496 | Bacteria | 2252 |
| 562 | nmdc:mga07m45_56544_c1 | 3300050496 | Bacteria | 2218 |
| 563 | nmdc:mga07m45_58492_c1 | 3300050496 | Bacteria | 2181 |
| 564 | Ga0495601_0307002 | 3300053077 | Bacteria | 1033 |
| 565 | Ga0500635_0000070 | 3300053080 | Bacteria | 67480 |
| 566 | Ga0500635_0052561 | 3300053080 | Bacteria | 1399 |
| 567 | Ga0500578_0000417 | 3300053086 | Bacteria | 52045 |
| 568 | Ga0500578_0008111 | 3300053086 | Bacteria | 6880 |
| 569 | Ga0500644_0003385 | 3300053088 | Bacteria | 3942 |
| 570 | Ga0500651_0081697 | 3300053093 | Bacteria | 2001 |
| 571 | Ga0500651_0266064 | 3300053093 | Bacteria | 992 |
| 572 | Ga0500650_0022212 | 3300053098 | Bacteria | 2806 |
| 573 | Ga0500562_015491 | 3300053108 | Bacteria | 1956 |
| 574 | Ga0500652_001084 | 3300053131 | Bacteria | 8794 |
| 575 | Ga0500652_035357 | 3300053131 | Bacteria | 1984 |
| 576 | Ga0500652_089641 | 3300053131 | Bacteria | 1284 |
| 577 | Ga0500655_010765 | 3300053133 | Bacteria | 1653 |
| 578 | Ga0500655_010982 | 3300053133 | Bacteria | 1637 |
| 579 | Ga0500658_0128773 | 3300053134 | Bacteria | 1127 |
| 580 | Ga0500559_0000097 | 3300053136 | Bacteria | 70124 |
| 581 | Ga0500568_0006967 | 3300053139 | Bacteria | 5601 |
| 582 | Ga0500568_0007565 | 3300053139 | Bacteria | 5316 |
| 583 | Ga0500577_0030338 | 3300053142 | Bacteria | 1881 |
| 584 | Ga0500604_0044551 | 3300053151 | Bacteria | 1351 |
| 585 | Ga0500604_0066152 | 3300053151 | Bacteria | 1144 |
| 586 | Ga0500619_005187 | 3300053154 | Bacteria | 2879 |
| 587 | Ga0500622_0000198 | 3300053156 | Bacteria | 63633 |
| 588 | Ga0500622_0005699 | 3300053156 | Bacteria | 7404 |
| 589 | Ga0500622_0008142 | 3300053156 | Bacteria | 5890 |
| 590 | Ga0500636_0032479 | 3300053177 | Bacteria | 3089 |
| 591 | Ga0500587_000996 | 3300053739 | Bacteria | 3825 |
| 592 | Ga0500661_016932 | 3300055283 | Bacteria | 1302 |
| 593 | Ga0466962_0029907 | 3300061719 | Bacteria | 2607 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10006249 | rootH1_100062494 | 229 |
| 2 | 3300053093 | Ga0500651_0081697 | Ga0500651_0081697_23_808 | 234 |
| 3 | 3300048926 | Ga0496123_0196881 | Ga0496123_0196881_29_883 | 249 |
| 4 | 3300031548 | Ga0307408_100032641 | Ga0307408_1000326415 | 251 |
| 5 | 3300031731 | Ga0307405_10005943 | Ga0307405_100059437 | 251 |
| 6 | 3300031824 | Ga0307413_10024211 | Ga0307413_100242112 | 251 |
| 7 | 3300031852 | Ga0307410_10044932 | Ga0307410_100449322 | 251 |
| 8 | 3300031901 | Ga0307406_10000570 | Ga0307406_1000057010 | 251 |
| 9 | 3300031911 | Ga0307412_10043869 | Ga0307412_100438692 | 251 |
| 10 | 3300031995 | Ga0307409_100003361 | Ga0307409_1000033612 | 251 |
| 11 | 3300032002 | Ga0307416_100004764 | Ga0307416_1000047643 | 251 |
| 12 | 3300032005 | Ga0307411_10002089 | Ga0307411_100020893 | 251 |
| 13 | 3300032126 | Ga0307415_100000470 | Ga0307415_10000047014 | 251 |
| 14 | 3300046539 | Ga0495621_0100844 | Ga0495621_0100844_32_856 | 252 |
| 15 | 3300048912 | Ga0496109_0594894 | Ga0496109_0594894_161_991 | 253 |
| 16 | 3300053156 | Ga0500622_0005699 | Ga0500622_0005699_28_873 | 253 |
| 17 | 3300048918 | Ga0496115_0484767 | Ga0496115_0484767_106_963 | 261 |
| 18 | 3300003794 | Ga0055531_10000469 | Ga0055531_100004691 | 270 |
| 19 | 3300025298 | Ga0209050_1002179 | Ga0209050_100217920 | 270 |
| 20 | 3300025303 | Ga0209051_1026424 | Ga0209051_10264243 | 270 |
| 21 | 3300025304 | Ga0209257_1000016 | Ga0209257_1000016150 | 270 |
| 22 | 3300005468 | Ga0070707_100232859 | Ga0070707_1002328592 | 271 |
| 23 | 3300005471 | Ga0070698_100236216 | Ga0070698_1002362161 | 271 |
| 24 | 3300035725 | Ga0373947_0031882 | Ga0373947_0031882_298_1239 | 271 |
| 25 | 3300048912 | Ga0496109_0005617 | Ga0496109_0005617_3945_4925 | 273 |
| 26 | 3300048913 | Ga0496110_0079834 | Ga0496110_0079834_673_1653 | 273 |
| 27 | 3300042131 | Ga0450894_010305 | Ga0450894_010305_198_1139 | 274 |
| 28 | 3300046461 | Ga0495641_0136091 | Ga0495641_0136091_85_1023 | 275 |
| 29 | 3300005328 | Ga0070676_10038439 | Ga0070676_100384393 | 276 |
| 30 | 3300005330 | Ga0070690_100043749 | Ga0070690_1000437493 | 276 |
| 31 | 3300005334 | Ga0068869_100032973 | Ga0068869_1000329732 | 276 |
| 32 | 3300005335 | Ga0070666_10015366 | Ga0070666_100153663 | 276 |
| 33 | 3300005338 | Ga0068868_100023935 | Ga0068868_1000239354 | 276 |
| 34 | 3300005354 | Ga0070675_100062941 | Ga0070675_1000629413 | 276 |
| 35 | 3300005355 | Ga0070671_100056944 | Ga0070671_1000569442 | 276 |
| 36 | 3300005364 | Ga0070673_100075393 | Ga0070673_1000753933 | 276 |
| 37 | 3300005456 | Ga0070678_100047132 | Ga0070678_1000471323 | 276 |
| 38 | 3300005466 | Ga0070685_10056448 | Ga0070685_100564482 | 276 |
| 39 | 3300005543 | Ga0070672_100261860 | Ga0070672_1002618602 | 276 |
| 40 | 3300005615 | Ga0070702_100142839 | Ga0070702_1001428392 | 276 |
| 41 | 3300005616 | Ga0068852_100008007 | Ga0068852_1000080072 | 276 |
| 42 | 3300005617 | Ga0068859_100009696 | Ga0068859_10000969610 | 276 |
| 43 | 3300005618 | Ga0068864_100000417 | Ga0068864_10000041710 | 276 |
| 44 | 3300005834 | Ga0068851_10098115 | Ga0068851_100981152 | 276 |
| 45 | 3300005841 | Ga0068863_100067684 | Ga0068863_1000676842 | 276 |
| 46 | 3300005842 | Ga0068858_100003411 | Ga0068858_10000341113 | 276 |
| 47 | 3300006237 | Ga0097621_100060883 | Ga0097621_1000608832 | 276 |
| 48 | 3300006931 | Ga0097620_100009697 | Ga0097620_10000969710 | 276 |
| 49 | 3300009177 | Ga0105248_10135531 | Ga0105248_101355313 | 276 |
| 50 | 3300013296 | Ga0157374_10045256 | Ga0157374_100452563 | 276 |
| 51 | 3300013308 | Ga0157375_10342988 | Ga0157375_103429882 | 276 |
| 52 | 3300014325 | Ga0163163_10003807 | Ga0163163_1000380712 | 276 |
| 53 | 3300014745 | Ga0157377_10092392 | Ga0157377_100923922 | 276 |
| 54 | 3300014968 | Ga0157379_10004392 | Ga0157379_1000439211 | 276 |
| 55 | 3300014969 | Ga0157376_10121960 | Ga0157376_101219601 | 276 |
| 56 | 3300017792 | Ga0163161_10214086 | Ga0163161_102140862 | 276 |
| 57 | 3300025903 | Ga0207680_10031399 | Ga0207680_100313993 | 276 |
| 58 | 3300025907 | Ga0207645_10161951 | Ga0207645_101619512 | 276 |
| 59 | 3300025926 | Ga0207659_10035289 | Ga0207659_100352893 | 276 |
| 60 | 3300025931 | Ga0207644_10004378 | Ga0207644_100043788 | 276 |
| 61 | 3300025941 | Ga0207711_10044865 | Ga0207711_100448653 | 276 |
| 62 | 3300025942 | Ga0207689_10030198 | Ga0207689_100301983 | 276 |
| 63 | 3300025960 | Ga0207651_10051694 | Ga0207651_100516943 | 276 |
| 64 | 3300025986 | Ga0207658_10046347 | Ga0207658_100463473 | 276 |
| 65 | 3300026023 | Ga0207677_10001217 | Ga0207677_1000121714 | 276 |
| 66 | 3300026035 | Ga0207703_10003280 | Ga0207703_100032803 | 276 |
| 67 | 3300026088 | Ga0207641_10122414 | Ga0207641_101224142 | 276 |
| 68 | 3300026095 | Ga0207676_10001762 | Ga0207676_1000176213 | 276 |
| 69 | 3300026121 | Ga0207683_10035185 | Ga0207683_100351853 | 276 |
| 70 | 3300026142 | Ga0207698_10090138 | Ga0207698_100901383 | 276 |
| 71 | 3300048911 | Ga0496108_0187634 | Ga0496108_0187634_592_1542 | 276 |
| 72 | 3300048912 | Ga0496109_0117465 | Ga0496109_0117465_793_1743 | 276 |
| 73 | 3300044712 | Ga0453684_0026097 | Ga0453684_0026097_617_1567 | 277 |
| 74 | 3300021361 | Ga0213872_10000258 | Ga0213872_1000025830 | 278 |
| 75 | 3300039447 | Ga0436361_0430065 | Ga0436361_0430065_21336_22286 | 278 |
| 76 | 3300044658 | Ga0466972_0000630 | Ga0466972_0000630_294_1238 | 280 |
| 77 | 3300005295 | Ga0065707_10087442 | Ga0065707_100874425 | 281 |
| 78 | 3300009553 | Ga0105249_10143456 | Ga0105249_101434562 | 281 |
| 79 | 3300025923 | Ga0207681_10044386 | Ga0207681_100443863 | 281 |
| 80 | 3300026075 | Ga0207708_10071425 | Ga0207708_100714252 | 281 |
| 81 | 3300026118 | Ga0207675_100022931 | Ga0207675_1000229314 | 281 |
| 82 | 3300028380 | Ga0268265_10397931 | Ga0268265_103979311 | 281 |
| 83 | 3300031456 | Ga0307513_10361315 | Ga0307513_103613151 | 281 |
| 84 | 3300042876 | Ga0451577_0018745 | Ga0451577_0018745_2805_3746 | 282 |
| 85 | 3300044712 | Ga0453684_0280678 | Ga0453684_0280678_316_1257 | 282 |
| 86 | 3300045051 | Ga0451576_0085485 | Ga0451576_0085485_2166_3107 | 282 |
| 87 | 3300046454 | Ga0495592_0000499 | Ga0495592_0000499_6938_7879 | 282 |
| 88 | 3300053154 | Ga0500619_005187 | Ga0500619_005187_282_1223 | 282 |
| 89 | 3300028786 | Ga0307517_10058934 | Ga0307517_100589341 | 283 |
| 90 | 3300031456 | Ga0307513_10046962 | Ga0307513_100469624 | 283 |
| 91 | 3300037471 | Ga0395905_0005103 | Ga0395905_0005103_6139_7122 | 283 |
| 92 | 3300046519 | Ga0495632_0002352 | Ga0495632_0002352_607_1545 | 283 |
| 93 | 3300053108 | Ga0500562_015491 | Ga0500562_015491_100_1038 | 283 |
| 94 | 3300053139 | Ga0500568_0006967 | Ga0500568_0006967_476_1414 | 283 |
| 95 | 3300053151 | Ga0500604_0044551 | Ga0500604_0044551_340_1278 | 283 |
| 96 | 3300006353 | Ga0075370_10063470 | Ga0075370_100634702 | 284 |
| 97 | 3300034820 | Ga0373959_0004852 | Ga0373959_0004852_229_1179 | 284 |
| 98 | 3300035088 | Ga0373940_0005138 | Ga0373940_0005138_1703_2653 | 284 |
| 99 | 3300035114 | Ga0373939_0000047 | Ga0373939_0000047_20572_21522 | 284 |
| 100 | 3300035121 | Ga0373960_0001152 | Ga0373960_0001152_2097_3047 | 284 |
| 101 | 3300035241 | Ga0373961_0034780 | Ga0373961_0034780_37_987 | 284 |
| 102 | 3300035691 | Ga0373931_0000579 | Ga0373931_0000579_11576_12526 | 284 |
| 103 | 3300044683 | Ga0466965_0031086 | Ga0466965_0031086_1254_2198 | 284 |
| 104 | 3300050496 | nmdc:mga07m45_54858_c1 | nmdc:mga07m45_54858_c1_622_1566 | 284 |
| 105 | iso_pu_bacteria | 2643221544 | 2643744051 | 284 |
| 106 | 3300005354 | Ga0070675_100414501 | Ga0070675_1004145012 | 285 |
| 107 | 3300005616 | Ga0068852_100096238 | Ga0068852_1000962383 | 285 |
| 108 | 3300005617 | Ga0068859_100487773 | Ga0068859_1004877732 | 285 |
| 109 | 3300005841 | Ga0068863_100085003 | Ga0068863_1000850033 | 285 |
| 110 | 3300005843 | Ga0068860_100189057 | Ga0068860_1001890573 | 285 |
| 111 | 3300005844 | Ga0068862_100052355 | Ga0068862_1000523552 | 285 |
| 112 | 3300006177 | Ga0075362_10014222 | Ga0075362_100142223 | 285 |
| 113 | 3300006931 | Ga0097620_100487784 | Ga0097620_1004877842 | 285 |
| 114 | 3300014968 | Ga0157379_10032133 | Ga0157379_100321333 | 285 |
| 115 | 3300025931 | Ga0207644_10030001 | Ga0207644_100300013 | 285 |
| 116 | 3300025940 | Ga0207691_10139772 | Ga0207691_101397721 | 285 |
| 117 | 3300026142 | Ga0207698_10119948 | Ga0207698_101199482 | 285 |
| 118 | 3300028380 | Ga0268265_10014091 | Ga0268265_100140914 | 285 |
| 119 | 3300044735 | Ga0466968_0092433 | Ga0466968_0092433_131_1072 | 285 |
| 120 | 3300048911 | Ga0496108_0018647 | Ga0496108_0018647_4433_5380 | 285 |
| 121 | 3300050489 | nmdc:mga03683_21281_c1 | nmdc:mga03683_21281_c1_789_1730 | 285 |
| 122 | 3300005331 | Ga0070670_100001482 | Ga0070670_10000148218 | 286 |
| 123 | 3300005355 | Ga0070671_100111697 | Ga0070671_1001116973 | 286 |
| 124 | 3300005364 | Ga0070673_100018380 | Ga0070673_1000183802 | 286 |
| 125 | 3300005367 | Ga0070667_100087141 | Ga0070667_1000871412 | 286 |
| 126 | 3300005456 | Ga0070678_100042645 | Ga0070678_1000426453 | 286 |
| 127 | 3300005543 | Ga0070672_100025245 | Ga0070672_1000252454 | 286 |
| 128 | 3300005618 | Ga0068864_100030569 | Ga0068864_1000305693 | 286 |
| 129 | 3300006237 | Ga0097621_100017545 | Ga0097621_1000175453 | 286 |
| 130 | 3300006358 | Ga0068871_100088309 | Ga0068871_1000883093 | 286 |
| 131 | 3300014969 | Ga0157376_10025992 | Ga0157376_100259925 | 286 |
| 132 | 3300025909 | Ga0207705_10057983 | Ga0207705_100579833 | 286 |
| 133 | 3300025925 | Ga0207650_10003543 | Ga0207650_100035434 | 286 |
| 134 | 3300025940 | Ga0207691_10001767 | Ga0207691_100017674 | 286 |
| 135 | 3300025960 | Ga0207651_10006968 | Ga0207651_100069684 | 286 |
| 136 | 3300026095 | Ga0207676_10016482 | Ga0207676_100164824 | 286 |
| 137 | 3300026121 | Ga0207683_10080447 | Ga0207683_100804472 | 286 |
| 138 | 3300026142 | Ga0207698_10413613 | Ga0207698_104136132 | 286 |
| 139 | 3300031507 | Ga0307509_10000698 | Ga0307509_1000069828 | 286 |
| 140 | 3300033180 | Ga0307510_10033683 | Ga0307510_100336832 | 286 |
| 141 | 3300035113 | Ga0373936_0106403 | Ga0373936_0106403_180_1127 | 286 |
| 142 | 3300042007 | Ga0439449_0034397 | Ga0439449_0034397_912_1856 | 286 |
| 143 | 3300049581 | Ga0501047_0139862 | Ga0501047_0139862_1085_2038 | 286 |
| 144 | iso_pu_bacteria | 2585428057 | 2587725947 | 286 |
| 145 | iso_pu_bacteria | 2585428058 | 2587735598 | 286 |
| 146 | iso_pu_bacteria | 2588253510 | 2588292840 | 286 |
| 147 | iso_pu_bacteria | 2643221585 | 2643932476 | 286 |
| 148 | iso_pu_bacteria | 2643221639 | 2644219890 | 286 |
| 149 | iso_pu_bacteria | 2643221646 | 2644260992 | 286 |
| 150 | iso_pu_bacteria | 2643221656 | 2644313727 | 286 |
| 151 | iso_pu_bacteria | 2738541337 | 2739054793 | 286 |
| 152 | 3300002773 | JGI25152J39213_1002392 | JGI25152J39213_10023923 | 287 |
| 153 | 3300002774 | JGI25150J39212_1010797 | JGI25150J39212_10107972 | 287 |
| 154 | 3300003215 | JGI25153J46596_10001676 | JGI25153J46596_1000167612 | 287 |
| 155 | 3300003771 | Ga0055526_1001240 | Ga0055526_10012408 | 287 |
| 156 | 3300006051 | Ga0075364_10188644 | Ga0075364_101886442 | 287 |
| 157 | 3300006195 | Ga0075366_10037604 | Ga0075366_100376042 | 287 |
| 158 | 3300013102 | Ga0157371_10119517 | Ga0157371_101195172 | 287 |
| 159 | 3300025245 | Ga0207425_1000570 | Ga0207425_10005702 | 287 |
| 160 | 3300025258 | Ga0209129_1000158 | Ga0209129_100015820 | 287 |
| 161 | 3300025273 | Ga0209673_1008551 | Ga0209673_10085513 | 287 |
| 162 | 3300025273 | Ga0209673_1023905 | Ga0209673_10239052 | 287 |
| 163 | 3300025295 | Ga0209564_1000282 | Ga0209564_100028220 | 287 |
| 164 | 3300025297 | Ga0209758_1000910 | Ga0209758_100091035 | 287 |
| 165 | 3300025298 | Ga0209050_1000223 | Ga0209050_100022345 | 287 |
| 166 | 3300025303 | Ga0209051_1023640 | Ga0209051_10236403 | 287 |
| 167 | 3300028786 | Ga0307517_10072069 | Ga0307517_100720694 | 287 |
| 168 | 3300031239 | Ga0265328_10037268 | Ga0265328_100372682 | 287 |
| 169 | 3300031251 | Ga0265327_10000925 | Ga0265327_1000092513 | 287 |
| 170 | 3300031344 | Ga0265316_10000176 | Ga0265316_1000017635 | 287 |
| 171 | 3300031649 | Ga0307514_10088726 | Ga0307514_100887262 | 287 |
| 172 | 3300035172 | Ga0373955_0041338 | Ga0373955_0041338_1295_2245 | 287 |
| 173 | 3300046459 | Ga0495629_0009172 | Ga0495629_0009172_3064_4014 | 287 |
| 174 | 3300046472 | Ga0495580_0110869 | Ga0495580_0110869_669_1619 | 287 |
| 175 | 3300046529 | Ga0495652_0086062 | Ga0495652_0086062_752_1702 | 287 |
| 176 | 3300046533 | Ga0495640_0137503 | Ga0495640_0137503_566_1516 | 287 |
| 177 | 3300046543 | Ga0495645_0037182 | Ga0495645_0037182_698_1648 | 287 |
| 178 | 3300046559 | Ga0495667_0091710 | Ga0495667_0091710_41_991 | 287 |
| 179 | 3300047471 | Ga0495684_0054704 | Ga0495684_0054704_922_1872 | 287 |
| 180 | 3300049569 | Ga0501032_0126057 | Ga0501032_0126057_160_1110 | 287 |
| 181 | 3300049579 | Ga0501043_0000058 | Ga0501043_0000058_34503_35453 | 287 |
| 182 | 3300049580 | Ga0501046_0000051 | Ga0501046_0000051_66625_67575 | 287 |
| 183 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_440829_441779 | 287 |
| 184 | 3300049582 | Ga0501048_0001358 | Ga0501048_0001358_1233_2183 | 287 |
| 185 | 3300049823 | Ga0501044_0103166 | Ga0501044_0103166_550_1500 | 287 |
| 186 | 3300049824 | Ga0501045_0015123 | Ga0501045_0015123_534_1484 | 287 |
| 187 | 3300050491 | nmdc:mga00v17_66258_c1 | nmdc:mga00v17_66258_c1_1121_2059 | 287 |
| 188 | 3300050493 | nmdc:mga0k408_21949_c1 | nmdc:mga0k408_21949_c1_909_1847 | 287 |
| 189 | 3300050494 | nmdc:mga06z11_286471_c1 | nmdc:mga06z11_286471_c1_13_951 | 287 |
| 190 | 3300050496 | nmdc:mga07m45_2998_c2 | nmdc:mga07m45_2998_c2_388_1326 | 287 |
| 191 | 3300053077 | Ga0495601_0307002 | Ga0495601_0307002_14_964 | 287 |
| 192 | 3300053086 | Ga0500578_0000417 | Ga0500578_0000417_6542_7483 | 287 |
| 193 | 3300053093 | Ga0500651_0266064 | Ga0500651_0266064_37_975 | 287 |
| 194 | 3300053098 | Ga0500650_0022212 | Ga0500650_0022212_1356_2294 | 287 |
| 195 | 3300053131 | Ga0500652_001084 | Ga0500652_001084_5484_6422 | 287 |
| 196 | 3300053133 | Ga0500655_010982 | Ga0500655_010982_419_1357 | 287 |
| 197 | 3300053142 | Ga0500577_0030338 | Ga0500577_0030338_650_1588 | 287 |
| 198 | 3300053151 | Ga0500604_0066152 | Ga0500604_0066152_168_1109 | 287 |
| 199 | 3300053156 | Ga0500622_0000198 | Ga0500622_0000198_60324_61262 | 287 |
| 200 | iso_pu_bacteria | 2585428062 | 2587759112 | 287 |
| 201 | iso_pu_bacteria | 2643221592 | 2643967949 | 287 |
| 202 | iso_pu_bacteria | 2643221625 | 2644143151 | 287 |
| 203 | iso_pu_bacteria | 2643221648 | 2644271761 | 287 |
| 204 | 3300005328 | Ga0070676_10125822 | Ga0070676_101258221 | 288 |
| 205 | 3300005330 | Ga0070690_100013442 | Ga0070690_1000134422 | 288 |
| 206 | 3300005331 | Ga0070670_100015553 | Ga0070670_1000155531 | 288 |
| 207 | 3300005331 | Ga0070670_100038140 | Ga0070670_1000381405 | 288 |
| 208 | 3300005334 | Ga0068869_100007008 | Ga0068869_1000070087 | 288 |
| 209 | 3300005335 | Ga0070666_10064003 | Ga0070666_100640031 | 288 |
| 210 | 3300005338 | Ga0068868_100044251 | Ga0068868_1000442511 | 288 |
| 211 | 3300005338 | Ga0068868_100049639 | Ga0068868_1000496392 | 288 |
| 212 | 3300005343 | Ga0070687_100005681 | Ga0070687_1000056814 | 288 |
| 213 | 3300005347 | Ga0070668_100011810 | Ga0070668_1000118103 | 288 |
| 214 | 3300005353 | Ga0070669_100002640 | Ga0070669_1000026406 | 288 |
| 215 | 3300005353 | Ga0070669_100005862 | Ga0070669_1000058621 | 288 |
| 216 | 3300005354 | Ga0070675_100006197 | Ga0070675_1000061971 | 288 |
| 217 | 3300005354 | Ga0070675_100015423 | Ga0070675_1000154234 | 288 |
| 218 | 3300005355 | Ga0070671_100042567 | Ga0070671_1000425674 | 288 |
| 219 | 3300005356 | Ga0070674_100017795 | Ga0070674_1000177953 | 288 |
| 220 | 3300005356 | Ga0070674_100154401 | Ga0070674_1001544011 | 288 |
| 221 | 3300005364 | Ga0070673_100034883 | Ga0070673_1000348831 | 288 |
| 222 | 3300005367 | Ga0070667_100007594 | Ga0070667_1000075946 | 288 |
| 223 | 3300005456 | Ga0070678_100026426 | Ga0070678_1000264264 | 288 |
| 224 | 3300005456 | Ga0070678_100353794 | Ga0070678_1003537941 | 288 |
| 225 | 3300005457 | Ga0070662_100283668 | Ga0070662_1002836681 | 288 |
| 226 | 3300005459 | Ga0068867_100000894 | Ga0068867_10000089415 | 288 |
| 227 | 3300005459 | Ga0068867_100254403 | Ga0068867_1002544032 | 288 |
| 228 | 3300005543 | Ga0070672_100007091 | Ga0070672_1000070913 | 288 |
| 229 | 3300005543 | Ga0070672_100010703 | Ga0070672_1000107031 | 288 |
| 230 | 3300005548 | Ga0070665_100144258 | Ga0070665_1001442583 | 288 |
| 231 | 3300005616 | Ga0068852_100056475 | Ga0068852_1000564754 | 288 |
| 232 | 3300005617 | Ga0068859_100032738 | Ga0068859_1000327385 | 288 |
| 233 | 3300005618 | Ga0068864_100055221 | Ga0068864_1000552211 | 288 |
| 234 | 3300005719 | Ga0068861_100019088 | Ga0068861_1000190883 | 288 |
| 235 | 3300005841 | Ga0068863_100002056 | Ga0068863_1000020566 | 288 |
| 236 | 3300005842 | Ga0068858_100000623 | Ga0068858_10000062330 | 288 |
| 237 | 3300005843 | Ga0068860_100022528 | Ga0068860_1000225286 | 288 |
| 238 | 3300005844 | Ga0068862_100119832 | Ga0068862_1001198322 | 288 |
| 239 | 3300006358 | Ga0068871_100241557 | Ga0068871_1002415571 | 288 |
| 240 | 3300006881 | Ga0068865_100015159 | Ga0068865_1000151593 | 288 |
| 241 | 3300006881 | Ga0068865_100299383 | Ga0068865_1002993831 | 288 |
| 242 | 3300006931 | Ga0097620_100032737 | Ga0097620_1000327375 | 288 |
| 243 | 3300009148 | Ga0105243_10041667 | Ga0105243_100416673 | 288 |
| 244 | 3300009177 | Ga0105248_10277354 | Ga0105248_102773542 | 288 |
| 245 | 3300009553 | Ga0105249_10009800 | Ga0105249_100098006 | 288 |
| 246 | 3300013306 | Ga0163162_10253456 | Ga0163162_102534563 | 288 |
| 247 | 3300013308 | Ga0157375_10002767 | Ga0157375_1000276715 | 288 |
| 248 | 3300014326 | Ga0157380_10000770 | Ga0157380_100007701 | 288 |
| 249 | 3300014968 | Ga0157379_10254376 | Ga0157379_102543761 | 288 |
| 250 | 3300021361 | Ga0213872_10004509 | Ga0213872_100045099 | 288 |
| 251 | 3300025315 | Ga0207697_10014915 | Ga0207697_100149153 | 288 |
| 252 | 3300025315 | Ga0207697_10077095 | Ga0207697_100770952 | 288 |
| 253 | 3300025893 | Ga0207682_10051761 | Ga0207682_100517612 | 288 |
| 254 | 3300025893 | Ga0207682_10115245 | Ga0207682_101152451 | 288 |
| 255 | 3300025907 | Ga0207645_10026636 | Ga0207645_100266361 | 288 |
| 256 | 3300025918 | Ga0207662_10013189 | Ga0207662_100131895 | 288 |
| 257 | 3300025923 | Ga0207681_10003110 | Ga0207681_100031107 | 288 |
| 258 | 3300025923 | Ga0207681_10009514 | Ga0207681_100095146 | 288 |
| 259 | 3300025925 | Ga0207650_10003734 | Ga0207650_1000373411 | 288 |
| 260 | 3300025926 | Ga0207659_10003530 | Ga0207659_100035303 | 288 |
| 261 | 3300025926 | Ga0207659_10231274 | Ga0207659_102312741 | 288 |
| 262 | 3300025931 | Ga0207644_10077953 | Ga0207644_100779532 | 288 |
| 263 | 3300025933 | Ga0207706_10022227 | Ga0207706_100222274 | 288 |
| 264 | 3300025935 | Ga0207709_10018575 | Ga0207709_100185753 | 288 |
| 265 | 3300025937 | Ga0207669_10003005 | Ga0207669_100030057 | 288 |
| 266 | 3300025937 | Ga0207669_10007396 | Ga0207669_100073961 | 288 |
| 267 | 3300025940 | Ga0207691_10108313 | Ga0207691_101083132 | 288 |
| 268 | 3300025940 | Ga0207691_10354139 | Ga0207691_103541391 | 288 |
| 269 | 3300025942 | Ga0207689_10012906 | Ga0207689_100129066 | 288 |
| 270 | 3300025960 | Ga0207651_10173828 | Ga0207651_101738282 | 288 |
| 271 | 3300025961 | Ga0207712_10036308 | Ga0207712_100363081 | 288 |
| 272 | 3300025972 | Ga0207668_10004050 | Ga0207668_100040509 | 288 |
| 273 | 3300025986 | Ga0207658_10041491 | Ga0207658_100414915 | 288 |
| 274 | 3300026035 | Ga0207703_10001480 | Ga0207703_100014807 | 288 |
| 275 | 3300026088 | Ga0207641_10001533 | Ga0207641_1000153319 | 288 |
| 276 | 3300026089 | Ga0207648_10309506 | Ga0207648_103095061 | 288 |
| 277 | 3300026095 | Ga0207676_10176523 | Ga0207676_101765231 | 288 |
| 278 | 3300026095 | Ga0207676_10326529 | Ga0207676_103265291 | 288 |
| 279 | 3300026118 | Ga0207675_100029708 | Ga0207675_1000297083 | 288 |
| 280 | 3300026121 | Ga0207683_10437389 | Ga0207683_104373891 | 288 |
| 281 | 3300028379 | Ga0268266_10496090 | Ga0268266_104960901 | 288 |
| 282 | 3300028380 | Ga0268265_10027800 | Ga0268265_100278003 | 288 |
| 283 | 3300028381 | Ga0268264_10019856 | Ga0268264_100198563 | 288 |
| 284 | 3300028794 | Ga0307515_10005936 | Ga0307515_100059369 | 288 |
| 285 | 3300028794 | Ga0307515_10011641 | Ga0307515_1001164115 | 288 |
| 286 | 3300031456 | Ga0307513_10005821 | Ga0307513_1000582114 | 288 |
| 287 | 3300031507 | Ga0307509_10039083 | Ga0307509_100390833 | 288 |
| 288 | 3300031548 | Ga0307408_100021576 | Ga0307408_1000215764 | 288 |
| 289 | 3300031548 | Ga0307408_100140014 | Ga0307408_1001400142 | 288 |
| 290 | 3300031616 | Ga0307508_10000504 | Ga0307508_1000050414 | 288 |
| 291 | 3300031649 | Ga0307514_10002566 | Ga0307514_1000256613 | 288 |
| 292 | 3300031731 | Ga0307405_10012518 | Ga0307405_100125181 | 288 |
| 293 | 3300031731 | Ga0307405_10016930 | Ga0307405_100169304 | 288 |
| 294 | 3300031824 | Ga0307413_10019690 | Ga0307413_100196903 | 288 |
| 295 | 3300031901 | Ga0307406_10031616 | Ga0307406_100316163 | 288 |
| 296 | 3300031901 | Ga0307406_10041963 | Ga0307406_100419633 | 288 |
| 297 | 3300031903 | Ga0307407_10049525 | Ga0307407_100495253 | 288 |
| 298 | 3300031911 | Ga0307412_10005099 | Ga0307412_100050996 | 288 |
| 299 | 3300031995 | Ga0307409_100001339 | Ga0307409_1000013395 | 288 |
| 300 | 3300031995 | Ga0307409_100002252 | Ga0307409_10000225211 | 288 |
| 301 | 3300032002 | Ga0307416_100019414 | Ga0307416_1000194143 | 288 |
| 302 | 3300032002 | Ga0307416_100019721 | Ga0307416_1000197213 | 288 |
| 303 | 3300032004 | Ga0307414_10035032 | Ga0307414_100350324 | 288 |
| 304 | 3300032004 | Ga0307414_10287164 | Ga0307414_102871642 | 288 |
| 305 | 3300032005 | Ga0307411_10011812 | Ga0307411_100118125 | 288 |
| 306 | 3300039447 | Ga0436361_0264437 | Ga0436361_0264437_54195_55133 | 288 |
| 307 | 3300044712 | Ga0453684_0008286 | Ga0453684_0008286_11212_12168 | 288 |
| 308 | 3300046512 | Ga0495610_0077809 | Ga0495610_0077809_428_1369 | 288 |
| 309 | 3300046522 | Ga0495643_0062508 | Ga0495643_0062508_129_1070 | 288 |
| 310 | 3300046660 | Ga0495625_0000827 | Ga0495625_0000827_8287_9228 | 288 |
| 311 | 3300047472 | Ga0495686_0068182 | Ga0495686_0068182_1060_2001 | 288 |
| 312 | 3300050493 | nmdc:mga0k408_63486_c1 | nmdc:mga0k408_63486_c1_1185_2126 | 288 |
| 313 | 3300050496 | nmdc:mga07m45_56544_c1 | nmdc:mga07m45_56544_c1_1111_2052 | 288 |
| 314 | 3300050496 | nmdc:mga07m45_58492_c1 | nmdc:mga07m45_58492_c1_1223_2164 | 288 |
| 315 | 3300053134 | Ga0500658_0128773 | Ga0500658_0128773_54_995 | 288 |
| 316 | iso_pu_bacteria | 2643221660 | 2644339816 | 288 |
| 317 | iso_pu_bacteria | 2831864461 | 2831867633 | 288 |
| 318 | iso_pu_bacteria | 2886848708 | 2886854916 | 288 |
| 319 | 3300005344 | Ga0070661_100145250 | Ga0070661_1001452502 | 289 |
| 320 | 3300005355 | Ga0070671_100122107 | Ga0070671_1001221073 | 289 |
| 321 | 3300005456 | Ga0070678_100104996 | Ga0070678_1001049962 | 289 |
| 322 | 3300005459 | Ga0068867_100021133 | Ga0068867_1000211333 | 289 |
| 323 | 3300005539 | Ga0068853_100033463 | Ga0068853_1000334632 | 289 |
| 324 | 3300005578 | Ga0068854_100122843 | Ga0068854_1001228433 | 289 |
| 325 | 3300009093 | Ga0105240_10021539 | Ga0105240_100215394 | 289 |
| 326 | 3300009545 | Ga0105237_10040414 | Ga0105237_100404144 | 289 |
| 327 | 3300009551 | Ga0105238_10371942 | Ga0105238_103719421 | 289 |
| 328 | 3300021361 | Ga0213872_10000033 | Ga0213872_1000003328 | 289 |
| 329 | 3300021361 | Ga0213872_10021274 | Ga0213872_100212742 | 289 |
| 330 | 3300025907 | Ga0207645_10117738 | Ga0207645_101177382 | 289 |
| 331 | 3300025925 | Ga0207650_10056215 | Ga0207650_100562153 | 289 |
| 332 | 3300025931 | Ga0207644_10158005 | Ga0207644_101580052 | 289 |
| 333 | 3300025981 | Ga0207640_10252651 | Ga0207640_102526512 | 289 |
| 334 | 3300026089 | Ga0207648_10004823 | Ga0207648_1000482311 | 289 |
| 335 | 3300026121 | Ga0207683_10209698 | Ga0207683_102096982 | 289 |
| 336 | 3300039447 | Ga0436361_0027317 | Ga0436361_0027317_20826_21776 | 289 |
| 337 | 3300039447 | Ga0436361_0301682 | Ga0436361_0301682_2001_2951 | 289 |
| 338 | 3300042000 | Ga0439437_003678 | Ga0439437_003678_334_1284 | 289 |
| 339 | 3300042120 | Ga0450917_002083 | Ga0450917_002083_104_1054 | 289 |
| 340 | 3300042126 | Ga0450888_000258 | Ga0450888_000258_106_1056 | 289 |
| 341 | 3300042136 | Ga0450900_004838 | Ga0450900_004838_14_964 | 289 |
| 342 | 3300042144 | Ga0450889_000025 | Ga0450889_000025_8557_9507 | 289 |
| 343 | 3300042533 | Ga0450901_008153 | Ga0450901_008153_34_984 | 289 |
| 344 | 3300049665 | Ga0501227_026095 | Ga0501227_026095_354_1304 | 289 |
| 345 | 3300003316 | rootH1_10007856 | rootH1_100078562 | 290 |
| 346 | 3300003322 | rootL2_10027257 | rootL2_100272575 | 290 |
| 347 | 3300005262 | Ga0065165_1000621 | Ga0065165_100062148 | 290 |
| 348 | 3300005329 | Ga0070683_100049963 | Ga0070683_1000499633 | 290 |
| 349 | 3300005331 | Ga0070670_100055150 | Ga0070670_1000551501 | 290 |
| 350 | 3300005337 | Ga0070682_100100347 | Ga0070682_1001003471 | 290 |
| 351 | 3300005338 | Ga0068868_100376041 | Ga0068868_1003760411 | 290 |
| 352 | 3300005364 | Ga0070673_100301129 | Ga0070673_1003011292 | 290 |
| 353 | 3300005366 | Ga0070659_100172033 | Ga0070659_1001720332 | 290 |
| 354 | 3300005367 | Ga0070667_100305577 | Ga0070667_1003055771 | 290 |
| 355 | 3300005445 | Ga0070708_100109977 | Ga0070708_1001099773 | 290 |
| 356 | 3300005564 | Ga0070664_100059502 | Ga0070664_1000595024 | 290 |
| 357 | 3300005578 | Ga0068854_100292743 | Ga0068854_1002927431 | 290 |
| 358 | 3300005617 | Ga0068859_100217279 | Ga0068859_1002172792 | 290 |
| 359 | 3300005843 | Ga0068860_100159526 | Ga0068860_1001595262 | 290 |
| 360 | 3300006353 | Ga0075370_10011470 | Ga0075370_100114704 | 290 |
| 361 | 3300006358 | Ga0068871_100341752 | Ga0068871_1003417522 | 290 |
| 362 | 3300006931 | Ga0097620_100217284 | Ga0097620_1002172843 | 290 |
| 363 | 3300009147 | Ga0114129_10307047 | Ga0114129_103070473 | 290 |
| 364 | 3300013306 | Ga0163162_10437556 | Ga0163162_104375562 | 290 |
| 365 | 3300014325 | Ga0163163_10108170 | Ga0163163_101081704 | 290 |
| 366 | 3300017792 | Ga0163161_10117770 | Ga0163161_101177702 | 290 |
| 367 | 3300025893 | Ga0207682_10013002 | Ga0207682_100130024 | 290 |
| 368 | 3300025907 | Ga0207645_10064121 | Ga0207645_100641213 | 290 |
| 369 | 3300025925 | Ga0207650_10026247 | Ga0207650_100262472 | 290 |
| 370 | 3300025944 | Ga0207661_10206010 | Ga0207661_102060102 | 290 |
| 371 | 3300025945 | Ga0207679_10128306 | Ga0207679_101283062 | 290 |
| 372 | 3300031251 | Ga0265327_10000080 | Ga0265327_1000008086 | 290 |
| 373 | 3300031548 | Ga0307408_100000012 | Ga0307408_100000012260 | 290 |
| 374 | 3300031548 | Ga0307408_100111052 | Ga0307408_1001110522 | 290 |
| 375 | 3300037471 | Ga0395905_0005387 | Ga0395905_0005387_8900_9850 | 290 |
| 376 | 3300044712 | Ga0453684_0249527 | Ga0453684_0249527_868_1818 | 290 |
| 377 | 3300045051 | Ga0451576_0065287 | Ga0451576_0065287_2123_3073 | 290 |
| 378 | 3300049130 | Ga0501310_002947 | Ga0501310_002947_369_1319 | 290 |
| 379 | 3300049662 | Ga0501222_002025 | Ga0501222_002025_168_1118 | 290 |
| 380 | 3300049679 | Ga0501249_028108 | Ga0501249_028108_30_980 | 290 |
| 381 | 3300049686 | Ga0501257_036739 | Ga0501257_036739_64_1014 | 290 |
| 382 | 3300049704 | Ga0501221_001011 | Ga0501221_001011_181_1131 | 290 |
| 383 | 3300049769 | Ga0501272_001114 | Ga0501272_001114_387_1337 | 290 |
| 384 | 3300050496 | nmdc:mga07m45_51896_c1 | nmdc:mga07m45_51896_c1_1258_2202 | 290 |
| 385 | 3300003215 | JGI25153J46596_10003840 | JGI25153J46596_100038408 | 291 |
| 386 | 3300005347 | Ga0070668_100020579 | Ga0070668_1000205793 | 291 |
| 387 | 3300005347 | Ga0070668_100376733 | Ga0070668_1003767332 | 291 |
| 388 | 3300005354 | Ga0070675_100032317 | Ga0070675_1000323174 | 291 |
| 389 | 3300005367 | Ga0070667_100076606 | Ga0070667_1000766062 | 291 |
| 390 | 3300005367 | Ga0070667_100169098 | Ga0070667_1001690982 | 291 |
| 391 | 3300005367 | Ga0070667_100359261 | Ga0070667_1003592612 | 291 |
| 392 | 3300005459 | Ga0068867_100000605 | Ga0068867_1000006053 | 291 |
| 393 | 3300005543 | Ga0070672_100029290 | Ga0070672_1000292904 | 291 |
| 394 | 3300005543 | Ga0070672_100057538 | Ga0070672_1000575382 | 291 |
| 395 | 3300005563 | Ga0068855_100603894 | Ga0068855_1006038942 | 291 |
| 396 | 3300005617 | Ga0068859_100246619 | Ga0068859_1002466193 | 291 |
| 397 | 3300005843 | Ga0068860_100000384 | Ga0068860_10000038436 | 291 |
| 398 | 3300005844 | Ga0068862_100037567 | Ga0068862_1000375673 | 291 |
| 399 | 3300006881 | Ga0068865_100002745 | Ga0068865_1000027454 | 291 |
| 400 | 3300006931 | Ga0097620_100246607 | Ga0097620_1002466073 | 291 |
| 401 | 3300009553 | Ga0105249_10017117 | Ga0105249_100171174 | 291 |
| 402 | 3300013297 | Ga0157378_10047529 | Ga0157378_100475293 | 291 |
| 403 | 3300013306 | Ga0163162_10001355 | Ga0163162_1000135517 | 291 |
| 404 | 3300013308 | Ga0157375_10040833 | Ga0157375_100408333 | 291 |
| 405 | 3300014326 | Ga0157380_10012894 | Ga0157380_100128946 | 291 |
| 406 | 3300017792 | Ga0163161_10021715 | Ga0163161_100217152 | 291 |
| 407 | 3300025923 | Ga0207681_10033819 | Ga0207681_100338192 | 291 |
| 408 | 3300025938 | Ga0207704_10005637 | Ga0207704_100056374 | 291 |
| 409 | 3300025939 | Ga0207665_10198954 | Ga0207665_101989542 | 291 |
| 410 | 3300025940 | Ga0207691_10030328 | Ga0207691_100303285 | 291 |
| 411 | 3300025940 | Ga0207691_10129705 | Ga0207691_101297052 | 291 |
| 412 | 3300025961 | Ga0207712_10009930 | Ga0207712_100099304 | 291 |
| 413 | 3300025972 | Ga0207668_10012878 | Ga0207668_100128784 | 291 |
| 414 | 3300025986 | Ga0207658_10053839 | Ga0207658_100538392 | 291 |
| 415 | 3300025986 | Ga0207658_10136908 | Ga0207658_101369082 | 291 |
| 416 | 3300026035 | Ga0207703_10041044 | Ga0207703_100410442 | 291 |
| 417 | 3300026067 | Ga0207678_10075599 | Ga0207678_100755993 | 291 |
| 418 | 3300026089 | Ga0207648_10002852 | Ga0207648_100028523 | 291 |
| 419 | 3300026121 | Ga0207683_10051334 | Ga0207683_100513342 | 291 |
| 420 | 3300028380 | Ga0268265_10003306 | Ga0268265_100033068 | 291 |
| 421 | 3300028381 | Ga0268264_10001034 | Ga0268264_1000103421 | 291 |
| 422 | 3300028786 | Ga0307517_10004429 | Ga0307517_1000442912 | 291 |
| 423 | 3300028794 | Ga0307515_10000139 | Ga0307515_10000139162 | 291 |
| 424 | 3300028794 | Ga0307515_10117134 | Ga0307515_101171341 | 291 |
| 425 | 3300030522 | Ga0307512_10010416 | Ga0307512_100104164 | 291 |
| 426 | 3300031456 | Ga0307513_10078619 | Ga0307513_100786193 | 291 |
| 427 | 3300031456 | Ga0307513_10084122 | Ga0307513_100841226 | 291 |
| 428 | 3300031456 | Ga0307513_10139805 | Ga0307513_101398053 | 291 |
| 429 | 3300031507 | Ga0307509_10012484 | Ga0307509_100124844 | 291 |
| 430 | 3300031616 | Ga0307508_10000144 | Ga0307508_100001449 | 291 |
| 431 | 3300031616 | Ga0307508_10010113 | Ga0307508_100101136 | 291 |
| 432 | 3300031649 | Ga0307514_10125861 | Ga0307514_101258612 | 291 |
| 433 | 3300031649 | Ga0307514_10207005 | Ga0307514_102070052 | 291 |
| 434 | 3300031730 | Ga0307516_10053910 | Ga0307516_100539102 | 291 |
| 435 | 3300033180 | Ga0307510_10000426 | Ga0307510_1000042621 | 291 |
| 436 | 3300037471 | Ga0395905_0000504 | Ga0395905_0000504_27008_27985 | 291 |
| 437 | 3300044656 | Ga0466969_0000018 | Ga0466969_0000018_52979_53920 | 291 |
| 438 | 3300044656 | Ga0466969_0020123 | Ga0466969_0020123_2281_3222 | 291 |
| 439 | 3300044684 | Ga0466966_0038581 | Ga0466966_0038581_422_1363 | 291 |
| 440 | 3300044693 | Ga0466961_0015398 | Ga0466961_0015398_2367_3308 | 291 |
| 441 | 3300044693 | Ga0466961_0016802 | Ga0466961_0016802_266_1207 | 291 |
| 442 | 3300044706 | Ga0466964_0003947 | Ga0466964_0003947_958_1899 | 291 |
| 443 | 3300044765 | Ga0466970_0095863 | Ga0466970_0095863_278_1219 | 291 |
| 444 | 3300044901 | Ga0466960_0088834 | Ga0466960_0088834_189_1130 | 291 |
| 445 | 3300045049 | Ga0466959_0031472 | Ga0466959_0031472_2045_2986 | 291 |
| 446 | 3300045049 | Ga0466959_0044206 | Ga0466959_0044206_1537_2478 | 291 |
| 447 | 3300045836 | Ga0466958_0009242 | Ga0466958_0009242_737_1678 | 291 |
| 448 | 3300045976 | Ga0466967_0104287 | Ga0466967_0104287_220_1161 | 291 |
| 449 | 3300046471 | Ga0495650_0015475 | Ga0495650_0015475_409_1350 | 291 |
| 450 | 3300046690 | Ga0495624_0060379 | Ga0495624_0060379_981_1928 | 291 |
| 451 | 3300047321 | Ga0495676_0018846 | Ga0495676_0018846_3550_4497 | 291 |
| 452 | 3300048088 | Ga0495602_0099403 | Ga0495602_0099403_1209_2156 | 291 |
| 453 | 3300048924 | Ga0496121_0003335 | Ga0496121_0003335_21341_22282 | 291 |
| 454 | 3300048927 | Ga0496124_0000733 | Ga0496124_0000733_31260_32201 | 291 |
| 455 | 3300048927 | Ga0496124_0184562 | Ga0496124_0184562_505_1446 | 291 |
| 456 | 3300048928 | Ga0496125_0017746 | Ga0496125_0017746_2017_2958 | 291 |
| 457 | 3300053088 | Ga0500644_0003385 | Ga0500644_0003385_368_1315 | 291 |
| 458 | 3300053131 | Ga0500652_035357 | Ga0500652_035357_597_1544 | 291 |
| 459 | 3300053133 | Ga0500655_010765 | Ga0500655_010765_141_1088 | 291 |
| 460 | 3300053136 | Ga0500559_0000097 | Ga0500559_0000097_61212_62159 | 291 |
| 461 | 3300053156 | Ga0500622_0008142 | Ga0500622_0008142_3986_4933 | 291 |
| 462 | 3300053739 | Ga0500587_000996 | Ga0500587_000996_1987_2934 | 291 |
| 463 | 3300061719 | Ga0466962_0029907 | Ga0466962_0029907_211_1152 | 291 |
| 464 | 3300003322 | rootL2_10001066 | rootL2_1000106628 | 292 |
| 465 | 3300003775 | Ga0055524_1000550 | Ga0055524_10005502 | 292 |
| 466 | 3300003775 | Ga0055524_1024981 | Ga0055524_10249812 | 292 |
| 467 | 3300003794 | Ga0055531_10003310 | Ga0055531_1000331010 | 292 |
| 468 | 3300003794 | Ga0055531_10012397 | Ga0055531_100123972 | 292 |
| 469 | 3300004625 | Ga0055543_1019323 | Ga0055543_10193231 | 292 |
| 470 | 3300005262 | Ga0065165_1000474 | Ga0065165_100047422 | 292 |
| 471 | 3300005331 | Ga0070670_100492060 | Ga0070670_1004920601 | 292 |
| 472 | 3300005355 | Ga0070671_100020190 | Ga0070671_1000201904 | 292 |
| 473 | 3300005355 | Ga0070671_100023028 | Ga0070671_1000230285 | 292 |
| 474 | 3300005356 | Ga0070674_100037861 | Ga0070674_1000378613 | 292 |
| 475 | 3300005548 | Ga0070665_100043957 | Ga0070665_1000439573 | 292 |
| 476 | 3300005617 | Ga0068859_100028192 | Ga0068859_1000281925 | 292 |
| 477 | 3300005618 | Ga0068864_100039478 | Ga0068864_1000394782 | 292 |
| 478 | 3300005841 | Ga0068863_100238659 | Ga0068863_1002386592 | 292 |
| 479 | 3300006353 | Ga0075370_10031800 | Ga0075370_100318003 | 292 |
| 480 | 3300006931 | Ga0097620_100028192 | Ga0097620_1000281925 | 292 |
| 481 | 3300006944 | Ga0099823_1000005 | Ga0099823_100000572 | 292 |
| 482 | 3300009098 | Ga0105245_10036547 | Ga0105245_100365474 | 292 |
| 483 | 3300009177 | Ga0105248_10001355 | Ga0105248_1000135513 | 292 |
| 484 | 3300011119 | Ga0105246_10066071 | Ga0105246_100660713 | 292 |
| 485 | 3300012497 | Ga0157319_1000005 | Ga0157319_100000593 | 292 |
| 486 | 3300013308 | Ga0157375_10228383 | Ga0157375_102283832 | 292 |
| 487 | 3300021361 | Ga0213872_10001003 | Ga0213872_1000100321 | 292 |
| 488 | 3300021361 | Ga0213872_10012188 | Ga0213872_100121882 | 292 |
| 489 | 3300025273 | Ga0209673_1008988 | Ga0209673_10089883 | 292 |
| 490 | 3300025295 | Ga0209564_1000021 | Ga0209564_100002143 | 292 |
| 491 | 3300025298 | Ga0209050_1001406 | Ga0209050_100140616 | 292 |
| 492 | 3300025299 | Ga0209256_1000309 | Ga0209256_100030927 | 292 |
| 493 | 3300025299 | Ga0209256_1001207 | Ga0209256_10012072 | 292 |
| 494 | 3300025303 | Ga0209051_1000621 | Ga0209051_10006216 | 292 |
| 495 | 3300025304 | Ga0209257_1000981 | Ga0209257_10009813 | 292 |
| 496 | 3300025304 | Ga0209257_1003138 | Ga0209257_100313813 | 292 |
| 497 | 3300025925 | Ga0207650_10197233 | Ga0207650_101972331 | 292 |
| 498 | 3300025927 | Ga0207687_10078434 | Ga0207687_100784343 | 292 |
| 499 | 3300025931 | Ga0207644_10017792 | Ga0207644_100177925 | 292 |
| 500 | 3300025931 | Ga0207644_10049302 | Ga0207644_100493022 | 292 |
| 501 | 3300025937 | Ga0207669_10161409 | Ga0207669_101614092 | 292 |
| 502 | 3300025941 | Ga0207711_10115954 | Ga0207711_101159543 | 292 |
| 503 | 3300026088 | Ga0207641_10084659 | Ga0207641_100846593 | 292 |
| 504 | 3300026088 | Ga0207641_10211186 | Ga0207641_102111862 | 292 |
| 505 | 3300026095 | Ga0207676_10027619 | Ga0207676_100276195 | 292 |
| 506 | 3300026142 | Ga0207698_10120403 | Ga0207698_101204032 | 292 |
| 507 | 3300027312 | Ga0209371_1010421 | Ga0209371_10104212 | 292 |
| 508 | 3300028379 | Ga0268266_10030341 | Ga0268266_100303414 | 292 |
| 509 | 3300028786 | Ga0307517_10149179 | Ga0307517_101491792 | 292 |
| 510 | 3300028794 | Ga0307515_10007880 | Ga0307515_1000788018 | 292 |
| 511 | 3300030500 | Ga0268256_1013843 | Ga0268256_10138433 | 292 |
| 512 | 3300031507 | Ga0307509_10020734 | Ga0307509_100207347 | 292 |
| 513 | 3300031507 | Ga0307509_10024647 | Ga0307509_100246474 | 292 |
| 514 | 3300031852 | Ga0307410_10298618 | Ga0307410_102986182 | 292 |
| 515 | 3300033179 | Ga0307507_10027415 | Ga0307507_100274151 | 292 |
| 516 | 3300039447 | Ga0436361_0156562 | Ga0436361_0156562_3030_3989 | 292 |
| 517 | 3300039447 | Ga0436361_0272384 | Ga0436361_0272384_3901_4860 | 292 |
| 518 | 3300042127 | Ga0450890_000482 | Ga0450890_000482_3450_4415 | 292 |
| 519 | 3300042437 | Ga0439444_0003978 | Ga0439444_0003978_59_1024 | 292 |
| 520 | 3300042438 | Ga0439459_0000990 | Ga0439459_0000990_438_1403 | 292 |
| 521 | 3300046616 | Ga0495668_0021362 | Ga0495668_0021362_263_1207 | 292 |
| 522 | 3300046692 | Ga0495671_0099716 | Ga0495671_0099716_197_1141 | 292 |
| 523 | 3300048911 | Ga0496108_0167965 | Ga0496108_0167965_48_995 | 292 |
| 524 | 3300048915 | Ga0496112_0009640 | Ga0496112_0009640_7117_8064 | 292 |
| 525 | 3300050493 | nmdc:mga0k408_53141_c1 | nmdc:mga0k408_53141_c1_1363_2328 | 292 |
| 526 | 3300053086 | Ga0500578_0008111 | Ga0500578_0008111_4317_5261 | 292 |
| 527 | 3300053139 | Ga0500568_0007565 | Ga0500568_0007565_1178_2131 | 292 |
| 528 | 3300005614 | Ga0068856_100363585 | Ga0068856_1003635852 | 293 |
| 529 | 3300048912 | Ga0496109_0192421 | Ga0496109_0192421_662_1681 | 293 |
| 530 | 3300046473 | Ga0495582_0140188 | Ga0495582_0140188_111_1061 | 294 |
| 531 | 3300031649 | Ga0307514_10000339 | Ga0307514_1000033910 | 295 |
| 532 | 3300037471 | Ga0395905_0034159 | Ga0395905_0034159_11_979 | 295 |
| 533 | 3300025256 | Ga0209759_1001016 | Ga0209759_100101611 | 296 |
| 534 | 3300031730 | Ga0307516_10006214 | Ga0307516_100062143 | 296 |
| 535 | 3300006353 | Ga0075370_10012670 | Ga0075370_100126704 | 297 |
| 536 | 3300028794 | Ga0307515_10005664 | Ga0307515_100056643 | 297 |
| 537 | 3300050496 | nmdc:mga07m45_3233_c1 | nmdc:mga07m45_3233_c1_4475_5443 | 297 |
| 538 | 3300025909 | Ga0207705_10127801 | Ga0207705_101278012 | 300 |
| 539 | 3300046506 | Ga0495583_0000428 | Ga0495583_0000428_12022_12996 | 300 |
| 540 | 3300046507 | Ga0495606_0000821 | Ga0495606_0000821_32597_33571 | 300 |
| 541 | 3300046616 | Ga0495668_0036997 | Ga0495668_0036997_260_1234 | 300 |
| 542 | 3300046660 | Ga0495625_0025677 | Ga0495625_0025677_1799_2773 | 300 |
| 543 | 3300046694 | Ga0495649_0003008 | Ga0495649_0003008_2296_3270 | 300 |
| 544 | 3300046794 | Ga0495589_0015574 | Ga0495589_0015574_2705_3679 | 300 |
| 545 | 3300053080 | Ga0500635_0052561 | Ga0500635_0052561_251_1225 | 300 |
| 546 | 3300053131 | Ga0500652_089641 | Ga0500652_089641_154_1122 | 300 |
| 547 | 3300053177 | Ga0500636_0032479 | Ga0500636_0032479_1867_2841 | 300 |
| 548 | 3300055283 | Ga0500661_016932 | Ga0500661_016932_201_1175 | 300 |
| 549 | 3300002705 | JGI25156J39149_1000273 | JGI25156J39149_100027330 | 301 |
| 550 | 3300002741 | JGI25157J39369_1000141 | JGI25157J39369_100014130 | 301 |
| 551 | 3300003323 | rootH1_10024534 | rootH1_100245341 | 301 |
| 552 | 3300003756 | Ga0055533_1000008 | Ga0055533_1000008153 | 301 |
| 553 | 3300003759 | Ga0055525_1001100 | Ga0055525_10011003 | 301 |
| 554 | 3300003761 | Ga0055535_1000271 | Ga0055535_10002715 | 301 |
| 555 | 3300003763 | Ga0055529_1000321 | Ga0055529_100032144 | 301 |
| 556 | 3300005334 | Ga0068869_100349062 | Ga0068869_1003490621 | 301 |
| 557 | 3300005338 | Ga0068868_100122638 | Ga0068868_1001226383 | 301 |
| 558 | 3300005339 | Ga0070660_100131055 | Ga0070660_1001310551 | 301 |
| 559 | 3300005339 | Ga0070660_100277679 | Ga0070660_1002776792 | 301 |
| 560 | 3300005364 | Ga0070673_100014291 | Ga0070673_1000142914 | 301 |
| 561 | 3300005367 | Ga0070667_100267146 | Ga0070667_1002671461 | 301 |
| 562 | 3300005563 | Ga0068855_100387551 | Ga0068855_1003875511 | 301 |
| 563 | 3300005577 | Ga0068857_100028700 | Ga0068857_1000287004 | 301 |
| 564 | 3300005578 | Ga0068854_100047028 | Ga0068854_1000470283 | 301 |
| 565 | 3300005614 | Ga0068856_100000135 | Ga0068856_10000013562 | 301 |
| 566 | 3300005616 | Ga0068852_100215107 | Ga0068852_1002151072 | 301 |
| 567 | 3300006353 | Ga0075370_10002303 | Ga0075370_100023038 | 301 |
| 568 | 3300009093 | Ga0105240_10075146 | Ga0105240_100751464 | 301 |
| 569 | 3300009093 | Ga0105240_10588401 | Ga0105240_105884011 | 301 |
| 570 | 3300010375 | Ga0105239_10032539 | Ga0105239_100325394 | 301 |
| 571 | 3300011119 | Ga0105246_10038570 | Ga0105246_100385704 | 301 |
| 572 | 3300013105 | Ga0157369_10267036 | Ga0157369_102670362 | 301 |
| 573 | 3300013297 | Ga0157378_10294993 | Ga0157378_102949932 | 301 |
| 574 | 3300013307 | Ga0157372_10140135 | Ga0157372_101401351 | 301 |
| 575 | 3300014968 | Ga0157379_10193293 | Ga0157379_101932932 | 301 |
| 576 | 3300025226 | Ga0209674_100015 | Ga0209674_100015511 | 301 |
| 577 | 3300025230 | Ga0209563_100017 | Ga0209563_100017608 | 301 |
| 578 | 3300025231 | Ga0207427_100444 | Ga0207427_1004449 | 301 |
| 579 | 3300025242 | Ga0209258_100025 | Ga0209258_1000256 | 301 |
| 580 | 3300025242 | Ga0209258_100726 | Ga0209258_1007264 | 301 |
| 581 | 3300025246 | Ga0209646_1000438 | Ga0209646_100043812 | 301 |
| 582 | 3300025250 | Ga0209026_1000028 | Ga0209026_1000028115 | 301 |
| 583 | 3300025253 | Ga0209677_100037 | Ga0209677_100037108 | 301 |
| 584 | 3300025253 | Ga0209677_100113 | Ga0209677_10011328 | 301 |
| 585 | 3300025254 | Ga0209148_1002792 | Ga0209148_10027925 | 301 |
| 586 | 3300025256 | Ga0209759_1000021 | Ga0209759_1000021171 | 301 |
| 587 | 3300025256 | Ga0209759_1005783 | Ga0209759_10057832 | 301 |
| 588 | 3300025272 | Ga0209455_1000166 | Ga0209455_100016691 | 301 |
| 589 | 3300025913 | Ga0207695_10007014 | Ga0207695_100070144 | 301 |
| 590 | 3300025919 | Ga0207657_10063014 | Ga0207657_100630143 | 301 |
| 591 | 3300025932 | Ga0207690_10009309 | Ga0207690_100093092 | 301 |
| 592 | 3300025942 | Ga0207689_10037320 | Ga0207689_100373203 | 301 |
| 593 | 3300025949 | Ga0207667_10003517 | Ga0207667_1000351716 | 301 |
| 594 | 3300025981 | Ga0207640_10054762 | Ga0207640_100547621 | 301 |
| 595 | 3300026023 | Ga0207677_10314377 | Ga0207677_103143772 | 301 |
| 596 | 3300026041 | Ga0207639_10384146 | Ga0207639_103841462 | 301 |
| 597 | 3300026078 | Ga0207702_10001523 | Ga0207702_1000152315 | 301 |
| 598 | 3300026116 | Ga0207674_10016268 | Ga0207674_100162683 | 301 |
| 599 | 3300026118 | Ga0207675_100025649 | Ga0207675_1000256491 | 301 |
| 600 | 3300028666 | Ga0265336_10000274 | Ga0265336_1000027411 | 301 |
| 601 | 3300031730 | Ga0307516_10000107 | Ga0307516_1000010779 | 301 |
| 602 | 3300037466 | Ga0395898_0028823 | Ga0395898_0028823_2066_3034 | 301 |
| 603 | 3300038443 | Ga0395901_0006507 | Ga0395901_0006507_6695_7663 | 301 |
| 604 | 3300044694 | Ga0466963_0017494 | Ga0466963_0017494_1447_2415 | 301 |
| 605 | 3300047472 | Ga0495686_0023279 | Ga0495686_0023279_246_1214 | 301 |
| 606 | 3300048909 | Ga0496106_0274144 | Ga0496106_0274144_20_988 | 301 |
| 607 | 3300050496 | nmdc:mga07m45_4373_c1 | nmdc:mga07m45_4373_c1_545_1513 | 301 |
| 608 | 3300053080 | Ga0500635_0000070 | Ga0500635_0000070_52394_53362 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yj7-assembly2.cif.gz_B | crystal structure of a hyperstable protein from the precambrian period | 0.9412 | 1 | 110 |
| 7c3f-assembly4.cif.gz_L | crystal structure of ferredoxin: thioredoxin reductase and thioredoxin m2 complex | 0.9402 | 1 | 110 |
| 4ulx-assembly1.cif.gz_A | crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant. | 0.9342 | 1 | 110 |
| 2fch-assembly5.cif.gz_E | crystal structure of thioredoxin mutant g74s | 0.9319 | 1 | 111 |
| 5hr2-assembly1.cif.gz_A | crystal structure of thioredoxin l94a mutant | 0.9317 | 2 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ulxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9342 | 1 | 110 | 3.40.30.10 |
| af_Q54NX3_19_129_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9318 | 3 | 108 | 3.40.30.10 |
| 3vfiA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9284 | 1 | 110 | 3.40.30.10 |
| 3vfiA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.92 | 1 | 110 | 3.40.30.10 |
| 4ulxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9174 | 1 | 110 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520BEP6-F1-model_v4 | Co-chaperone YbbN | 1.002 | 1 | 112 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A520H0B7-F1-model_v4 | Co-chaperone YbbN | 1.001 | 1 | 105 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A4Q5WIQ6-F1-model_v4 | deleted | 0.9988 | 1 | 120 |
|
| AF-A0A520H0B7-F1-model_v4 | Co-chaperone YbbN | 0.9918 | 1 | 105 |
GO:0005829
GO:0015035 GO:0045454 |
| AF-A0A7Y1UPT9-F1-model_v4 | Thioredoxin | 0.9796 | 1 | 112 |
GO:0005829
GO:0015035 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar