F468713
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 607 | 350 | 545 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0021274|Ga0395899_0021274_1547_2584 |
| Length | 345 |
| Sequence | MRSRRSRRSYTGKQLAAASRSYDGLRFGSPCSHGPDPHNGGPFADEPPVSLTTRLTYVLPHRVLSSLARRLAYSDHPGVSRWLIDTVTKRFGVDLTEAAEPDPRAYPTFNAFFTRALRVGARAPDXXXRALLMPADGRISECGHIGRADEGVLHEDHGHIFQAKGHGFTTAELLGDATAAQAFAGGVYATVYLSPRDYHRVHMPWTGTLRETVHVPGRLFSVGPDAVGTVSKLFARNERLVCHFDCDFGPMAVVMVGALLVSGVETVWGGVEIPPYGGPVVVKDYRAGNSSGEAIVLERFAEMARFNYGSTVIVLLPPGVATLAPQLGAETAVRLGERLATIAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 4 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 5 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 6 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 7 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 8 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 9 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 10 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 11 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 12 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 13 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 14 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 15 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 16 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 17 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 18 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 19 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 20 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 21 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 22 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 23 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 24 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 25 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 26 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 27 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 28 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 29 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 30 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 31 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 32 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 33 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 34 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 35 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 36 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 37 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 38 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 39 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 40 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 41 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 42 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 43 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 44 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 45 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 46 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 47 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 48 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 49 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 50 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 51 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 52 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 53 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 54 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 55 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 56 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 57 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 58 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 59 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 60 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 61 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 62 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 63 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 64 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 65 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 66 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 67 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 68 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 69 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 70 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 71 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 79 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 80 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 82 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 101 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 102 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 105 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 110 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 111 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 112 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 113 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 114 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 115 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 116 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 117 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 118 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 214 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 215 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 216 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 217 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 246 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 247 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 248 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 249 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 250 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 258 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 261 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 291 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 292 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 301 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 304 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 305 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 334 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 349 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 350 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.46 |
| Metatranscriptomes | 0.33 |
| Isolates | 10.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.16 |
| Bulb | 0 |
| Endosphere | 15.32 |
| Nodule | 0.33 |
| Rhizoplane | 3.29 |
| Rhizosphere | 66.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3430003 | 2162886007 | Bacteria | 3997 |
| 2 | JGI24741J21665_1001939 | 3300001915 | Bacteria | 5578 |
| 3 | JGI24740J21852_10002530 | 3300001979 | Bacteria | 8255 |
| 4 | JGI25162J39368_1001808 | 3300002737 | Bacteria | 10048 |
| 5 | JGI25162J39368_1001810 | 3300002737 | Bacteria | 10041 |
| 6 | JGI25157J39369_1000764 | 3300002741 | Bacteria | 16694 |
| 7 | JGI25164J39214_1000891 | 3300002772 | Bacteria | 10040 |
| 8 | JGI25164J39214_1001247 | 3300002772 | Bacteria | 6754 |
| 9 | JGI25152J39213_1000548 | 3300002773 | Bacteria | 20669 |
| 10 | JGI25150J39212_1000114 | 3300002774 | Bacteria | 45745 |
| 11 | JGI25151J46595_10000100 | 3300003187 | Bacteria | 116522 |
| 12 | JGI25151J46595_10000128 | 3300003187 | Bacteria | 102514 |
| 13 | JGI25165J46597_1001382 | 3300003214 | Bacteria | 13341 |
| 14 | JGI25165J46597_1001877 | 3300003214 | Bacteria | 8582 |
| 15 | JGI25153J46596_10000071 | 3300003215 | Bacteria | 116950 |
| 16 | Ga0055526_1000021 | 3300003771 | Bacteria | 180007 |
| 17 | Ga0055526_1000486 | 3300003771 | Bacteria | 31535 |
| 18 | Ga0055537_1000141 | 3300003773 | Bacteria | 54030 |
| 19 | Ga0055524_1000128 | 3300003775 | Bacteria | 88986 |
| 20 | Ga0055524_1036326 | 3300003775 | Bacteria | 1327 |
| 21 | Ga0055536_1003210 | 3300003781 | Bacteria | 8863 |
| 22 | Ga0055536_1010253 | 3300003781 | Bacteria | 3744 |
| 23 | Ga0055536_1010288 | 3300003781 | Bacteria | 3735 |
| 24 | Ga0055534_1000034 | 3300003784 | Bacteria | 114684 |
| 25 | Ga0055534_1000054 | 3300003784 | Bacteria | 88986 |
| 26 | Ga0055528_1000009 | 3300003790 | Bacteria | 224150 |
| 27 | Ga0055528_1000671 | 3300003790 | Bacteria | 24792 |
| 28 | Ga0055530_10003879 | 3300003791 | Bacteria | 8173 |
| 29 | Ga0055530_10003891 | 3300003791 | Bacteria | 8143 |
| 30 | Ga0055530_10006699 | 3300003791 | Bacteria | 5061 |
| 31 | Ga0055531_10001755 | 3300003794 | Bacteria | 15453 |
| 32 | Ga0055531_10013574 | 3300003794 | Bacteria | 3744 |
| 33 | Ga0055531_10014194 | 3300003794 | Bacteria | 3607 |
| 34 | Ga0055531_10015882 | 3300003794 | Bacteria | 3285 |
| 35 | Ga0055531_10023878 | 3300003794 | Bacteria | 2275 |
| 36 | Ga0055531_10034919 | 3300003794 | Bacteria | 1585 |
| 37 | Ga0058692_1000011 | 3300003856 | Bacteria | 321321 |
| 38 | Ga0058692_1000024 | 3300003856 | Bacteria | 219702 |
| 39 | Ga0065704_10070427 | 3300005289 | Bacteria | 25272 |
| 40 | Ga0065715_10119645 | 3300005293 | Bacteria | 2281 |
| 41 | Ga0070683_100002993 | 3300005329 | Bacteria | 13555 |
| 42 | Ga0070677_10144016 | 3300005333 | Bacteria | 1102 |
| 43 | Ga0070666_10161546 | 3300005335 | Bacteria | 1566 |
| 44 | Ga0070666_10357797 | 3300005335 | Bacteria | 1045 |
| 45 | Ga0070680_100035853 | 3300005336 | Bacteria | 4006 |
| 46 | Ga0070680_100462075 | 3300005336 | Bacteria | 1084 |
| 47 | Ga0070682_100002010 | 3300005337 | Bacteria | 11358 |
| 48 | Ga0070660_100062724 | 3300005339 | Bacteria | 2888 |
| 49 | Ga0070661_100174837 | 3300005344 | Bacteria | 1632 |
| 50 | Ga0070692_10001511 | 3300005345 | Bacteria | 8515 |
| 51 | Ga0070668_100003985 | 3300005347 | Bacteria | 10932 |
| 52 | Ga0070669_100021116 | 3300005353 | Bacteria | 4653 |
| 53 | Ga0070675_100183973 | 3300005354 | Bacteria | 1808 |
| 54 | Ga0070675_100215198 | 3300005354 | Bacteria | 1672 |
| 55 | Ga0070674_100380553 | 3300005356 | Bacteria | 1148 |
| 56 | Ga0070667_100326170 | 3300005367 | Bacteria | 1386 |
| 57 | Ga0070714_100000309 | 3300005435 | Bacteria | 37078 |
| 58 | Ga0070714_100010639 | 3300005435 | Bacteria | 7278 |
| 59 | Ga0070714_100461773 | 3300005435 | Bacteria | 1207 |
| 60 | Ga0070713_100007035 | 3300005436 | Bacteria | 7857 |
| 61 | Ga0070710_10081272 | 3300005437 | Bacteria | 1892 |
| 62 | Ga0070694_100016102 | 3300005444 | Bacteria | 4706 |
| 63 | Ga0070663_100007817 | 3300005455 | Bacteria | 6536 |
| 64 | Ga0070681_10000029 | 3300005458 | Bacteria | 104346 |
| 65 | Ga0070681_10007131 | 3300005458 | Bacteria | 10890 |
| 66 | Ga0070681_10011742 | 3300005458 | Bacteria | 8678 |
| 67 | Ga0070681_10136745 | 3300005458 | Bacteria | 2381 |
| 68 | Ga0070681_10422246 | 3300005458 | Bacteria | 1245 |
| 69 | Ga0070681_10562173 | 3300005458 | Bacteria | 1054 |
| 70 | Ga0070681_10652263 | 3300005458 | Bacteria | 967 |
| 71 | Ga0068867_100185165 | 3300005459 | Bacteria | 1658 |
| 72 | Ga0070679_100000372 | 3300005530 | Bacteria | 38070 |
| 73 | Ga0070679_100005054 | 3300005530 | Bacteria | 12176 |
| 74 | Ga0070679_100016047 | 3300005530 | Bacteria | 7214 |
| 75 | Ga0070684_100007023 | 3300005535 | Bacteria | 8750 |
| 76 | Ga0068853_100000560 | 3300005539 | Bacteria | 25470 |
| 77 | Ga0068853_100003691 | 3300005539 | Bacteria | 11748 |
| 78 | Ga0068853_100011050 | 3300005539 | Bacteria | 7323 |
| 79 | Ga0068853_100164047 | 3300005539 | Bacteria | 2006 |
| 80 | Ga0068853_100186624 | 3300005539 | Bacteria | 1882 |
| 81 | Ga0070672_100004894 | 3300005543 | Bacteria | 8811 |
| 82 | Ga0070696_100002455 | 3300005546 | Bacteria | 12296 |
| 83 | Ga0070696_100012046 | 3300005546 | Bacteria | 5793 |
| 84 | Ga0070696_100016626 | 3300005546 | Bacteria | 4959 |
| 85 | Ga0070693_100012474 | 3300005547 | Bacteria | 4301 |
| 86 | Ga0070693_100016710 | 3300005547 | Bacteria | 3802 |
| 87 | Ga0070665_100200891 | 3300005548 | Bacteria | 1994 |
| 88 | Ga0068855_100011338 | 3300005563 | Bacteria | 10760 |
| 89 | Ga0068855_100027527 | 3300005563 | Bacteria | 6799 |
| 90 | Ga0068855_100559354 | 3300005563 | Bacteria | 1237 |
| 91 | Ga0068854_100071896 | 3300005578 | Bacteria | 2532 |
| 92 | Ga0068854_100156886 | 3300005578 | Bacteria | 1759 |
| 93 | Ga0068854_100180122 | 3300005578 | Bacteria | 1650 |
| 94 | Ga0068856_100000234 | 3300005614 | Bacteria | 60217 |
| 95 | Ga0068852_100005378 | 3300005616 | Bacteria | 9155 |
| 96 | Ga0068859_100047374 | 3300005617 | Bacteria | 4319 |
| 97 | Ga0068864_100217571 | 3300005618 | Bacteria | 1761 |
| 98 | Ga0068863_100361920 | 3300005841 | Bacteria | 1414 |
| 99 | Ga0068860_100039783 | 3300005843 | Bacteria | 4497 |
| 100 | Ga0075365_10060969 | 3300006038 | Bacteria | 2518 |
| 101 | Ga0075364_10000020 | 3300006051 | Bacteria | 54215 |
| 102 | Ga0075369_10055806 | 3300006186 | Bacteria | 1717 |
| 103 | Ga0097620_100047374 | 3300006931 | Bacteria | 4319 |
| 104 | Ga0099826_10113365 | 3300006948 | Bacteria | 1611 |
| 105 | Ga0105251_10006353 | 3300009011 | Bacteria | 7548 |
| 106 | Ga0105244_10038939 | 3300009036 | Bacteria | 2477 |
| 107 | Ga0105240_10011255 | 3300009093 | Bacteria | 12473 |
| 108 | Ga0105240_10028762 | 3300009093 | Bacteria | 7250 |
| 109 | Ga0105240_10092734 | 3300009093 | Bacteria | 3687 |
| 110 | Ga0105245_10218788 | 3300009098 | Bacteria | 1837 |
| 111 | Ga0105245_10276405 | 3300009098 | Bacteria | 1640 |
| 112 | Ga0105243_10065350 | 3300009148 | Bacteria | 2922 |
| 113 | Ga0105241_10381857 | 3300009174 | Bacteria | 1231 |
| 114 | Ga0105248_10331750 | 3300009177 | Bacteria | 1713 |
| 115 | Ga0105237_10011506 | 3300009545 | Bacteria | 9361 |
| 116 | Ga0105238_10004604 | 3300009551 | Bacteria | 13643 |
| 117 | Ga0105238_10007073 | 3300009551 | Bacteria | 11228 |
| 118 | Ga0105238_10029020 | 3300009551 | Bacteria | 5635 |
| 119 | Ga0105238_10039845 | 3300009551 | Bacteria | 4762 |
| 120 | Ga0105238_10047996 | 3300009551 | Bacteria | 4304 |
| 121 | Ga0105032_100180 | 3300009979 | Bacteria | 6509 |
| 122 | Ga0105239_10195593 | 3300010375 | Bacteria | 2264 |
| 123 | Ga0157373_10008924 | 3300013100 | Bacteria | 7417 |
| 124 | Ga0157373_10027422 | 3300013100 | Bacteria | 4108 |
| 125 | Ga0157373_10059372 | 3300013100 | Bacteria | 2710 |
| 126 | Ga0157371_10000154 | 3300013102 | Bacteria | 100237 |
| 127 | Ga0157371_10002651 | 3300013102 | Bacteria | 16946 |
| 128 | Ga0157371_10012336 | 3300013102 | Bacteria | 6539 |
| 129 | Ga0157371_10032246 | 3300013102 | Bacteria | 3771 |
| 130 | Ga0157371_10070183 | 3300013102 | Bacteria | 2481 |
| 131 | Ga0157371_10338334 | 3300013102 | Bacteria | 1094 |
| 132 | Ga0157370_10004589 | 3300013104 | Bacteria | 15809 |
| 133 | Ga0157370_10008833 | 3300013104 | Bacteria | 10831 |
| 134 | Ga0157370_10012597 | 3300013104 | Bacteria | 8763 |
| 135 | Ga0157370_10013540 | 3300013104 | Bacteria | 8396 |
| 136 | Ga0157370_10015401 | 3300013104 | Bacteria | 7773 |
| 137 | Ga0157370_10043506 | 3300013104 | Bacteria | 4321 |
| 138 | Ga0157370_10052040 | 3300013104 | Bacteria | 3910 |
| 139 | Ga0157370_10083839 | 3300013104 | Bacteria | 2996 |
| 140 | Ga0157370_10117649 | 3300013104 | Bacteria | 2482 |
| 141 | Ga0157370_10315849 | 3300013104 | Bacteria | 1442 |
| 142 | Ga0157369_10000148 | 3300013105 | Bacteria | 100073 |
| 143 | Ga0157369_10017641 | 3300013105 | Bacteria | 8021 |
| 144 | Ga0157369_10018886 | 3300013105 | Bacteria | 7725 |
| 145 | Ga0157369_10236378 | 3300013105 | Bacteria | 1909 |
| 146 | Ga0157369_10399732 | 3300013105 | Bacteria | 1425 |
| 147 | Ga0157378_10036223 | 3300013297 | Bacteria | 4367 |
| 148 | Ga0163162_10000007 | 3300013306 | Bacteria | 368084 |
| 149 | Ga0157372_10003801 | 3300013307 | Bacteria | 16211 |
| 150 | Ga0157372_10015387 | 3300013307 | Bacteria | 8198 |
| 151 | Ga0157372_10149646 | 3300013307 | Bacteria | 2694 |
| 152 | Ga0157372_10235558 | 3300013307 | Bacteria | 2123 |
| 153 | Ga0157372_10328623 | 3300013307 | Bacteria | 1780 |
| 154 | Ga0157372_10486300 | 3300013307 | Bacteria | 1439 |
| 155 | Ga0157375_10000256 | 3300013308 | Bacteria | 48304 |
| 156 | Ga0157375_10048294 | 3300013308 | Bacteria | 4163 |
| 157 | Ga0157375_10301943 | 3300013308 | Bacteria | 1764 |
| 158 | Ga0182008_10000142 | 3300014497 | Bacteria | 55320 |
| 159 | Ga0182008_10008964 | 3300014497 | Bacteria | 5422 |
| 160 | Ga0182008_10031525 | 3300014497 | Bacteria | 2668 |
| 161 | Ga0157376_10001188 | 3300014969 | Bacteria | 17183 |
| 162 | Ga0182006_1013905 | 3300015261 | Bacteria | 3479 |
| 163 | Ga0182006_1019604 | 3300015261 | Bacteria | 2845 |
| 164 | Ga0182006_1031233 | 3300015261 | Bacteria | 2148 |
| 165 | Ga0182007_10000287 | 3300015262 | Bacteria | 33403 |
| 166 | Ga0182007_10011339 | 3300015262 | Bacteria | 3472 |
| 167 | Ga0182007_10047471 | 3300015262 | Bacteria | 1420 |
| 168 | Ga0182005_1002348 | 3300015265 | Bacteria | 6824 |
| 169 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 170 | Ga0163161_10001348 | 3300017792 | Bacteria | 18260 |
| 171 | Ga0163161_10021106 | 3300017792 | Bacteria | 4578 |
| 172 | Ga0206354_10831098 | 3300020081 | Bacteria | 13528 |
| 173 | Ga0154015_1062321 | 3300020610 | Bacteria | 2446 |
| 174 | Ga0207427_100115 | 3300025231 | Bacteria | 104282 |
| 175 | Ga0207427_100130 | 3300025231 | Bacteria | 94510 |
| 176 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 177 | Ga0209437_100079 | 3300025233 | Bacteria | 275948 |
| 178 | Ga0207425_1000030 | 3300025245 | Bacteria | 268200 |
| 179 | Ga0207425_1019940 | 3300025245 | Bacteria | 1439 |
| 180 | Ga0209026_1000051 | 3300025250 | Bacteria | 250792 |
| 181 | Ga0209129_1000063 | 3300025258 | Bacteria | 240205 |
| 182 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 183 | Ga0209233_1000121 | 3300025261 | Bacteria | 233309 |
| 184 | Ga0209565_1000022 | 3300025263 | Bacteria | 390888 |
| 185 | Ga0209565_1000048 | 3300025263 | Bacteria | 224961 |
| 186 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 187 | Ga0209673_1000104 | 3300025273 | Bacteria | 186569 |
| 188 | Ga0209673_1012935 | 3300025273 | Bacteria | 3324 |
| 189 | Ga0209130_1014151 | 3300025284 | Bacteria | 2014 |
| 190 | Ga0209675_1000045 | 3300025291 | Bacteria | 225750 |
| 191 | Ga0209675_1000048 | 3300025291 | Bacteria | 221457 |
| 192 | Ga0209675_1006536 | 3300025291 | Bacteria | 4652 |
| 193 | Ga0209676_1000024 | 3300025292 | Bacteria | 578839 |
| 194 | Ga0209676_1000091 | 3300025292 | Bacteria | 251328 |
| 195 | Ga0209676_1000117 | 3300025292 | Bacteria | 203251 |
| 196 | Ga0209676_1001772 | 3300025292 | Bacteria | 18192 |
| 197 | Ga0209676_1004431 | 3300025292 | Bacteria | 7834 |
| 198 | Ga0209676_1017119 | 3300025292 | Bacteria | 2580 |
| 199 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 200 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 201 | Ga0209025_1001699 | 3300025294 | Bacteria | 26850 |
| 202 | Ga0209025_1011986 | 3300025294 | Bacteria | 5623 |
| 203 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 204 | Ga0209564_1000213 | 3300025295 | Bacteria | 132985 |
| 205 | Ga0209564_1007904 | 3300025295 | Bacteria | 5373 |
| 206 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 207 | Ga0209758_1024714 | 3300025297 | Bacteria | 2666 |
| 208 | Ga0209050_1000603 | 3300025298 | Bacteria | 57120 |
| 209 | Ga0209050_1001640 | 3300025298 | Bacteria | 22906 |
| 210 | Ga0209050_1005300 | 3300025298 | Bacteria | 8195 |
| 211 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 212 | Ga0209256_1003125 | 3300025299 | Bacteria | 12074 |
| 213 | Ga0209256_1004506 | 3300025299 | Bacteria | 8700 |
| 214 | Ga0209256_1004759 | 3300025299 | Bacteria | 8282 |
| 215 | Ga0209256_1005517 | 3300025299 | Bacteria | 7236 |
| 216 | Ga0209256_1020821 | 3300025299 | Bacteria | 2034 |
| 217 | Ga0209051_1006048 | 3300025303 | Bacteria | 6908 |
| 218 | Ga0209051_1012596 | 3300025303 | Bacteria | 4082 |
| 219 | Ga0209257_1000062 | 3300025304 | Bacteria | 362413 |
| 220 | Ga0209257_1000122 | 3300025304 | Bacteria | 219678 |
| 221 | Ga0209257_1000217 | 3300025304 | Bacteria | 136049 |
| 222 | Ga0209257_1000243 | 3300025304 | Bacteria | 126291 |
| 223 | Ga0209257_1001409 | 3300025304 | Bacteria | 28685 |
| 224 | Ga0209257_1001842 | 3300025304 | Bacteria | 23103 |
| 225 | Ga0209257_1003711 | 3300025304 | Bacteria | 12692 |
| 226 | Ga0209257_1004748 | 3300025304 | Bacteria | 10151 |
| 227 | Ga0209257_1005770 | 3300025304 | Bacteria | 8451 |
| 228 | Ga0209257_1013027 | 3300025304 | Bacteria | 3753 |
| 229 | Ga0209257_1014540 | 3300025304 | Bacteria | 3373 |
| 230 | Ga0207713_1016794 | 3300025735 | Bacteria | 3701 |
| 231 | Ga0207692_10089366 | 3300025898 | Bacteria | 1667 |
| 232 | Ga0207680_10292890 | 3300025903 | Bacteria | 1133 |
| 233 | Ga0207647_10065285 | 3300025904 | Bacteria | 2210 |
| 234 | Ga0207705_10000968 | 3300025909 | Bacteria | 23502 |
| 235 | Ga0207654_10073192 | 3300025911 | Bacteria | 2041 |
| 236 | Ga0207707_10000216 | 3300025912 | Bacteria | 61797 |
| 237 | Ga0207707_10000285 | 3300025912 | Bacteria | 53692 |
| 238 | Ga0207707_10002882 | 3300025912 | Bacteria | 15354 |
| 239 | Ga0207707_10006803 | 3300025912 | Bacteria | 9976 |
| 240 | Ga0207695_10002942 | 3300025913 | Bacteria | 24581 |
| 241 | Ga0207671_10003439 | 3300025914 | Bacteria | 15793 |
| 242 | Ga0207660_10009145 | 3300025917 | Bacteria | 6415 |
| 243 | Ga0207660_10014673 | 3300025917 | Bacteria | 5160 |
| 244 | Ga0207660_10335654 | 3300025917 | Bacteria | 1209 |
| 245 | Ga0207649_10132106 | 3300025920 | Bacteria | 1697 |
| 246 | Ga0207652_10001445 | 3300025921 | Bacteria | 21033 |
| 247 | Ga0207652_10001658 | 3300025921 | Bacteria | 19533 |
| 248 | Ga0207652_10004611 | 3300025921 | Bacteria | 11168 |
| 249 | Ga0207652_10028948 | 3300025921 | Bacteria | 4625 |
| 250 | Ga0207652_10040233 | 3300025921 | Bacteria | 3969 |
| 251 | Ga0207681_10005175 | 3300025923 | Bacteria | 8010 |
| 252 | Ga0207694_10001329 | 3300025924 | Bacteria | 21273 |
| 253 | Ga0207694_10065310 | 3300025924 | Bacteria | 2837 |
| 254 | Ga0207694_10074612 | 3300025924 | Bacteria | 2655 |
| 255 | Ga0207694_10093609 | 3300025924 | Bacteria | 2374 |
| 256 | Ga0207694_10124398 | 3300025924 | Bacteria | 2062 |
| 257 | Ga0207687_10184891 | 3300025927 | Bacteria | 1617 |
| 258 | Ga0207700_10001685 | 3300025928 | Bacteria | 12544 |
| 259 | Ga0207664_10000300 | 3300025929 | Bacteria | 36867 |
| 260 | Ga0207664_10000884 | 3300025929 | Bacteria | 20225 |
| 261 | Ga0207664_10469911 | 3300025929 | Bacteria | 1124 |
| 262 | Ga0207644_10019547 | 3300025931 | Bacteria | 4595 |
| 263 | Ga0207690_10013740 | 3300025932 | Bacteria | 4874 |
| 264 | Ga0207690_10079526 | 3300025932 | Bacteria | 2285 |
| 265 | Ga0207690_10086988 | 3300025932 | Bacteria | 2198 |
| 266 | Ga0207706_10275037 | 3300025933 | Bacteria | 1469 |
| 267 | Ga0207706_10469701 | 3300025933 | Bacteria | 1087 |
| 268 | Ga0207686_10090069 | 3300025934 | Bacteria | 2023 |
| 269 | Ga0207709_10001041 | 3300025935 | Bacteria | 20489 |
| 270 | Ga0207691_10001351 | 3300025940 | Bacteria | 24456 |
| 271 | Ga0207667_10001277 | 3300025949 | Bacteria | 31581 |
| 272 | Ga0207667_10005450 | 3300025949 | Bacteria | 15509 |
| 273 | Ga0207667_10051224 | 3300025949 | Bacteria | 4353 |
| 274 | Ga0207667_10251289 | 3300025949 | Bacteria | 1809 |
| 275 | Ga0207668_10153578 | 3300025972 | Bacteria | 1785 |
| 276 | Ga0207668_10366736 | 3300025972 | Bacteria | 1208 |
| 277 | Ga0207640_10009981 | 3300025981 | Bacteria | 5334 |
| 278 | Ga0207658_10353571 | 3300025986 | Bacteria | 1280 |
| 279 | Ga0207639_10013523 | 3300026041 | Bacteria | 5715 |
| 280 | Ga0207639_10312141 | 3300026041 | Bacteria | 1393 |
| 281 | Ga0207678_10113753 | 3300026067 | Bacteria | 2309 |
| 282 | Ga0207678_10240017 | 3300026067 | Bacteria | 1552 |
| 283 | Ga0207678_10308580 | 3300026067 | Bacteria | 1360 |
| 284 | Ga0207678_10425972 | 3300026067 | Bacteria | 1151 |
| 285 | Ga0207702_10000113 | 3300026078 | Bacteria | 94003 |
| 286 | Ga0207702_10000474 | 3300026078 | Bacteria | 45055 |
| 287 | Ga0207702_10113288 | 3300026078 | Bacteria | 2415 |
| 288 | Ga0207641_10153524 | 3300026088 | Bacteria | 2087 |
| 289 | Ga0207641_10321894 | 3300026088 | Bacteria | 1467 |
| 290 | Ga0207648_10143860 | 3300026089 | Bacteria | 2103 |
| 291 | Ga0207674_10015151 | 3300026116 | Bacteria | 8484 |
| 292 | Ga0207674_10025973 | 3300026116 | Bacteria | 6232 |
| 293 | Ga0207675_100008513 | 3300026118 | Bacteria | 9651 |
| 294 | Ga0207698_10000276 | 3300026142 | Bacteria | 31255 |
| 295 | Ga0207698_10003769 | 3300026142 | Bacteria | 9161 |
| 296 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 297 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 298 | Ga0209999_1007733 | 3300027543 | Bacteria | 1932 |
| 299 | Ga0209982_1006567 | 3300027552 | Bacteria | 1694 |
| 300 | Ga0209983_1004486 | 3300027665 | Bacteria | 2934 |
| 301 | Ga0209971_1001850 | 3300027682 | Bacteria | 5179 |
| 302 | Ga0209974_10002513 | 3300027876 | Bacteria | 6647 |
| 303 | Ga0209974_10022211 | 3300027876 | Bacteria | 2102 |
| 304 | Ga0268266_10166883 | 3300028379 | Bacteria | 1995 |
| 305 | Ga0268266_10174276 | 3300028379 | Bacteria | 1954 |
| 306 | Ga0268264_10106646 | 3300028381 | Bacteria | 2446 |
| 307 | Ga0307515_10268053 | 3300028794 | Bacteria | 1433 |
| 308 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 309 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 310 | Ga0316177_1154661 | 3300030731 | Bacteria | 3036 |
| 311 | Ga0316176_1196688 | 3300030732 | Bacteria | 2111 |
| 312 | Ga0316183_1165678 | 3300030742 | Bacteria | 4311 |
| 313 | Ga0316181_1116568 | 3300030744 | Bacteria | 2745 |
| 314 | Ga0316182_1032687 | 3300030745 | Bacteria | 1599 |
| 315 | Ga0316182_1045838 | 3300030745 | Bacteria | 1920 |
| 316 | Ga0307513_10001515 | 3300031456 | Bacteria | 33354 |
| 317 | Ga0307408_100103013 | 3300031548 | Bacteria | 2178 |
| 318 | Ga0316579_10051224 | 3300031691 | Bacteria | 1931 |
| 319 | Ga0316576_10101615 | 3300031727 | Bacteria | 2149 |
| 320 | Ga0307516_10023137 | 3300031730 | Bacteria | 6375 |
| 321 | Ga0316577_10262752 | 3300031733 | Bacteria | 976 |
| 322 | Ga0307413_10020201 | 3300031824 | Bacteria | 3536 |
| 323 | Ga0307413_10106519 | 3300031824 | Bacteria | 1866 |
| 324 | Ga0307413_10108752 | 3300031824 | Bacteria | 1851 |
| 325 | Ga0307413_10337769 | 3300031824 | Bacteria | 1157 |
| 326 | Ga0307410_10022805 | 3300031852 | Bacteria | 3877 |
| 327 | Ga0307410_10167656 | 3300031852 | Bacteria | 1652 |
| 328 | Ga0307406_10097183 | 3300031901 | Bacteria | 1997 |
| 329 | Ga0307406_10153855 | 3300031901 | Bacteria | 1644 |
| 330 | Ga0307406_10241399 | 3300031901 | Bacteria | 1355 |
| 331 | Ga0307412_10003464 | 3300031911 | Bacteria | 8772 |
| 332 | Ga0307409_100302032 | 3300031995 | Bacteria | 1489 |
| 333 | Ga0307416_100043968 | 3300032002 | Bacteria | 3503 |
| 334 | Ga0307414_10007328 | 3300032004 | Bacteria | 6198 |
| 335 | Ga0307414_10008024 | 3300032004 | Bacteria | 5968 |
| 336 | Ga0307414_10047686 | 3300032004 | Bacteria | 2950 |
| 337 | Ga0307414_10320160 | 3300032004 | Bacteria | 1319 |
| 338 | Ga0307411_10014333 | 3300032005 | Bacteria | 4406 |
| 339 | Ga0307411_10384424 | 3300032005 | Bacteria | 1155 |
| 340 | Ga0373926_0171250 | 3300035083 | Bacteria | 831 |
| 341 | Ga0373944_0032391 | 3300035089 | Bacteria | 1578 |
| 342 | Ga0373923_0173399 | 3300035111 | Bacteria | 989 |
| 343 | Ga0373945_0102135 | 3300035116 | Bacteria | 1123 |
| 344 | Ga0373956_0085433 | 3300035119 | Bacteria | 1451 |
| 345 | Ga0373943_0220229 | 3300035170 | Bacteria | 1057 |
| 346 | Ga0316574_0066867 | 3300035398 | Bacteria | 2265 |
| 347 | Ga0316582_0084641 | 3300036647 | Bacteria | 2076 |
| 348 | Ga0395899_0021274 | 3300037312 | Bacteria | 4921 |
| 349 | Ga0395899_0378782 | 3300037312 | Bacteria | 941 |
| 350 | Ga0395900_0000175 | 3300037418 | Bacteria | 102937 |
| 351 | Ga0395900_0031426 | 3300037418 | Bacteria | 5455 |
| 352 | Ga0395900_0098626 | 3300037418 | Bacteria | 3002 |
| 353 | Ga0395900_0274081 | 3300037418 | Bacteria | 1681 |
| 354 | Ga0395898_0260825 | 3300037466 | Bacteria | 1653 |
| 355 | Ga0395905_0000503 | 3300037471 | Bacteria | 53661 |
| 356 | Ga0395905_0019782 | 3300037471 | Bacteria | 6382 |
| 357 | Ga0395901_0001216 | 3300038443 | Bacteria | 27417 |
| 358 | Ga0395901_0400550 | 3300038443 | Bacteria | 1410 |
| 359 | Ga0237819_00151 | 3300038705 | Bacteria | 25521 |
| 360 | Ga0237816_00052 | 3300039145 | Bacteria | 7620 |
| 361 | Ga0439436_0008498 | 3300041404 | Bacteria | 3158 |
| 362 | Ga0439436_0017952 | 3300041404 | Bacteria | 2117 |
| 363 | Ga0439436_0023615 | 3300041404 | Bacteria | 1818 |
| 364 | Ga0439436_0031231 | 3300041404 | Bacteria | 1546 |
| 365 | Ga0439447_007420 | 3300041407 | Bacteria | 3482 |
| 366 | Ga0439465_0001513 | 3300041413 | Bacteria | 7550 |
| 367 | Ga0439465_0004624 | 3300041413 | Bacteria | 4442 |
| 368 | Ga0451789_1189856 | 3300041443 | Bacteria | 1177 |
| 369 | Ga0451791_0501601 | 3300041451 | Bacteria | 984 |
| 370 | Ga0451791_0669101 | 3300041451 | Bacteria | 1999 |
| 371 | Ga0451793_0382579 | 3300041452 | Bacteria | 1042 |
| 372 | Ga0451800_1497069 | 3300041459 | Bacteria | 7935 |
| 373 | Ga0451802_0225807 | 3300041460 | Bacteria | 4748 |
| 374 | Ga0451802_1329035 | 3300041460 | Bacteria | 1426 |
| 375 | Ga0451806_254328 | 3300041462 | Bacteria | 6559 |
| 376 | Ga0451807_0519353 | 3300041486 | Bacteria | 7299 |
| 377 | Ga0451807_2648432 | 3300041486 | Bacteria | 1298 |
| 378 | Ga0451837_0224093 | 3300041494 | Bacteria | 2030 |
| 379 | Ga0451837_1853913 | 3300041494 | Bacteria | 1568 |
| 380 | Ga0451843_0405619 | 3300041509 | Bacteria | 2215 |
| 381 | Ga0451843_0406729 | 3300041509 | Bacteria | 3050 |
| 382 | Ga0451843_0502913 | 3300041509 | Bacteria | 1554 |
| 383 | Ga0451853_0391743 | 3300041512 | Bacteria | 3098 |
| 384 | Ga0451853_0518947 | 3300041512 | Bacteria | 1099 |
| 385 | Ga0439432_015906 | 3300042006 | Bacteria | 2534 |
| 386 | Ga0439449_0000018 | 3300042007 | Bacteria | 46636 |
| 387 | Ga0439449_0003124 | 3300042007 | Bacteria | 6445 |
| 388 | Ga0439449_0004679 | 3300042007 | Bacteria | 5287 |
| 389 | Ga0439449_0011438 | 3300042007 | Bacteria | 3339 |
| 390 | Ga0451577_0058752 | 3300042876 | Bacteria | 3429 |
| 391 | Ga0495603_0134539 | 3300046455 | Bacteria | 1439 |
| 392 | Ga0495638_0031329 | 3300046460 | Bacteria | 3419 |
| 393 | Ga0495580_0030395 | 3300046472 | Bacteria | 3912 |
| 394 | Ga0495582_0013614 | 3300046473 | Bacteria | 4478 |
| 395 | Ga0495639_0038071 | 3300046475 | Bacteria | 2158 |
| 396 | Ga0495606_0013802 | 3300046507 | Bacteria | 6351 |
| 397 | Ga0495610_0007418 | 3300046512 | Bacteria | 7303 |
| 398 | Ga0495628_0427513 | 3300046516 | Bacteria | 964 |
| 399 | Ga0495630_0065527 | 3300046517 | Bacteria | 2730 |
| 400 | Ga0495643_0003677 | 3300046522 | Bacteria | 11123 |
| 401 | Ga0495663_0001399 | 3300046525 | Bacteria | 7615 |
| 402 | Ga0495663_0003825 | 3300046525 | Bacteria | 4294 |
| 403 | Ga0495663_0013691 | 3300046525 | Bacteria | 2268 |
| 404 | Ga0495663_0026508 | 3300046525 | Bacteria | 1697 |
| 405 | Ga0495665_0056512 | 3300046531 | Bacteria | 2072 |
| 406 | Ga0495586_0077862 | 3300046535 | Bacteria | 1819 |
| 407 | Ga0495621_0029869 | 3300046539 | Bacteria | 1860 |
| 408 | Ga0495633_0027302 | 3300046558 | Bacteria | 2791 |
| 409 | Ga0495656_0027624 | 3300046615 | Bacteria | 2268 |
| 410 | Ga0495656_0029083 | 3300046615 | Bacteria | 2221 |
| 411 | Ga0495668_0008487 | 3300046616 | Bacteria | 6402 |
| 412 | Ga0495668_0022639 | 3300046616 | Bacteria | 3591 |
| 413 | Ga0495625_0137231 | 3300046660 | Bacteria | 1652 |
| 414 | Ga0495635_0225497 | 3300046663 | Bacteria | 1267 |
| 415 | Ga0495647_0013704 | 3300046681 | Bacteria | 2814 |
| 416 | Ga0495658_0004968 | 3300046683 | Bacteria | 6524 |
| 417 | Ga0495671_0070657 | 3300046692 | Bacteria | 1715 |
| 418 | Ga0495600_0147419 | 3300046809 | Bacteria | 1525 |
| 419 | Ga0495636_0000567 | 3300047318 | Bacteria | 13609 |
| 420 | Ga0495636_0018370 | 3300047318 | Bacteria | 2805 |
| 421 | Ga0495636_0108742 | 3300047318 | Bacteria | 1218 |
| 422 | Ga0495672_0000073 | 3300047320 | Bacteria | 179398 |
| 423 | Ga0495672_0083386 | 3300047320 | Bacteria | 1776 |
| 424 | Ga0495684_0318318 | 3300047471 | Bacteria | 1113 |
| 425 | Ga0496100_0190319 | 3300048903 | Bacteria | 1489 |
| 426 | Ga0496100_0364400 | 3300048903 | Bacteria | 1094 |
| 427 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 428 | Ga0496105_0000014 | 3300048908 | Bacteria | 220911 |
| 429 | Ga0496106_0328530 | 3300048909 | Bacteria | 1228 |
| 430 | Ga0496109_0031793 | 3300048912 | Bacteria | 4739 |
| 431 | Ga0496110_0525235 | 3300048913 | Bacteria | 1076 |
| 432 | Ga0496112_0054916 | 3300048915 | Bacteria | 3914 |
| 433 | Ga0496113_0012572 | 3300048916 | Bacteria | 5694 |
| 434 | Ga0496113_0024103 | 3300048916 | Bacteria | 4321 |
| 435 | Ga0496116_0008602 | 3300048919 | Bacteria | 8833 |
| 436 | Ga0496116_0121941 | 3300048919 | Bacteria | 1506 |
| 437 | Ga0496117_0002324 | 3300048920 | Bacteria | 24332 |
| 438 | Ga0496117_0003747 | 3300048920 | Bacteria | 17400 |
| 439 | Ga0496117_0030699 | 3300048920 | Bacteria | 4118 |
| 440 | Ga0496117_0083404 | 3300048920 | Bacteria | 2090 |
| 441 | Ga0496118_0000344 | 3300048921 | Bacteria | 78989 |
| 442 | Ga0496118_0003355 | 3300048921 | Bacteria | 20262 |
| 443 | Ga0496118_0024226 | 3300048921 | Bacteria | 5247 |
| 444 | Ga0496118_0061448 | 3300048921 | Bacteria | 2782 |
| 445 | Ga0496119_0002556 | 3300048922 | Bacteria | 19810 |
| 446 | Ga0496120_0002304 | 3300048923 | Bacteria | 19766 |
| 447 | Ga0496121_0014643 | 3300048924 | Bacteria | 8294 |
| 448 | Ga0496122_0005815 | 3300048925 | Bacteria | 14499 |
| 449 | Ga0496122_0034822 | 3300048925 | Bacteria | 4111 |
| 450 | Ga0496122_0036737 | 3300048925 | Bacteria | 3955 |
| 451 | Ga0496122_0063232 | 3300048925 | Bacteria | 2702 |
| 452 | Ga0496122_0124389 | 3300048925 | Bacteria | 1654 |
| 453 | Ga0496122_0166372 | 3300048925 | Bacteria | 1336 |
| 454 | Ga0496123_0004555 | 3300048926 | Bacteria | 14460 |
| 455 | Ga0496123_0029269 | 3300048926 | Bacteria | 4059 |
| 456 | Ga0496123_0074519 | 3300048926 | Bacteria | 2100 |
| 457 | Ga0496123_0079332 | 3300048926 | Bacteria | 2006 |
| 458 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 459 | Ga0496124_0003468 | 3300048927 | Bacteria | 19254 |
| 460 | Ga0496124_0004080 | 3300048927 | Bacteria | 17281 |
| 461 | Ga0496124_0012072 | 3300048927 | Bacteria | 8574 |
| 462 | Ga0496124_0040855 | 3300048927 | Bacteria | 4007 |
| 463 | Ga0496124_0052040 | 3300048927 | Bacteria | 3481 |
| 464 | Ga0496124_0090072 | 3300048927 | Bacteria | 2503 |
| 465 | Ga0496125_0006523 | 3300048928 | Bacteria | 12582 |
| 466 | Ga0496125_0014622 | 3300048928 | Bacteria | 7632 |
| 467 | Ga0496125_0044590 | 3300048928 | Bacteria | 3747 |
| 468 | Ga0496125_0056647 | 3300048928 | Bacteria | 3181 |
| 469 | Ga0496126_0007989 | 3300048929 | Bacteria | 11486 |
| 470 | Ga0496126_0026779 | 3300048929 | Bacteria | 5521 |
| 471 | Ga0496126_0144782 | 3300048929 | Bacteria | 2042 |
| 472 | Ga0501290_000770 | 3300049513 | Bacteria | 4751 |
| 473 | Ga0501031_0010110 | 3300049568 | Bacteria | 6148 |
| 474 | Ga0501031_0028463 | 3300049568 | Bacteria | 3642 |
| 475 | Ga0501031_0142997 | 3300049568 | Bacteria | 1563 |
| 476 | Ga0501033_0001489 | 3300049570 | Bacteria | 20740 |
| 477 | Ga0501033_0002438 | 3300049570 | Bacteria | 15799 |
| 478 | Ga0501033_0007341 | 3300049570 | Bacteria | 8586 |
| 479 | Ga0501033_0011027 | 3300049570 | Bacteria | 6921 |
| 480 | Ga0501034_0000122 | 3300049571 | Bacteria | 144085 |
| 481 | Ga0501034_0001021 | 3300049571 | Bacteria | 40111 |
| 482 | Ga0501034_0037891 | 3300049571 | Bacteria | 4883 |
| 483 | Ga0501034_0054343 | 3300049571 | Bacteria | 4032 |
| 484 | Ga0501034_0510628 | 3300049571 | Bacteria | 1115 |
| 485 | Ga0501036_0023761 | 3300049572 | Bacteria | 5164 |
| 486 | Ga0501036_0118547 | 3300049572 | Bacteria | 2235 |
| 487 | Ga0501037_0002420 | 3300049573 | Bacteria | 13491 |
| 488 | Ga0501038_0004044 | 3300049574 | Bacteria | 13629 |
| 489 | Ga0501038_0021112 | 3300049574 | Bacteria | 5849 |
| 490 | Ga0501038_0120182 | 3300049574 | Bacteria | 2168 |
| 491 | Ga0501038_0215908 | 3300049574 | Bacteria | 1532 |
| 492 | Ga0501039_0003853 | 3300049575 | Bacteria | 11261 |
| 493 | Ga0501039_0325279 | 3300049575 | Bacteria | 1208 |
| 494 | Ga0501040_0001206 | 3300049576 | Bacteria | 16460 |
| 495 | Ga0501041_0001968 | 3300049577 | Bacteria | 11551 |
| 496 | Ga0501042_0000931 | 3300049578 | Bacteria | 16497 |
| 497 | Ga0501043_0002449 | 3300049579 | Bacteria | 15701 |
| 498 | Ga0501043_0021394 | 3300049579 | Bacteria | 5070 |
| 499 | Ga0501043_0037824 | 3300049579 | Bacteria | 3796 |
| 500 | Ga0501043_0099869 | 3300049579 | Bacteria | 2281 |
| 501 | Ga0501046_0011112 | 3300049580 | Bacteria | 7710 |
| 502 | Ga0501046_0133120 | 3300049580 | Bacteria | 1884 |
| 503 | Ga0501047_0059411 | 3300049581 | Bacteria | 3691 |
| 504 | Ga0501047_0094597 | 3300049581 | Bacteria | 2867 |
| 505 | Ga0501048_0011120 | 3300049582 | Bacteria | 6710 |
| 506 | Ga0501068_0000860 | 3300049584 | Bacteria | 15814 |
| 507 | Ga0501069_0090472 | 3300049585 | Bacteria | 1730 |
| 508 | Ga0501070_0003058 | 3300049586 | Bacteria | 14565 |
| 509 | Ga0501070_0068580 | 3300049586 | Bacteria | 2936 |
| 510 | Ga0501070_0077087 | 3300049586 | Bacteria | 2759 |
| 511 | Ga0501071_0006996 | 3300049587 | Bacteria | 7366 |
| 512 | Ga0501072_0001665 | 3300049588 | Bacteria | 16559 |
| 513 | Ga0501073_0004387 | 3300049589 | Bacteria | 10598 |
| 514 | Ga0501074_0001678 | 3300049590 | Bacteria | 15070 |
| 515 | Ga0501074_0072784 | 3300049590 | Bacteria | 2468 |
| 516 | Ga0501074_0104354 | 3300049590 | Bacteria | 2029 |
| 517 | Ga0501075_0000858 | 3300049591 | Bacteria | 19148 |
| 518 | Ga0501076_0002159 | 3300049592 | Bacteria | 13483 |
| 519 | Ga0501076_0031032 | 3300049592 | Bacteria | 4165 |
| 520 | Ga0501077_0004578 | 3300049593 | Bacteria | 8401 |
| 521 | Ga0501249_008222 | 3300049679 | Bacteria | 2163 |
| 522 | Ga0501259_001711 | 3300049688 | Bacteria | 3647 |
| 523 | Ga0501225_0013529 | 3300049705 | Bacteria | 2283 |
| 524 | Ga0501079_0002189 | 3300049741 | Bacteria | 14087 |
| 525 | Ga0501080_0009101 | 3300049742 | Bacteria | 9039 |
| 526 | Ga0501081_0000359 | 3300049743 | Bacteria | 24723 |
| 527 | Ga0501081_0352406 | 3300049743 | Unclassified | 1085 |
| 528 | Ga0501035_0003215 | 3300049822 | Bacteria | 15660 |
| 529 | Ga0501035_0003472 | 3300049822 | Bacteria | 15084 |
| 530 | Ga0501035_0006572 | 3300049822 | Bacteria | 10894 |
| 531 | Ga0501035_0035887 | 3300049822 | Bacteria | 4497 |
| 532 | Ga0501035_0054814 | 3300049822 | Bacteria | 3561 |
| 533 | Ga0501035_0057075 | 3300049822 | Bacteria | 3481 |
| 534 | Ga0501044_0027026 | 3300049823 | Bacteria | 6071 |
| 535 | Ga0501044_0165761 | 3300049823 | Bacteria | 2184 |
| 536 | Ga0501044_0506485 | 3300049823 | Bacteria | 1108 |
| 537 | Ga0501044_0519466 | 3300049823 | Bacteria | 1090 |
| 538 | Ga0501045_0031495 | 3300049824 | Bacteria | 3841 |
| 539 | nmdc:mga00v17_202_c2 | 3300050491 | Bacteria | 31082 |
| 540 | nmdc:mga06r32_252131_c1 | 3300050510 | Bacteria | 1752 |
| 541 | Ga0500610_0000087 | 3300053079 | Bacteria | 27865 |
| 542 | Ga0500634_0000048 | 3300053161 | Bacteria | 55497 |
| 543 | Ga0501084_0007709 | 3300054114 | Bacteria | 8869 |
| 544 | Ga0501082_0000368 | 3300060353 | Bacteria | 39768 |
| 545 | Ga0530510_0000025 | 3300061734 | Bacteria | 67946 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027543 | Ga0209999_1007733 | Ga0209999_10077333 | 236 |
| 2 | 3300027552 | Ga0209982_1006567 | Ga0209982_10065671 | 236 |
| 3 | 3300027665 | Ga0209983_1004486 | Ga0209983_10044861 | 236 |
| 4 | 3300027682 | Ga0209971_1001850 | Ga0209971_10018501 | 236 |
| 5 | 3300027876 | Ga0209974_10002513 | Ga0209974_100025132 | 236 |
| 6 | 3300035111 | Ga0373923_0173399 | Ga0373923_0173399_232_969 | 240 |
| 7 | 3300025921 | Ga0207652_10001445 | Ga0207652_1000144521 | 245 |
| 8 | 3300048925 | Ga0496122_0124389 | Ga0496122_0124389_871_1611 | 246 |
| 9 | 3300032004 | Ga0307414_10320160 | Ga0307414_103201601 | 251 |
| 10 | 3300005347 | Ga0070668_100003985 | Ga0070668_1000039855 | 259 |
| 11 | 3300025972 | Ga0207668_10153578 | Ga0207668_101535782 | 259 |
| 12 | 3300035083 | Ga0373926_0171250 | Ga0373926_0171250_22_816 | 259 |
| 13 | 3300046516 | Ga0495628_0427513 | Ga0495628_0427513_22_816 | 259 |
| 14 | 3300041452 | Ga0451793_0382579 | Ga0451793_0382579_208_1005 | 265 |
| 15 | 3300049568 | Ga0501031_0028463 | Ga0501031_0028463_1744_2586 | 269 |
| 16 | 3300049572 | Ga0501036_0118547 | Ga0501036_0118547_570_1412 | 269 |
| 17 | 3300049581 | Ga0501047_0094597 | Ga0501047_0094597_1002_1844 | 269 |
| 18 | 3300049586 | Ga0501070_0068580 | Ga0501070_0068580_320_1162 | 269 |
| 19 | 3300049822 | Ga0501035_0057075 | Ga0501035_0057075_2582_3424 | 269 |
| 20 | 3300050510 | nmdc:mga06r32_252131_c1 | nmdc:mga06r32_252131_c1_862_1734 | 271 |
| 21 | 3300049589 | Ga0501073_0004387 | Ga0501073_0004387_6378_7220 | 272 |
| 22 | 3300006948 | Ga0099826_10113365 | Ga0099826_101133652 | 274 |
| 23 | 3300048920 | Ga0496117_0002324 | Ga0496117_0002324_2732_3574 | 274 |
| 24 | 3300048921 | Ga0496118_0000344 | Ga0496118_0000344_20671_21513 | 274 |
| 25 | 3300049571 | Ga0501034_0000122 | Ga0501034_0000122_128727_129572 | 274 |
| 26 | 3300049571 | Ga0501034_0001021 | Ga0501034_0001021_9709_10560 | 274 |
| 27 | iso_pu_bacteria | 2537561836 | 2538832404 | 274 |
| 28 | iso_pu_bacteria | 2643221562 | 2643830425 | 274 |
| 29 | iso_pu_bacteria | 2895395659 | 2895398819 | 274 |
| 30 | iso_pu_bacteria | 2939611941 | 2939612383 | 274 |
| 31 | 3300049513 | Ga0501290_000770 | Ga0501290_000770_1438_2334 | 275 |
| 32 | iso_pu_bacteria | 8002869464 | 8002872550 | 275 |
| 33 | 3300041494 | Ga0451837_0224093 | Ga0451837_0224093_972_1820 | 276 |
| 34 | 3300041509 | Ga0451843_0502913 | Ga0451843_0502913_119_967 | 276 |
| 35 | iso_pu_bacteria | 2524614729 | 2525556930 | 276 |
| 36 | iso_pu_bacteria | 2547132130 | 2547500033 | 276 |
| 37 | iso_pu_bacteria | 2547132130 | 2547500757 | 276 |
| 38 | iso_pu_bacteria | 2571042365 | 2572253551 | 276 |
| 39 | iso_pu_bacteria | 2576861471 | 2578457574 | 276 |
| 40 | iso_pu_bacteria | 2627854209 | 2630648526 | 276 |
| 41 | iso_pu_bacteria | 2643221579 | 2643908740 | 276 |
| 42 | iso_pu_bacteria | 2643221581 | 2643916168 | 276 |
| 43 | iso_pu_bacteria | 2643221695 | 2644528887 | 276 |
| 44 | iso_pu_bacteria | 2747842428 | 2747948084 | 276 |
| 45 | iso_pu_bacteria | 2765235840 | 2765579908 | 276 |
| 46 | iso_pu_bacteria | 2816332141 | 2816519049 | 276 |
| 47 | iso_pu_bacteria | 2842391507 | 2842394866 | 276 |
| 48 | iso_pu_bacteria | 2842757796 | 2842760605 | 276 |
| 49 | iso_pu_bacteria | 2842780639 | 2842781123 | 276 |
| 50 | iso_pu_bacteria | 2852649853 | 2852649995 | 276 |
| 51 | iso_pu_bacteria | 2857442823 | 2857444772 | 276 |
| 52 | iso_pu_bacteria | 2874220319 | 2874222592 | 276 |
| 53 | iso_pu_bacteria | 2919089067 | 2919090533 | 276 |
| 54 | iso_pu_bacteria | 2919134579 | 2919137538 | 276 |
| 55 | iso_pu_bacteria | 2923516293 | 2923517950 | 276 |
| 56 | iso_pu_bacteria | 2928496128 | 2928498368 | 276 |
| 57 | iso_pu_bacteria | 2931380184 | 2931383951 | 276 |
| 58 | iso_pu_bacteria | 2937610967 | 2937614488 | 276 |
| 59 | iso_pu_bacteria | 2939589442 | 2939591134 | 276 |
| 60 | iso_pu_bacteria | 2939622612 | 2939624629 | 276 |
| 61 | iso_pu_bacteria | 2939626828 | 2939628297 | 276 |
| 62 | iso_pu_bacteria | 2941475908 | 2941476660 | 276 |
| 63 | iso_pu_bacteria | 2961047084 | 2961049357 | 276 |
| 64 | iso_pu_bacteria | 2961064222 | 2961065955 | 276 |
| 65 | iso_pu_bacteria | 2974307012 | 2974308200 | 276 |
| 66 | iso_pu_bacteria | 2977247770 | 2977248952 | 276 |
| 67 | iso_pu_bacteria | 2984514374 | 2984516591 | 276 |
| 68 | iso_pu_bacteria | 2987605356 | 2987607389 | 276 |
| 69 | 3300005435 | Ga0070714_100010639 | Ga0070714_1000106394 | 277 |
| 70 | 3300005437 | Ga0070710_10081272 | Ga0070710_100812722 | 277 |
| 71 | 3300013104 | Ga0157370_10083839 | Ga0157370_100838392 | 277 |
| 72 | 3300014497 | Ga0182008_10031525 | Ga0182008_100315253 | 277 |
| 73 | 3300015261 | Ga0182006_1019604 | Ga0182006_10196044 | 277 |
| 74 | 3300015262 | Ga0182007_10011339 | Ga0182007_100113394 | 277 |
| 75 | 3300025898 | Ga0207692_10089366 | Ga0207692_100893662 | 277 |
| 76 | 3300025929 | Ga0207664_10000884 | Ga0207664_1000088418 | 277 |
| 77 | iso_pu_bacteria | 2643221559 | 2643815283 | 277 |
| 78 | iso_pu_bacteria | 2643221573 | 2643879322 | 277 |
| 79 | iso_pu_bacteria | 2643221586 | 2643939960 | 277 |
| 80 | iso_pu_bacteria | 2643221593 | 2643976181 | 277 |
| 81 | iso_pu_bacteria | 2643221612 | 2644077016 | 277 |
| 82 | iso_pu_bacteria | 2643221720 | 2644660621 | 277 |
| 83 | iso_pu_bacteria | 2643221727 | 2644695330 | 277 |
| 84 | iso_pu_bacteria | 2643221728 | 2644697982 | 277 |
| 85 | iso_pu_bacteria | 2747842501 | 2748018304 | 277 |
| 86 | iso_pu_bacteria | 2818991457 | 2819660093 | 277 |
| 87 | iso_pu_bacteria | 2852684882 | 2852685091 | 277 |
| 88 | iso_pu_bacteria | 2894414249 | 2894415907 | 277 |
| 89 | iso_pu_bacteria | 2895498888 | 2895502602 | 277 |
| 90 | iso_pu_bacteria | 2895511927 | 2895514068 | 277 |
| 91 | iso_pu_bacteria | 2895522137 | 2895524453 | 277 |
| 92 | iso_pu_bacteria | 2895525241 | 2895526550 | 277 |
| 93 | iso_pu_bacteria | 2919130084 | 2919130631 | 277 |
| 94 | iso_pu_bacteria | 2919513703 | 2919516134 | 277 |
| 95 | iso_pu_bacteria | 2919675420 | 2919677967 | 277 |
| 96 | iso_pu_bacteria | 2929195423 | 2929198366 | 277 |
| 97 | iso_pu_bacteria | 2941489479 | 2941491151 | 277 |
| 98 | iso_pu_bacteria | 2995948881 | 2995952082 | 277 |
| 99 | iso_pu_bacteria | 8003014200 | 8003014590 | 277 |
| 100 | 3300002737 | JGI25162J39368_1001808 | JGI25162J39368_10018082 | 278 |
| 101 | 3300002737 | JGI25162J39368_1001810 | JGI25162J39368_10018109 | 278 |
| 102 | 3300002741 | JGI25157J39369_1000764 | JGI25157J39369_100076415 | 278 |
| 103 | 3300002772 | JGI25164J39214_1000891 | JGI25164J39214_10008912 | 278 |
| 104 | 3300002772 | JGI25164J39214_1001247 | JGI25164J39214_10012475 | 278 |
| 105 | 3300003214 | JGI25165J46597_1001382 | JGI25165J46597_10013829 | 278 |
| 106 | 3300003214 | JGI25165J46597_1001877 | JGI25165J46597_10018777 | 278 |
| 107 | 3300005435 | Ga0070714_100000309 | Ga0070714_10000030917 | 278 |
| 108 | 3300005436 | Ga0070713_100007035 | Ga0070713_1000070355 | 278 |
| 109 | 3300005458 | Ga0070681_10562173 | Ga0070681_105621731 | 278 |
| 110 | 3300005530 | Ga0070679_100016047 | Ga0070679_1000160475 | 278 |
| 111 | 3300005546 | Ga0070696_100002455 | Ga0070696_1000024559 | 278 |
| 112 | 3300009174 | Ga0105241_10381857 | Ga0105241_103818571 | 278 |
| 113 | 3300013308 | Ga0157375_10000256 | Ga0157375_1000025618 | 278 |
| 114 | 3300014969 | Ga0157376_10001188 | Ga0157376_100011888 | 278 |
| 115 | 3300015262 | Ga0182007_10047471 | Ga0182007_100474712 | 278 |
| 116 | 3300025231 | Ga0207427_100115 | Ga0207427_100115101 | 278 |
| 117 | 3300025231 | Ga0207427_100130 | Ga0207427_10013094 | 278 |
| 118 | 3300025233 | Ga0209437_100020 | Ga0209437_100020237 | 278 |
| 119 | 3300025233 | Ga0209437_100079 | Ga0209437_100079173 | 278 |
| 120 | 3300025250 | Ga0209026_1000051 | Ga0209026_1000051100 | 278 |
| 121 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020388 | 278 |
| 122 | 3300025261 | Ga0209233_1000121 | Ga0209233_1000121130 | 278 |
| 123 | 3300025297 | Ga0209758_1024714 | Ga0209758_10247143 | 278 |
| 124 | 3300025904 | Ga0207647_10065285 | Ga0207647_100652852 | 278 |
| 125 | 3300025921 | Ga0207652_10040233 | Ga0207652_100402335 | 278 |
| 126 | 3300025928 | Ga0207700_10001685 | Ga0207700_100016859 | 278 |
| 127 | 3300025929 | Ga0207664_10000300 | Ga0207664_1000030027 | 278 |
| 128 | 3300025929 | Ga0207664_10469911 | Ga0207664_104699111 | 278 |
| 129 | 3300025933 | Ga0207706_10275037 | Ga0207706_102750372 | 278 |
| 130 | 3300025934 | Ga0207686_10090069 | Ga0207686_100900692 | 278 |
| 131 | 3300026078 | Ga0207702_10113288 | Ga0207702_101132883 | 278 |
| 132 | 3300035089 | Ga0373944_0032391 | Ga0373944_0032391_193_1044 | 278 |
| 133 | 3300035119 | Ga0373956_0085433 | Ga0373956_0085433_504_1355 | 278 |
| 134 | 3300035170 | Ga0373943_0220229 | Ga0373943_0220229_55_906 | 278 |
| 135 | 3300038443 | Ga0395901_0001216 | Ga0395901_0001216_23934_24773 | 278 |
| 136 | 3300046455 | Ga0495603_0134539 | Ga0495603_0134539_165_1016 | 278 |
| 137 | 3300046472 | Ga0495580_0030395 | Ga0495580_0030395_2307_3158 | 278 |
| 138 | 3300046473 | Ga0495582_0013614 | Ga0495582_0013614_2982_3833 | 278 |
| 139 | 3300046475 | Ga0495639_0038071 | Ga0495639_0038071_318_1169 | 278 |
| 140 | 3300046517 | Ga0495630_0065527 | Ga0495630_0065527_1756_2607 | 278 |
| 141 | 3300046531 | Ga0495665_0056512 | Ga0495665_0056512_1021_1872 | 278 |
| 142 | 3300046535 | Ga0495586_0077862 | Ga0495586_0077862_301_1152 | 278 |
| 143 | 3300046663 | Ga0495635_0225497 | Ga0495635_0225497_194_1045 | 278 |
| 144 | 3300046681 | Ga0495647_0013704 | Ga0495647_0013704_1890_2741 | 278 |
| 145 | 3300046683 | Ga0495658_0004968 | Ga0495658_0004968_3931_4782 | 278 |
| 146 | 3300046809 | Ga0495600_0147419 | Ga0495600_0147419_359_1210 | 278 |
| 147 | 3300047471 | Ga0495684_0318318 | Ga0495684_0318318_64_915 | 278 |
| 148 | 3300048907 | Ga0496104_0000011 | Ga0496104_0000011_64630_65481 | 278 |
| 149 | 3300048908 | Ga0496105_0000014 | Ga0496105_0000014_64657_65508 | 278 |
| 150 | 3300049568 | Ga0501031_0142997 | Ga0501031_0142997_35_880 | 278 |
| 151 | 3300049570 | Ga0501033_0007341 | Ga0501033_0007341_4227_5072 | 278 |
| 152 | 3300049574 | Ga0501038_0215908 | Ga0501038_0215908_20_865 | 278 |
| 153 | 3300049575 | Ga0501039_0325279 | Ga0501039_0325279_179_1024 | 278 |
| 154 | 3300049579 | Ga0501043_0002449 | Ga0501043_0002449_13764_14609 | 278 |
| 155 | 3300049580 | Ga0501046_0133120 | Ga0501046_0133120_866_1711 | 278 |
| 156 | 3300049822 | Ga0501035_0003215 | Ga0501035_0003215_13785_14630 | 278 |
| 157 | 3300001915 | JGI24741J21665_1001939 | JGI24741J21665_10019391 | 279 |
| 158 | 3300001979 | JGI24740J21852_10002530 | JGI24740J21852_1000253010 | 279 |
| 159 | 3300005329 | Ga0070683_100002993 | Ga0070683_10000299314 | 279 |
| 160 | 3300005336 | Ga0070680_100035853 | Ga0070680_1000358532 | 279 |
| 161 | 3300005345 | Ga0070692_10001511 | Ga0070692_1000151110 | 279 |
| 162 | 3300005455 | Ga0070663_100007817 | Ga0070663_1000078172 | 279 |
| 163 | 3300005458 | Ga0070681_10007131 | Ga0070681_100071312 | 279 |
| 164 | 3300005530 | Ga0070679_100000372 | Ga0070679_10000037213 | 279 |
| 165 | 3300005530 | Ga0070679_100005054 | Ga0070679_10000505413 | 279 |
| 166 | 3300005535 | Ga0070684_100007023 | Ga0070684_10000702312 | 279 |
| 167 | 3300005546 | Ga0070696_100016626 | Ga0070696_1000166267 | 279 |
| 168 | 3300005563 | Ga0068855_100011338 | Ga0068855_1000113383 | 279 |
| 169 | 3300005563 | Ga0068855_100027527 | Ga0068855_1000275271 | 279 |
| 170 | 3300005563 | Ga0068855_100559354 | Ga0068855_1005593541 | 279 |
| 171 | 3300005578 | Ga0068854_100071896 | Ga0068854_1000718962 | 279 |
| 172 | 3300009093 | Ga0105240_10028762 | Ga0105240_1002876210 | 279 |
| 173 | 3300009093 | Ga0105240_10092734 | Ga0105240_100927344 | 279 |
| 174 | 3300009551 | Ga0105238_10047996 | Ga0105238_100479963 | 279 |
| 175 | 3300013100 | Ga0157373_10059372 | Ga0157373_100593723 | 279 |
| 176 | 3300013102 | Ga0157371_10012336 | Ga0157371_100123362 | 279 |
| 177 | 3300013104 | Ga0157370_10008833 | Ga0157370_100088335 | 279 |
| 178 | 3300013104 | Ga0157370_10117649 | Ga0157370_101176494 | 279 |
| 179 | 3300013105 | Ga0157369_10017641 | Ga0157369_100176412 | 279 |
| 180 | 3300013105 | Ga0157369_10399732 | Ga0157369_103997322 | 279 |
| 181 | 3300013306 | Ga0163162_10000007 | Ga0163162_1000000720 | 279 |
| 182 | 3300013307 | Ga0157372_10003801 | Ga0157372_100038012 | 279 |
| 183 | 3300013307 | Ga0157372_10015387 | Ga0157372_1001538711 | 279 |
| 184 | 3300020081 | Ga0206354_10831098 | Ga0206354_1083109810 | 279 |
| 185 | 3300020610 | Ga0154015_1062321 | Ga0154015_10623213 | 279 |
| 186 | 3300025909 | Ga0207705_10000968 | Ga0207705_1000096811 | 279 |
| 187 | 3300025912 | Ga0207707_10000216 | Ga0207707_1000021650 | 279 |
| 188 | 3300025912 | Ga0207707_10002882 | Ga0207707_1000288215 | 279 |
| 189 | 3300025917 | Ga0207660_10009145 | Ga0207660_100091456 | 279 |
| 190 | 3300025917 | Ga0207660_10014673 | Ga0207660_100146734 | 279 |
| 191 | 3300025921 | Ga0207652_10001658 | Ga0207652_1000165810 | 279 |
| 192 | 3300025921 | Ga0207652_10004611 | Ga0207652_100046115 | 279 |
| 193 | 3300025924 | Ga0207694_10093609 | Ga0207694_100936092 | 279 |
| 194 | 3300025949 | Ga0207667_10001277 | Ga0207667_1000127714 | 279 |
| 195 | 3300025949 | Ga0207667_10051224 | Ga0207667_100512244 | 279 |
| 196 | 3300025949 | Ga0207667_10251289 | Ga0207667_102512892 | 279 |
| 197 | 3300025981 | Ga0207640_10009981 | Ga0207640_100099815 | 279 |
| 198 | 3300026078 | Ga0207702_10000474 | Ga0207702_1000047425 | 279 |
| 199 | 3300026142 | Ga0207698_10000276 | Ga0207698_1000027625 | 279 |
| 200 | 3300032002 | Ga0307416_100043968 | Ga0307416_1000439683 | 279 |
| 201 | 3300037418 | Ga0395900_0000175 | Ga0395900_0000175_2365_3204 | 279 |
| 202 | 3300048903 | Ga0496100_0364400 | Ga0496100_0364400_183_1055 | 279 |
| 203 | 3300049571 | Ga0501034_0510628 | Ga0501034_0510628_64_954 | 279 |
| 204 | 3300049574 | Ga0501038_0120182 | Ga0501038_0120182_442_1332 | 279 |
| 205 | 3300049581 | Ga0501047_0059411 | Ga0501047_0059411_88_978 | 279 |
| 206 | 3300049585 | Ga0501069_0090472 | Ga0501069_0090472_694_1584 | 279 |
| 207 | 3300049586 | Ga0501070_0003058 | Ga0501070_0003058_6383_7273 | 279 |
| 208 | 3300049586 | Ga0501070_0077087 | Ga0501070_0077087_1408_2325 | 279 |
| 209 | 3300049590 | Ga0501074_0001678 | Ga0501074_0001678_8596_9486 | 279 |
| 210 | 3300049590 | Ga0501074_0072784 | Ga0501074_0072784_1015_1905 | 279 |
| 211 | 3300049590 | Ga0501074_0104354 | Ga0501074_0104354_817_1734 | 279 |
| 212 | 3300049743 | Ga0501081_0352406 | Ga0501081_0352406_109_969 | 279 |
| 213 | 3300049822 | Ga0501035_0006572 | Ga0501035_0006572_6982_7872 | 279 |
| 214 | 3300049823 | Ga0501044_0506485 | Ga0501044_0506485_71_910 | 279 |
| 215 | 3300049823 | Ga0501044_0519466 | Ga0501044_0519466_168_1058 | 279 |
| 216 | 3300003771 | Ga0055526_1000486 | Ga0055526_100048622 | 280 |
| 217 | 3300003775 | Ga0055524_1036326 | Ga0055524_10363262 | 280 |
| 218 | 3300003781 | Ga0055536_1003210 | Ga0055536_10032102 | 280 |
| 219 | 3300003781 | Ga0055536_1010253 | Ga0055536_10102533 | 280 |
| 220 | 3300003781 | Ga0055536_1010288 | Ga0055536_10102883 | 280 |
| 221 | 3300003784 | Ga0055534_1000034 | Ga0055534_100003416 | 280 |
| 222 | 3300003790 | Ga0055528_1000671 | Ga0055528_100067116 | 280 |
| 223 | 3300003791 | Ga0055530_10003879 | Ga0055530_100038797 | 280 |
| 224 | 3300003791 | Ga0055530_10003891 | Ga0055530_100038912 | 280 |
| 225 | 3300003794 | Ga0055531_10001755 | Ga0055531_100017558 | 280 |
| 226 | 3300003794 | Ga0055531_10013574 | Ga0055531_100135743 | 280 |
| 227 | 3300003794 | Ga0055531_10014194 | Ga0055531_100141943 | 280 |
| 228 | 3300003794 | Ga0055531_10015882 | Ga0055531_100158823 | 280 |
| 229 | 3300003856 | Ga0058692_1000011 | Ga0058692_100001121 | 280 |
| 230 | 3300005293 | Ga0065715_10119645 | Ga0065715_101196452 | 280 |
| 231 | 3300005333 | Ga0070677_10144016 | Ga0070677_101440161 | 280 |
| 232 | 3300005336 | Ga0070680_100462075 | Ga0070680_1004620752 | 280 |
| 233 | 3300005337 | Ga0070682_100002010 | Ga0070682_1000020104 | 280 |
| 234 | 3300005339 | Ga0070660_100062724 | Ga0070660_1000627242 | 280 |
| 235 | 3300005444 | Ga0070694_100016102 | Ga0070694_1000161024 | 280 |
| 236 | 3300005458 | Ga0070681_10000029 | Ga0070681_1000002937 | 280 |
| 237 | 3300005458 | Ga0070681_10011742 | Ga0070681_100117426 | 280 |
| 238 | 3300005458 | Ga0070681_10136745 | Ga0070681_101367453 | 280 |
| 239 | 3300005458 | Ga0070681_10422246 | Ga0070681_104222462 | 280 |
| 240 | 3300005458 | Ga0070681_10652263 | Ga0070681_106522631 | 280 |
| 241 | 3300005539 | Ga0068853_100000560 | Ga0068853_1000005606 | 280 |
| 242 | 3300005539 | Ga0068853_100003691 | Ga0068853_10000369110 | 280 |
| 243 | 3300005539 | Ga0068853_100164047 | Ga0068853_1001640471 | 280 |
| 244 | 3300005546 | Ga0070696_100012046 | Ga0070696_1000120464 | 280 |
| 245 | 3300005547 | Ga0070693_100012474 | Ga0070693_1000124743 | 280 |
| 246 | 3300005547 | Ga0070693_100016710 | Ga0070693_1000167103 | 280 |
| 247 | 3300005614 | Ga0068856_100000234 | Ga0068856_10000023432 | 280 |
| 248 | 3300005616 | Ga0068852_100005378 | Ga0068852_1000053782 | 280 |
| 249 | 3300005617 | Ga0068859_100047374 | Ga0068859_1000473744 | 280 |
| 250 | 3300005618 | Ga0068864_100217571 | Ga0068864_1002175712 | 280 |
| 251 | 3300005841 | Ga0068863_100361920 | Ga0068863_1003619202 | 280 |
| 252 | 3300006038 | Ga0075365_10060969 | Ga0075365_100609692 | 280 |
| 253 | 3300006051 | Ga0075364_10000020 | Ga0075364_100000208 | 280 |
| 254 | 3300006186 | Ga0075369_10055806 | Ga0075369_100558062 | 280 |
| 255 | 3300006931 | Ga0097620_100047374 | Ga0097620_1000473743 | 280 |
| 256 | 3300009011 | Ga0105251_10006353 | Ga0105251_100063533 | 280 |
| 257 | 3300009036 | Ga0105244_10038939 | Ga0105244_100389392 | 280 |
| 258 | 3300009098 | Ga0105245_10218788 | Ga0105245_102187882 | 280 |
| 259 | 3300009551 | Ga0105238_10007073 | Ga0105238_100070733 | 280 |
| 260 | 3300009551 | Ga0105238_10029020 | Ga0105238_100290202 | 280 |
| 261 | 3300009551 | Ga0105238_10039845 | Ga0105238_100398454 | 280 |
| 262 | 3300010375 | Ga0105239_10195593 | Ga0105239_101955933 | 280 |
| 263 | 3300013100 | Ga0157373_10008924 | Ga0157373_100089246 | 280 |
| 264 | 3300013100 | Ga0157373_10027422 | Ga0157373_100274222 | 280 |
| 265 | 3300013102 | Ga0157371_10000154 | Ga0157371_1000015423 | 280 |
| 266 | 3300013102 | Ga0157371_10002651 | Ga0157371_1000265119 | 280 |
| 267 | 3300013102 | Ga0157371_10070183 | Ga0157371_100701832 | 280 |
| 268 | 3300013102 | Ga0157371_10338334 | Ga0157371_103383342 | 280 |
| 269 | 3300013104 | Ga0157370_10004589 | Ga0157370_1000458913 | 280 |
| 270 | 3300013104 | Ga0157370_10012597 | Ga0157370_100125976 | 280 |
| 271 | 3300013104 | Ga0157370_10013540 | Ga0157370_100135407 | 280 |
| 272 | 3300013104 | Ga0157370_10052040 | Ga0157370_100520403 | 280 |
| 273 | 3300013105 | Ga0157369_10236378 | Ga0157369_102363781 | 280 |
| 274 | 3300013307 | Ga0157372_10149646 | Ga0157372_101496462 | 280 |
| 275 | 3300013307 | Ga0157372_10235558 | Ga0157372_102355583 | 280 |
| 276 | 3300013307 | Ga0157372_10486300 | Ga0157372_104863002 | 280 |
| 277 | 3300013308 | Ga0157375_10301943 | Ga0157375_103019432 | 280 |
| 278 | 3300014497 | Ga0182008_10000142 | Ga0182008_1000014232 | 280 |
| 279 | 3300014497 | Ga0182008_10008964 | Ga0182008_100089642 | 280 |
| 280 | 3300015261 | Ga0182006_1013905 | Ga0182006_10139053 | 280 |
| 281 | 3300015261 | Ga0182006_1031233 | Ga0182006_10312332 | 280 |
| 282 | 3300015262 | Ga0182007_10000287 | Ga0182007_1000028726 | 280 |
| 283 | 3300017792 | Ga0163161_10001348 | Ga0163161_100013487 | 280 |
| 284 | 3300017792 | Ga0163161_10021106 | Ga0163161_100211064 | 280 |
| 285 | 3300025245 | Ga0207425_1019940 | Ga0207425_10199402 | 280 |
| 286 | 3300025263 | Ga0209565_1000022 | Ga0209565_1000022324 | 280 |
| 287 | 3300025273 | Ga0209673_1000104 | Ga0209673_100010471 | 280 |
| 288 | 3300025291 | Ga0209675_1000048 | Ga0209675_1000048173 | 280 |
| 289 | 3300025292 | Ga0209676_1000024 | Ga0209676_1000024286 | 280 |
| 290 | 3300025292 | Ga0209676_1000091 | Ga0209676_1000091163 | 280 |
| 291 | 3300025292 | Ga0209676_1000117 | Ga0209676_1000117143 | 280 |
| 292 | 3300025294 | Ga0209025_1011986 | Ga0209025_10119862 | 280 |
| 293 | 3300025295 | Ga0209564_1000213 | Ga0209564_100021349 | 280 |
| 294 | 3300025298 | Ga0209050_1001640 | Ga0209050_10016402 | 280 |
| 295 | 3300025298 | Ga0209050_1005300 | Ga0209050_10053007 | 280 |
| 296 | 3300025299 | Ga0209256_1004506 | Ga0209256_10045068 | 280 |
| 297 | 3300025299 | Ga0209256_1020821 | Ga0209256_10208212 | 280 |
| 298 | 3300025303 | Ga0209051_1006048 | Ga0209051_10060484 | 280 |
| 299 | 3300025304 | Ga0209257_1000062 | Ga0209257_100006244 | 280 |
| 300 | 3300025304 | Ga0209257_1000217 | Ga0209257_100021745 | 280 |
| 301 | 3300025304 | Ga0209257_1005770 | Ga0209257_10057707 | 280 |
| 302 | 3300025304 | Ga0209257_1013027 | Ga0209257_10130272 | 280 |
| 303 | 3300025304 | Ga0209257_1014540 | Ga0209257_10145403 | 280 |
| 304 | 3300025735 | Ga0207713_1016794 | Ga0207713_10167943 | 280 |
| 305 | 3300025911 | Ga0207654_10073192 | Ga0207654_100731922 | 280 |
| 306 | 3300025912 | Ga0207707_10000285 | Ga0207707_100002856 | 280 |
| 307 | 3300025912 | Ga0207707_10006803 | Ga0207707_100068032 | 280 |
| 308 | 3300025917 | Ga0207660_10335654 | Ga0207660_103356541 | 280 |
| 309 | 3300025921 | Ga0207652_10028948 | Ga0207652_100289483 | 280 |
| 310 | 3300025924 | Ga0207694_10065310 | Ga0207694_100653103 | 280 |
| 311 | 3300025924 | Ga0207694_10074612 | Ga0207694_100746123 | 280 |
| 312 | 3300025924 | Ga0207694_10124398 | Ga0207694_101243982 | 280 |
| 313 | 3300025927 | Ga0207687_10184891 | Ga0207687_101848912 | 280 |
| 314 | 3300025932 | Ga0207690_10013740 | Ga0207690_100137402 | 280 |
| 315 | 3300025932 | Ga0207690_10086988 | Ga0207690_100869883 | 280 |
| 316 | 3300025935 | Ga0207709_10001041 | Ga0207709_100010417 | 280 |
| 317 | 3300025949 | Ga0207667_10005450 | Ga0207667_1000545013 | 280 |
| 318 | 3300025972 | Ga0207668_10366736 | Ga0207668_103667362 | 280 |
| 319 | 3300026041 | Ga0207639_10312141 | Ga0207639_103121412 | 280 |
| 320 | 3300026067 | Ga0207678_10113753 | Ga0207678_101137531 | 280 |
| 321 | 3300026067 | Ga0207678_10240017 | Ga0207678_102400172 | 280 |
| 322 | 3300026078 | Ga0207702_10000113 | Ga0207702_100001139 | 280 |
| 323 | 3300026088 | Ga0207641_10153524 | Ga0207641_101535243 | 280 |
| 324 | 3300026116 | Ga0207674_10015151 | Ga0207674_100151516 | 280 |
| 325 | 3300026116 | Ga0207674_10025973 | Ga0207674_100259736 | 280 |
| 326 | 3300026142 | Ga0207698_10003769 | Ga0207698_1000376910 | 280 |
| 327 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007416 | 280 |
| 328 | 3300027876 | Ga0209974_10022211 | Ga0209974_100222113 | 280 |
| 329 | 3300028379 | Ga0268266_10174276 | Ga0268266_101742761 | 280 |
| 330 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008534 | 280 |
| 331 | 3300030731 | Ga0316177_1154661 | Ga0316177_11546612 | 280 |
| 332 | 3300030732 | Ga0316176_1196688 | Ga0316176_11966882 | 280 |
| 333 | 3300030742 | Ga0316183_1165678 | Ga0316183_11656782 | 280 |
| 334 | 3300030744 | Ga0316181_1116568 | Ga0316181_11165682 | 280 |
| 335 | 3300030745 | Ga0316182_1032687 | Ga0316182_10326872 | 280 |
| 336 | 3300030745 | Ga0316182_1045838 | Ga0316182_10458381 | 280 |
| 337 | 3300031548 | Ga0307408_100103013 | Ga0307408_1001030132 | 280 |
| 338 | 3300031824 | Ga0307413_10106519 | Ga0307413_101065192 | 280 |
| 339 | 3300031824 | Ga0307413_10108752 | Ga0307413_101087521 | 280 |
| 340 | 3300031824 | Ga0307413_10337769 | Ga0307413_103377691 | 280 |
| 341 | 3300031852 | Ga0307410_10167656 | Ga0307410_101676562 | 280 |
| 342 | 3300031911 | Ga0307412_10003464 | Ga0307412_100034643 | 280 |
| 343 | 3300032004 | Ga0307414_10008024 | Ga0307414_100080243 | 280 |
| 344 | 3300032004 | Ga0307414_10047686 | Ga0307414_100476864 | 280 |
| 345 | 3300032005 | Ga0307411_10384424 | Ga0307411_103844241 | 280 |
| 346 | 3300037418 | Ga0395900_0031426 | Ga0395900_0031426_3719_4561 | 280 |
| 347 | 3300041404 | Ga0439436_0023615 | Ga0439436_0023615_844_1716 | 280 |
| 348 | 3300041404 | Ga0439436_0031231 | Ga0439436_0031231_600_1442 | 280 |
| 349 | 3300041451 | Ga0451791_0501601 | Ga0451791_0501601_65_907 | 280 |
| 350 | 3300041460 | Ga0451802_1329035 | Ga0451802_1329035_512_1354 | 280 |
| 351 | 3300041494 | Ga0451837_1853913 | Ga0451837_1853913_455_1297 | 280 |
| 352 | 3300041509 | Ga0451843_0405619 | Ga0451843_0405619_108_956 | 280 |
| 353 | 3300042006 | Ga0439432_015906 | Ga0439432_015906_436_1308 | 280 |
| 354 | 3300042007 | Ga0439449_0003124 | Ga0439449_0003124_4327_5199 | 280 |
| 355 | 3300046460 | Ga0495638_0031329 | Ga0495638_0031329_1330_2172 | 280 |
| 356 | 3300046507 | Ga0495606_0013802 | Ga0495606_0013802_431_1273 | 280 |
| 357 | 3300046512 | Ga0495610_0007418 | Ga0495610_0007418_1358_2200 | 280 |
| 358 | 3300046522 | Ga0495643_0003677 | Ga0495643_0003677_8826_9668 | 280 |
| 359 | 3300046525 | Ga0495663_0003825 | Ga0495663_0003825_1150_1992 | 280 |
| 360 | 3300046525 | Ga0495663_0013691 | Ga0495663_0013691_1223_2065 | 280 |
| 361 | 3300046539 | Ga0495621_0029869 | Ga0495621_0029869_422_1291 | 280 |
| 362 | 3300046558 | Ga0495633_0027302 | Ga0495633_0027302_664_1506 | 280 |
| 363 | 3300046616 | Ga0495668_0022639 | Ga0495668_0022639_2453_3322 | 280 |
| 364 | 3300046660 | Ga0495625_0137231 | Ga0495625_0137231_320_1162 | 280 |
| 365 | 3300047318 | Ga0495636_0000567 | Ga0495636_0000567_1375_2247 | 280 |
| 366 | 3300047318 | Ga0495636_0018370 | Ga0495636_0018370_591_1463 | 280 |
| 367 | 3300047320 | Ga0495672_0000073 | Ga0495672_0000073_149180_150022 | 280 |
| 368 | 3300047320 | Ga0495672_0083386 | Ga0495672_0083386_731_1576 | 280 |
| 369 | 3300048919 | Ga0496116_0008602 | Ga0496116_0008602_6554_7396 | 280 |
| 370 | 3300048919 | Ga0496116_0121941 | Ga0496116_0121941_227_1069 | 280 |
| 371 | 3300048920 | Ga0496117_0003747 | Ga0496117_0003747_10793_11635 | 280 |
| 372 | 3300048920 | Ga0496117_0030699 | Ga0496117_0030699_952_1794 | 280 |
| 373 | 3300048921 | Ga0496118_0003355 | Ga0496118_0003355_1314_2156 | 280 |
| 374 | 3300048921 | Ga0496118_0024226 | Ga0496118_0024226_2788_3630 | 280 |
| 375 | 3300048922 | Ga0496119_0002556 | Ga0496119_0002556_17960_18802 | 280 |
| 376 | 3300048923 | Ga0496120_0002304 | Ga0496120_0002304_17962_18804 | 280 |
| 377 | 3300048924 | Ga0496121_0014643 | Ga0496121_0014643_6121_6963 | 280 |
| 378 | 3300048925 | Ga0496122_0005815 | Ga0496122_0005815_3325_4167 | 280 |
| 379 | 3300048925 | Ga0496122_0036737 | Ga0496122_0036737_2764_3606 | 280 |
| 380 | 3300048925 | Ga0496122_0063232 | Ga0496122_0063232_158_1000 | 280 |
| 381 | 3300048925 | Ga0496122_0166372 | Ga0496122_0166372_158_1000 | 280 |
| 382 | 3300048926 | Ga0496123_0004555 | Ga0496123_0004555_3328_4170 | 280 |
| 383 | 3300048926 | Ga0496123_0074519 | Ga0496123_0074519_1127_1969 | 280 |
| 384 | 3300048926 | Ga0496123_0079332 | Ga0496123_0079332_954_1796 | 280 |
| 385 | 3300048927 | Ga0496124_0000009 | Ga0496124_0000009_143384_144226 | 280 |
| 386 | 3300048927 | Ga0496124_0003468 | Ga0496124_0003468_3562_4404 | 280 |
| 387 | 3300048927 | Ga0496124_0004080 | Ga0496124_0004080_12043_12885 | 280 |
| 388 | 3300048927 | Ga0496124_0012072 | Ga0496124_0012072_5858_6700 | 280 |
| 389 | 3300048927 | Ga0496124_0040855 | Ga0496124_0040855_690_1532 | 280 |
| 390 | 3300048927 | Ga0496124_0052040 | Ga0496124_0052040_1101_1943 | 280 |
| 391 | 3300048927 | Ga0496124_0090072 | Ga0496124_0090072_551_1393 | 280 |
| 392 | 3300048928 | Ga0496125_0006523 | Ga0496125_0006523_1347_2189 | 280 |
| 393 | 3300048928 | Ga0496125_0014622 | Ga0496125_0014622_858_1700 | 280 |
| 394 | 3300048928 | Ga0496125_0044590 | Ga0496125_0044590_2199_3041 | 280 |
| 395 | 3300048928 | Ga0496125_0056647 | Ga0496125_0056647_707_1549 | 280 |
| 396 | 3300048929 | Ga0496126_0007989 | Ga0496126_0007989_9293_10135 | 280 |
| 397 | 3300049568 | Ga0501031_0010110 | Ga0501031_0010110_3185_4027 | 280 |
| 398 | 3300049570 | Ga0501033_0001489 | Ga0501033_0001489_4058_4906 | 280 |
| 399 | 3300049570 | Ga0501033_0002438 | Ga0501033_0002438_1231_2073 | 280 |
| 400 | 3300049573 | Ga0501037_0002420 | Ga0501037_0002420_2962_3804 | 280 |
| 401 | 3300049574 | Ga0501038_0021112 | Ga0501038_0021112_1275_2117 | 280 |
| 402 | 3300049822 | Ga0501035_0003472 | Ga0501035_0003472_11126_11968 | 280 |
| 403 | 3300049822 | Ga0501035_0054814 | Ga0501035_0054814_2398_3246 | 280 |
| 404 | 3300049823 | Ga0501044_0027026 | Ga0501044_0027026_2988_3830 | 280 |
| 405 | 3300050491 | nmdc:mga00v17_202_c2 | nmdc:mga00v17_202_c2_21702_22547 | 280 |
| 406 | 3300053079 | Ga0500610_0000087 | Ga0500610_0000087_18249_19100 | 280 |
| 407 | 3300053161 | Ga0500634_0000048 | Ga0500634_0000048_44325_45167 | 280 |
| 408 | 2162886007 | SwRhRL2b_contig_3430003 | SwRhRL2b_0470.00006820 | 281 |
| 409 | 3300002773 | JGI25152J39213_1000548 | JGI25152J39213_100054815 | 281 |
| 410 | 3300002774 | JGI25150J39212_1000114 | JGI25150J39212_100011445 | 281 |
| 411 | 3300003187 | JGI25151J46595_10000100 | JGI25151J46595_1000010014 | 281 |
| 412 | 3300003187 | JGI25151J46595_10000128 | JGI25151J46595_1000012842 | 281 |
| 413 | 3300003215 | JGI25153J46596_10000071 | JGI25153J46596_1000007114 | 281 |
| 414 | 3300003771 | Ga0055526_1000021 | Ga0055526_100002148 | 281 |
| 415 | 3300003773 | Ga0055537_1000141 | Ga0055537_100014128 | 281 |
| 416 | 3300003775 | Ga0055524_1000128 | Ga0055524_100012830 | 281 |
| 417 | 3300003784 | Ga0055534_1000054 | Ga0055534_100005430 | 281 |
| 418 | 3300003790 | Ga0055528_1000009 | Ga0055528_100000948 | 281 |
| 419 | 3300003791 | Ga0055530_10006699 | Ga0055530_100066993 | 281 |
| 420 | 3300003794 | Ga0055531_10023878 | Ga0055531_100238781 | 281 |
| 421 | 3300003794 | Ga0055531_10034919 | Ga0055531_100349191 | 281 |
| 422 | 3300003856 | Ga0058692_1000024 | Ga0058692_1000024176 | 281 |
| 423 | 3300005289 | Ga0065704_10070427 | Ga0065704_100704275 | 281 |
| 424 | 3300005335 | Ga0070666_10161546 | Ga0070666_101615461 | 281 |
| 425 | 3300005335 | Ga0070666_10357797 | Ga0070666_103577971 | 281 |
| 426 | 3300005344 | Ga0070661_100174837 | Ga0070661_1001748371 | 281 |
| 427 | 3300005353 | Ga0070669_100021116 | Ga0070669_1000211164 | 281 |
| 428 | 3300005354 | Ga0070675_100183973 | Ga0070675_1001839732 | 281 |
| 429 | 3300005354 | Ga0070675_100215198 | Ga0070675_1002151981 | 281 |
| 430 | 3300005356 | Ga0070674_100380553 | Ga0070674_1003805532 | 281 |
| 431 | 3300005367 | Ga0070667_100326170 | Ga0070667_1003261702 | 281 |
| 432 | 3300005435 | Ga0070714_100461773 | Ga0070714_1004617731 | 281 |
| 433 | 3300005459 | Ga0068867_100185165 | Ga0068867_1001851652 | 281 |
| 434 | 3300005539 | Ga0068853_100011050 | Ga0068853_1000110505 | 281 |
| 435 | 3300005539 | Ga0068853_100186624 | Ga0068853_1001866242 | 281 |
| 436 | 3300005543 | Ga0070672_100004894 | Ga0070672_1000048946 | 281 |
| 437 | 3300005548 | Ga0070665_100200891 | Ga0070665_1002008912 | 281 |
| 438 | 3300005578 | Ga0068854_100156886 | Ga0068854_1001568862 | 281 |
| 439 | 3300005578 | Ga0068854_100180122 | Ga0068854_1001801222 | 281 |
| 440 | 3300005843 | Ga0068860_100039783 | Ga0068860_1000397833 | 281 |
| 441 | 3300009093 | Ga0105240_10011255 | Ga0105240_100112555 | 281 |
| 442 | 3300009098 | Ga0105245_10276405 | Ga0105245_102764052 | 281 |
| 443 | 3300009148 | Ga0105243_10065350 | Ga0105243_100653503 | 281 |
| 444 | 3300009177 | Ga0105248_10331750 | Ga0105248_103317502 | 281 |
| 445 | 3300009545 | Ga0105237_10011506 | Ga0105237_100115065 | 281 |
| 446 | 3300009551 | Ga0105238_10004604 | Ga0105238_100046048 | 281 |
| 447 | 3300009979 | Ga0105032_100180 | Ga0105032_1001801 | 281 |
| 448 | 3300013102 | Ga0157371_10032246 | Ga0157371_100322462 | 281 |
| 449 | 3300013104 | Ga0157370_10015401 | Ga0157370_100154015 | 281 |
| 450 | 3300013104 | Ga0157370_10043506 | Ga0157370_100435064 | 281 |
| 451 | 3300013104 | Ga0157370_10315849 | Ga0157370_103158492 | 281 |
| 452 | 3300013105 | Ga0157369_10000148 | Ga0157369_1000014884 | 281 |
| 453 | 3300013105 | Ga0157369_10018886 | Ga0157369_100188866 | 281 |
| 454 | 3300013297 | Ga0157378_10036223 | Ga0157378_100362234 | 281 |
| 455 | 3300013307 | Ga0157372_10328623 | Ga0157372_103286232 | 281 |
| 456 | 3300013308 | Ga0157375_10048294 | Ga0157375_100482944 | 281 |
| 457 | 3300015265 | Ga0182005_1002348 | Ga0182005_10023485 | 281 |
| 458 | 3300015689 | Ga0183360_10001 | Ga0183360_100011157 | 281 |
| 459 | 3300025245 | Ga0207425_1000030 | Ga0207425_1000030130 | 281 |
| 460 | 3300025258 | Ga0209129_1000063 | Ga0209129_100006392 | 281 |
| 461 | 3300025263 | Ga0209565_1000048 | Ga0209565_100004849 | 281 |
| 462 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000012645 | 281 |
| 463 | 3300025273 | Ga0209673_1012935 | Ga0209673_10129352 | 281 |
| 464 | 3300025284 | Ga0209130_1014151 | Ga0209130_10141513 | 281 |
| 465 | 3300025291 | Ga0209675_1000045 | Ga0209675_1000045117 | 281 |
| 466 | 3300025291 | Ga0209675_1006536 | Ga0209675_10065362 | 281 |
| 467 | 3300025292 | Ga0209676_1001772 | Ga0209676_100177217 | 281 |
| 468 | 3300025292 | Ga0209676_1004431 | Ga0209676_10044316 | 281 |
| 469 | 3300025292 | Ga0209676_1017119 | Ga0209676_10171192 | 281 |
| 470 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005410 | 281 |
| 471 | 3300025294 | Ga0209025_1000013 | Ga0209025_1000013664 | 281 |
| 472 | 3300025294 | Ga0209025_1001699 | Ga0209025_10016997 | 281 |
| 473 | 3300025295 | Ga0209564_1000001 | Ga0209564_100000149 | 281 |
| 474 | 3300025295 | Ga0209564_1007904 | Ga0209564_10079043 | 281 |
| 475 | 3300025297 | Ga0209758_1000014 | Ga0209758_1000014664 | 281 |
| 476 | 3300025298 | Ga0209050_1000603 | Ga0209050_100060325 | 281 |
| 477 | 3300025299 | Ga0209256_1000002 | Ga0209256_10000021503 | 281 |
| 478 | 3300025299 | Ga0209256_1003125 | Ga0209256_100312510 | 281 |
| 479 | 3300025299 | Ga0209256_1004759 | Ga0209256_10047593 | 281 |
| 480 | 3300025299 | Ga0209256_1005517 | Ga0209256_10055174 | 281 |
| 481 | 3300025303 | Ga0209051_1012596 | Ga0209051_10125964 | 281 |
| 482 | 3300025304 | Ga0209257_1000122 | Ga0209257_100012264 | 281 |
| 483 | 3300025304 | Ga0209257_1000243 | Ga0209257_100024319 | 281 |
| 484 | 3300025304 | Ga0209257_1001409 | Ga0209257_100140917 | 281 |
| 485 | 3300025304 | Ga0209257_1001842 | Ga0209257_10018422 | 281 |
| 486 | 3300025304 | Ga0209257_1003711 | Ga0209257_10037112 | 281 |
| 487 | 3300025304 | Ga0209257_1004748 | Ga0209257_10047482 | 281 |
| 488 | 3300025903 | Ga0207680_10292890 | Ga0207680_102928901 | 281 |
| 489 | 3300025913 | Ga0207695_10002942 | Ga0207695_1000294212 | 281 |
| 490 | 3300025914 | Ga0207671_10003439 | Ga0207671_100034396 | 281 |
| 491 | 3300025920 | Ga0207649_10132106 | Ga0207649_101321061 | 281 |
| 492 | 3300025923 | Ga0207681_10005175 | Ga0207681_100051751 | 281 |
| 493 | 3300025924 | Ga0207694_10001329 | Ga0207694_1000132916 | 281 |
| 494 | 3300025931 | Ga0207644_10019547 | Ga0207644_100195472 | 281 |
| 495 | 3300025932 | Ga0207690_10079526 | Ga0207690_100795262 | 281 |
| 496 | 3300025933 | Ga0207706_10469701 | Ga0207706_104697011 | 281 |
| 497 | 3300025940 | Ga0207691_10001351 | Ga0207691_1000135123 | 281 |
| 498 | 3300025986 | Ga0207658_10353571 | Ga0207658_103535712 | 281 |
| 499 | 3300026041 | Ga0207639_10013523 | Ga0207639_100135233 | 281 |
| 500 | 3300026067 | Ga0207678_10308580 | Ga0207678_103085802 | 281 |
| 501 | 3300026067 | Ga0207678_10425972 | Ga0207678_104259722 | 281 |
| 502 | 3300026088 | Ga0207641_10321894 | Ga0207641_103218941 | 281 |
| 503 | 3300026089 | Ga0207648_10143860 | Ga0207648_101438602 | 281 |
| 504 | 3300026118 | Ga0207675_100008513 | Ga0207675_1000085138 | 281 |
| 505 | 3300027312 | Ga0209371_1000016 | Ga0209371_1000016394 | 281 |
| 506 | 3300028379 | Ga0268266_10166883 | Ga0268266_101668832 | 281 |
| 507 | 3300028381 | Ga0268264_10106646 | Ga0268264_101066463 | 281 |
| 508 | 3300028794 | Ga0307515_10268053 | Ga0307515_102680532 | 281 |
| 509 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015176 | 281 |
| 510 | 3300031456 | Ga0307513_10001515 | Ga0307513_1000151534 | 281 |
| 511 | 3300031691 | Ga0316579_10051224 | Ga0316579_100512241 | 281 |
| 512 | 3300031727 | Ga0316576_10101615 | Ga0316576_101016152 | 281 |
| 513 | 3300031730 | Ga0307516_10023137 | Ga0307516_100231372 | 281 |
| 514 | 3300031733 | Ga0316577_10262752 | Ga0316577_102627521 | 281 |
| 515 | 3300031824 | Ga0307413_10020201 | Ga0307413_100202013 | 281 |
| 516 | 3300031852 | Ga0307410_10022805 | Ga0307410_100228052 | 281 |
| 517 | 3300031901 | Ga0307406_10097183 | Ga0307406_100971832 | 281 |
| 518 | 3300031901 | Ga0307406_10153855 | Ga0307406_101538552 | 281 |
| 519 | 3300031901 | Ga0307406_10241399 | Ga0307406_102413992 | 281 |
| 520 | 3300031995 | Ga0307409_100302032 | Ga0307409_1003020322 | 281 |
| 521 | 3300032004 | Ga0307414_10007328 | Ga0307414_100073282 | 281 |
| 522 | 3300032005 | Ga0307411_10014333 | Ga0307411_100143333 | 281 |
| 523 | 3300035116 | Ga0373945_0102135 | Ga0373945_0102135_226_1071 | 281 |
| 524 | 3300035398 | Ga0316574_0066867 | Ga0316574_0066867_48_965 | 281 |
| 525 | 3300036647 | Ga0316582_0084641 | Ga0316582_0084641_322_1239 | 281 |
| 526 | 3300037312 | Ga0395899_0021274 | Ga0395899_0021274_1547_2584 | 281 |
| 527 | 3300037312 | Ga0395899_0378782 | Ga0395899_0378782_14_907 | 281 |
| 528 | 3300037418 | Ga0395900_0098626 | Ga0395900_0098626_36_980 | 281 |
| 529 | 3300037418 | Ga0395900_0274081 | Ga0395900_0274081_264_1109 | 281 |
| 530 | 3300037466 | Ga0395898_0260825 | Ga0395898_0260825_151_1173 | 281 |
| 531 | 3300037471 | Ga0395905_0000503 | Ga0395905_0000503_27699_28643 | 281 |
| 532 | 3300037471 | Ga0395905_0019782 | Ga0395905_0019782_1197_2096 | 281 |
| 533 | 3300038443 | Ga0395901_0400550 | Ga0395901_0400550_101_1123 | 281 |
| 534 | 3300038705 | Ga0237819_00151 | Ga0237819_00151_5680_6525 | 281 |
| 535 | 3300039145 | Ga0237816_00052 | Ga0237816_00052_4573_5418 | 281 |
| 536 | 3300041404 | Ga0439436_0008498 | Ga0439436_0008498_1776_2630 | 281 |
| 537 | 3300041404 | Ga0439436_0017952 | Ga0439436_0017952_508_1362 | 281 |
| 538 | 3300041407 | Ga0439447_007420 | Ga0439447_007420_1791_2639 | 281 |
| 539 | 3300041413 | Ga0439465_0001513 | Ga0439465_0001513_767_1621 | 281 |
| 540 | 3300041413 | Ga0439465_0004624 | Ga0439465_0004624_1794_2648 | 281 |
| 541 | 3300041443 | Ga0451789_1189856 | Ga0451789_1189856_257_1123 | 281 |
| 542 | 3300041451 | Ga0451791_0669101 | Ga0451791_0669101_337_1182 | 281 |
| 543 | 3300041459 | Ga0451800_1497069 | Ga0451800_1497069_915_1763 | 281 |
| 544 | 3300041460 | Ga0451802_0225807 | Ga0451802_0225807_1899_2765 | 281 |
| 545 | 3300041462 | Ga0451806_254328 | Ga0451806_254328_2028_2876 | 281 |
| 546 | 3300041486 | Ga0451807_0519353 | Ga0451807_0519353_1491_2339 | 281 |
| 547 | 3300041486 | Ga0451807_2648432 | Ga0451807_2648432_34_879 | 281 |
| 548 | 3300041509 | Ga0451843_0406729 | Ga0451843_0406729_704_1552 | 281 |
| 549 | 3300041512 | Ga0451853_0391743 | Ga0451853_0391743_787_1653 | 281 |
| 550 | 3300041512 | Ga0451853_0518947 | Ga0451853_0518947_170_1015 | 281 |
| 551 | 3300042007 | Ga0439449_0000018 | Ga0439449_0000018_1255_2109 | 281 |
| 552 | 3300042007 | Ga0439449_0004679 | Ga0439449_0004679_23_910 | 281 |
| 553 | 3300042007 | Ga0439449_0011438 | Ga0439449_0011438_610_1455 | 281 |
| 554 | 3300042876 | Ga0451577_0058752 | Ga0451577_0058752_1484_2335 | 281 |
| 555 | 3300046525 | Ga0495663_0001399 | Ga0495663_0001399_5290_6144 | 281 |
| 556 | 3300046525 | Ga0495663_0026508 | Ga0495663_0026508_197_1051 | 281 |
| 557 | 3300046615 | Ga0495656_0027624 | Ga0495656_0027624_655_1533 | 281 |
| 558 | 3300046615 | Ga0495656_0029083 | Ga0495656_0029083_1185_2057 | 281 |
| 559 | 3300046616 | Ga0495668_0008487 | Ga0495668_0008487_2445_3293 | 281 |
| 560 | 3300046692 | Ga0495671_0070657 | Ga0495671_0070657_125_979 | 281 |
| 561 | 3300047318 | Ga0495636_0108742 | Ga0495636_0108742_270_1148 | 281 |
| 562 | 3300048903 | Ga0496100_0190319 | Ga0496100_0190319_134_1078 | 281 |
| 563 | 3300048909 | Ga0496106_0328530 | Ga0496106_0328530_13_885 | 281 |
| 564 | 3300048912 | Ga0496109_0031793 | Ga0496109_0031793_3080_4024 | 281 |
| 565 | 3300048913 | Ga0496110_0525235 | Ga0496110_0525235_177_1049 | 281 |
| 566 | 3300048915 | Ga0496112_0054916 | Ga0496112_0054916_2591_3535 | 281 |
| 567 | 3300048916 | Ga0496113_0012572 | Ga0496113_0012572_1981_2925 | 281 |
| 568 | 3300048916 | Ga0496113_0024103 | Ga0496113_0024103_3076_3948 | 281 |
| 569 | 3300048920 | Ga0496117_0083404 | Ga0496117_0083404_12_887 | 281 |
| 570 | 3300048921 | Ga0496118_0061448 | Ga0496118_0061448_922_1770 | 281 |
| 571 | 3300048925 | Ga0496122_0034822 | Ga0496122_0034822_3198_4046 | 281 |
| 572 | 3300048926 | Ga0496123_0029269 | Ga0496123_0029269_46_894 | 281 |
| 573 | 3300048929 | Ga0496126_0026779 | Ga0496126_0026779_3377_4225 | 281 |
| 574 | 3300048929 | Ga0496126_0144782 | Ga0496126_0144782_215_1063 | 281 |
| 575 | 3300049570 | Ga0501033_0011027 | Ga0501033_0011027_2062_2949 | 281 |
| 576 | 3300049571 | Ga0501034_0037891 | Ga0501034_0037891_2577_3425 | 281 |
| 577 | 3300049571 | Ga0501034_0054343 | Ga0501034_0054343_2015_2863 | 281 |
| 578 | 3300049572 | Ga0501036_0023761 | Ga0501036_0023761_3933_4820 | 281 |
| 579 | 3300049574 | Ga0501038_0004044 | Ga0501038_0004044_11250_12137 | 281 |
| 580 | 3300049575 | Ga0501039_0003853 | Ga0501039_0003853_8833_9720 | 281 |
| 581 | 3300049576 | Ga0501040_0001206 | Ga0501040_0001206_7545_8432 | 281 |
| 582 | 3300049577 | Ga0501041_0001968 | Ga0501041_0001968_5933_6820 | 281 |
| 583 | 3300049578 | Ga0501042_0000931 | Ga0501042_0000931_6309_7196 | 281 |
| 584 | 3300049579 | Ga0501043_0021394 | Ga0501043_0021394_1049_1942 | 281 |
| 585 | 3300049579 | Ga0501043_0037824 | Ga0501043_0037824_2884_3747 | 281 |
| 586 | 3300049579 | Ga0501043_0099869 | Ga0501043_0099869_889_1776 | 281 |
| 587 | 3300049580 | Ga0501046_0011112 | Ga0501046_0011112_3673_4560 | 281 |
| 588 | 3300049582 | Ga0501048_0011120 | Ga0501048_0011120_4465_5352 | 281 |
| 589 | 3300049584 | Ga0501068_0000860 | Ga0501068_0000860_10597_11484 | 281 |
| 590 | 3300049587 | Ga0501071_0006996 | Ga0501071_0006996_3451_4338 | 281 |
| 591 | 3300049588 | Ga0501072_0001665 | Ga0501072_0001665_12411_13298 | 281 |
| 592 | 3300049591 | Ga0501075_0000858 | Ga0501075_0000858_16250_17137 | 281 |
| 593 | 3300049592 | Ga0501076_0002159 | Ga0501076_0002159_6027_6914 | 281 |
| 594 | 3300049592 | Ga0501076_0031032 | Ga0501076_0031032_279_1154 | 281 |
| 595 | 3300049593 | Ga0501077_0004578 | Ga0501077_0004578_1068_1955 | 281 |
| 596 | 3300049679 | Ga0501249_008222 | Ga0501249_008222_111_986 | 281 |
| 597 | 3300049688 | Ga0501259_001711 | Ga0501259_001711_1866_2741 | 281 |
| 598 | 3300049705 | Ga0501225_0013529 | Ga0501225_0013529_240_1091 | 281 |
| 599 | 3300049741 | Ga0501079_0002189 | Ga0501079_0002189_7588_8475 | 281 |
| 600 | 3300049742 | Ga0501080_0009101 | Ga0501080_0009101_5858_6745 | 281 |
| 601 | 3300049743 | Ga0501081_0000359 | Ga0501081_0000359_14561_15448 | 281 |
| 602 | 3300049822 | Ga0501035_0035887 | Ga0501035_0035887_1670_2557 | 281 |
| 603 | 3300049823 | Ga0501044_0165761 | Ga0501044_0165761_169_1056 | 281 |
| 604 | 3300049824 | Ga0501045_0031495 | Ga0501045_0031495_2383_3258 | 281 |
| 605 | 3300054114 | Ga0501084_0007709 | Ga0501084_0007709_5130_6017 | 281 |
| 606 | 3300060353 | Ga0501082_0000368 | Ga0501082_0000368_36900_37787 | 281 |
| 607 | 3300061734 | Ga0530510_0000025 | Ga0530510_0000025_20006_20893 | 281 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cnx-assembly2.cif.gz_E | crystal structure of apo psd from e. coli (2.63 a) | 0.9545 | 5 | 246 |
| 7cnz-assembly2.cif.gz_G | crystal structure of 10pe bound psd from e. coli (2.70 a) | 0.9393 | 1 | 246 |
| 7cnz-assembly2.cif.gz_G | crystal structure of 10pe bound psd from e. coli (2.70 a) | 0.9356 | 1 | 246 |
| 7cnx-assembly2.cif.gz_E | crystal structure of apo psd from e. coli (2.63 a) | 0.9247 | 5 | 246 |
| 6zjl-assembly1.cif.gz_4 | respiratory complex i from thermus thermophilus, nad+ dataset, major state | 0.6799 | 181 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8K1_63_285_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9751 | 61 | 277 | 2.70.70.10 |
| af_P0A8K1_63_285_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9451 | 61 | 277 | 2.70.70.10 |
| af_C7FZZ8_173_397_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9114 | 62 | 278 | 2.70.70.10 |
| af_A1A5T2_181_425_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9004 | 62 | 277 | 2.70.70.10 |
| af_O14333_232_431_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8986 | 130 | 278 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R0DQG4-F1-model_v4 | deleted | 0.9992 | 81 | 279 |
|
| AF-A0A0R0DQG4-F1-model_v4 | deleted | 0.9892 | 81 | 279 |
|
| AF-A0A3D2SL59-F1-model_v4 | phosphatidylserine decarboxylase (EC 4.1.1.65) | 0.9868 | 22 | 147 |
GO:0004609
GO:0006646 |
| AF-W7WJA4-F1-model_v4 | phosphatidylserine decarboxylase (EC 4.1.1.65) | 0.9848 | 86 | 277 |
GO:0004609
GO:0006646 |
| AF-A0A2E3MJK1-F1-model_v4 | Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] | 0.9847 | 9 | 281 |
GO:0004609
GO:0005886 GO:0006646 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar