F468713

General Info

Members Datasets Scaffolds Average Seq Length
607 350 545 284

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0021274|Ga0395899_0021274_1547_2584
Length 345
Sequence MRSRRSRRSYTGKQLAAASRSYDGLRFGSPCSHGPDPHNGGPFADEPPVSLTTRLTYVLPHRVLSSLARRLAYSDHPGVSRWLIDTVTKRFGVDLTEAAEPDPRAYPTFNAFFTRALRVGARAPDXXXRALLMPADGRISECGHIGRADEGVLHEDHGHIFQAKGHGFTTAELLGDATAAQAFAGGVYATVYLSPRDYHRVHMPWTGTLRETVHVPGRLFSVGPDAVGTVSKLFARNERLVCHFDCDFGPMAVVMVGALLVSGVETVWGGVEIPPYGGPVVVKDYRAGNSSGEAIVLERFAEMARFNYGSTVIVLLPPGVATLAPQLGAETAVRLGERLATIAVA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
4 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
5 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
6 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
7 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
8 2643221559 Lysobacter sp. Root559 Isolate Unclassified
9 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
10 2643221573 Lysobacter sp. Root604 Isolate Unclassified
11 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
12 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
13 2643221586 Lysobacter sp. Root667 Isolate Unclassified
14 2643221593 Lysobacter sp. Root690 Isolate Unclassified
15 2643221612 Lysobacter sp. Root76 Isolate Unclassified
16 2643221695 Lysobacter sp. Root494 Isolate Unclassified
17 2643221720 Lysobacter sp. Root916 Isolate Unclassified
18 2643221727 Lysobacter sp. Root96 Isolate Unclassified
19 2643221728 Lysobacter sp. Root983 Isolate Unclassified
20 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
21 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
22 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
23 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
24 2818991457 Xanthomonas translucens 569 Isolate Unclassified
25 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
26 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
27 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
28 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
29 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
30 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
31 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
32 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
33 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
34 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
35 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
36 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
37 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
38 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
39 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
40 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
41 2919513703 Luteimonas sp. 3794 Isolate Unclassified
42 2919675420 Luteimonas terrae 4099 Isolate Unclassified
43 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
44 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
45 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
46 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
47 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
48 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
49 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
50 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
51 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
52 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
53 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
54 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
55 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
56 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
57 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
58 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
59 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
60 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
61 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
62 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
63 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
64 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
65 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
66 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
67 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
68 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
69 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
70 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
78 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
79 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
82 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
83 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
86 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
87 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
98 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
99 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
100 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
101 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
106 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
107 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
154 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
213 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
214 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
215 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
216 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
217 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
246 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
247 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
248 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
251 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
252 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
255 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
256 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
257 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
258 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
334 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
335 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
345 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
349 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
350 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.46
Metatranscriptomes 0.33
Isolates 10.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 15.32
Nodule 0.33
Rhizoplane 3.29
Rhizosphere 66.39
Stem 0
Stem Tuber 0
Unclassified 14.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3430003 2162886007 Bacteria 3997
2 JGI24741J21665_1001939 3300001915 Bacteria 5578
3 JGI24740J21852_10002530 3300001979 Bacteria 8255
4 JGI25162J39368_1001808 3300002737 Bacteria 10048
5 JGI25162J39368_1001810 3300002737 Bacteria 10041
6 JGI25157J39369_1000764 3300002741 Bacteria 16694
7 JGI25164J39214_1000891 3300002772 Bacteria 10040
8 JGI25164J39214_1001247 3300002772 Bacteria 6754
9 JGI25152J39213_1000548 3300002773 Bacteria 20669
10 JGI25150J39212_1000114 3300002774 Bacteria 45745
11 JGI25151J46595_10000100 3300003187 Bacteria 116522
12 JGI25151J46595_10000128 3300003187 Bacteria 102514
13 JGI25165J46597_1001382 3300003214 Bacteria 13341
14 JGI25165J46597_1001877 3300003214 Bacteria 8582
15 JGI25153J46596_10000071 3300003215 Bacteria 116950
16 Ga0055526_1000021 3300003771 Bacteria 180007
17 Ga0055526_1000486 3300003771 Bacteria 31535
18 Ga0055537_1000141 3300003773 Bacteria 54030
19 Ga0055524_1000128 3300003775 Bacteria 88986
20 Ga0055524_1036326 3300003775 Bacteria 1327
21 Ga0055536_1003210 3300003781 Bacteria 8863
22 Ga0055536_1010253 3300003781 Bacteria 3744
23 Ga0055536_1010288 3300003781 Bacteria 3735
24 Ga0055534_1000034 3300003784 Bacteria 114684
25 Ga0055534_1000054 3300003784 Bacteria 88986
26 Ga0055528_1000009 3300003790 Bacteria 224150
27 Ga0055528_1000671 3300003790 Bacteria 24792
28 Ga0055530_10003879 3300003791 Bacteria 8173
29 Ga0055530_10003891 3300003791 Bacteria 8143
30 Ga0055530_10006699 3300003791 Bacteria 5061
31 Ga0055531_10001755 3300003794 Bacteria 15453
32 Ga0055531_10013574 3300003794 Bacteria 3744
33 Ga0055531_10014194 3300003794 Bacteria 3607
34 Ga0055531_10015882 3300003794 Bacteria 3285
35 Ga0055531_10023878 3300003794 Bacteria 2275
36 Ga0055531_10034919 3300003794 Bacteria 1585
37 Ga0058692_1000011 3300003856 Bacteria 321321
38 Ga0058692_1000024 3300003856 Bacteria 219702
39 Ga0065704_10070427 3300005289 Bacteria 25272
40 Ga0065715_10119645 3300005293 Bacteria 2281
41 Ga0070683_100002993 3300005329 Bacteria 13555
42 Ga0070677_10144016 3300005333 Bacteria 1102
43 Ga0070666_10161546 3300005335 Bacteria 1566
44 Ga0070666_10357797 3300005335 Bacteria 1045
45 Ga0070680_100035853 3300005336 Bacteria 4006
46 Ga0070680_100462075 3300005336 Bacteria 1084
47 Ga0070682_100002010 3300005337 Bacteria 11358
48 Ga0070660_100062724 3300005339 Bacteria 2888
49 Ga0070661_100174837 3300005344 Bacteria 1632
50 Ga0070692_10001511 3300005345 Bacteria 8515
51 Ga0070668_100003985 3300005347 Bacteria 10932
52 Ga0070669_100021116 3300005353 Bacteria 4653
53 Ga0070675_100183973 3300005354 Bacteria 1808
54 Ga0070675_100215198 3300005354 Bacteria 1672
55 Ga0070674_100380553 3300005356 Bacteria 1148
56 Ga0070667_100326170 3300005367 Bacteria 1386
57 Ga0070714_100000309 3300005435 Bacteria 37078
58 Ga0070714_100010639 3300005435 Bacteria 7278
59 Ga0070714_100461773 3300005435 Bacteria 1207
60 Ga0070713_100007035 3300005436 Bacteria 7857
61 Ga0070710_10081272 3300005437 Bacteria 1892
62 Ga0070694_100016102 3300005444 Bacteria 4706
63 Ga0070663_100007817 3300005455 Bacteria 6536
64 Ga0070681_10000029 3300005458 Bacteria 104346
65 Ga0070681_10007131 3300005458 Bacteria 10890
66 Ga0070681_10011742 3300005458 Bacteria 8678
67 Ga0070681_10136745 3300005458 Bacteria 2381
68 Ga0070681_10422246 3300005458 Bacteria 1245
69 Ga0070681_10562173 3300005458 Bacteria 1054
70 Ga0070681_10652263 3300005458 Bacteria 967
71 Ga0068867_100185165 3300005459 Bacteria 1658
72 Ga0070679_100000372 3300005530 Bacteria 38070
73 Ga0070679_100005054 3300005530 Bacteria 12176
74 Ga0070679_100016047 3300005530 Bacteria 7214
75 Ga0070684_100007023 3300005535 Bacteria 8750
76 Ga0068853_100000560 3300005539 Bacteria 25470
77 Ga0068853_100003691 3300005539 Bacteria 11748
78 Ga0068853_100011050 3300005539 Bacteria 7323
79 Ga0068853_100164047 3300005539 Bacteria 2006
80 Ga0068853_100186624 3300005539 Bacteria 1882
81 Ga0070672_100004894 3300005543 Bacteria 8811
82 Ga0070696_100002455 3300005546 Bacteria 12296
83 Ga0070696_100012046 3300005546 Bacteria 5793
84 Ga0070696_100016626 3300005546 Bacteria 4959
85 Ga0070693_100012474 3300005547 Bacteria 4301
86 Ga0070693_100016710 3300005547 Bacteria 3802
87 Ga0070665_100200891 3300005548 Bacteria 1994
88 Ga0068855_100011338 3300005563 Bacteria 10760
89 Ga0068855_100027527 3300005563 Bacteria 6799
90 Ga0068855_100559354 3300005563 Bacteria 1237
91 Ga0068854_100071896 3300005578 Bacteria 2532
92 Ga0068854_100156886 3300005578 Bacteria 1759
93 Ga0068854_100180122 3300005578 Bacteria 1650
94 Ga0068856_100000234 3300005614 Bacteria 60217
95 Ga0068852_100005378 3300005616 Bacteria 9155
96 Ga0068859_100047374 3300005617 Bacteria 4319
97 Ga0068864_100217571 3300005618 Bacteria 1761
98 Ga0068863_100361920 3300005841 Bacteria 1414
99 Ga0068860_100039783 3300005843 Bacteria 4497
100 Ga0075365_10060969 3300006038 Bacteria 2518
101 Ga0075364_10000020 3300006051 Bacteria 54215
102 Ga0075369_10055806 3300006186 Bacteria 1717
103 Ga0097620_100047374 3300006931 Bacteria 4319
104 Ga0099826_10113365 3300006948 Bacteria 1611
105 Ga0105251_10006353 3300009011 Bacteria 7548
106 Ga0105244_10038939 3300009036 Bacteria 2477
107 Ga0105240_10011255 3300009093 Bacteria 12473
108 Ga0105240_10028762 3300009093 Bacteria 7250
109 Ga0105240_10092734 3300009093 Bacteria 3687
110 Ga0105245_10218788 3300009098 Bacteria 1837
111 Ga0105245_10276405 3300009098 Bacteria 1640
112 Ga0105243_10065350 3300009148 Bacteria 2922
113 Ga0105241_10381857 3300009174 Bacteria 1231
114 Ga0105248_10331750 3300009177 Bacteria 1713
115 Ga0105237_10011506 3300009545 Bacteria 9361
116 Ga0105238_10004604 3300009551 Bacteria 13643
117 Ga0105238_10007073 3300009551 Bacteria 11228
118 Ga0105238_10029020 3300009551 Bacteria 5635
119 Ga0105238_10039845 3300009551 Bacteria 4762
120 Ga0105238_10047996 3300009551 Bacteria 4304
121 Ga0105032_100180 3300009979 Bacteria 6509
122 Ga0105239_10195593 3300010375 Bacteria 2264
123 Ga0157373_10008924 3300013100 Bacteria 7417
124 Ga0157373_10027422 3300013100 Bacteria 4108
125 Ga0157373_10059372 3300013100 Bacteria 2710
126 Ga0157371_10000154 3300013102 Bacteria 100237
127 Ga0157371_10002651 3300013102 Bacteria 16946
128 Ga0157371_10012336 3300013102 Bacteria 6539
129 Ga0157371_10032246 3300013102 Bacteria 3771
130 Ga0157371_10070183 3300013102 Bacteria 2481
131 Ga0157371_10338334 3300013102 Bacteria 1094
132 Ga0157370_10004589 3300013104 Bacteria 15809
133 Ga0157370_10008833 3300013104 Bacteria 10831
134 Ga0157370_10012597 3300013104 Bacteria 8763
135 Ga0157370_10013540 3300013104 Bacteria 8396
136 Ga0157370_10015401 3300013104 Bacteria 7773
137 Ga0157370_10043506 3300013104 Bacteria 4321
138 Ga0157370_10052040 3300013104 Bacteria 3910
139 Ga0157370_10083839 3300013104 Bacteria 2996
140 Ga0157370_10117649 3300013104 Bacteria 2482
141 Ga0157370_10315849 3300013104 Bacteria 1442
142 Ga0157369_10000148 3300013105 Bacteria 100073
143 Ga0157369_10017641 3300013105 Bacteria 8021
144 Ga0157369_10018886 3300013105 Bacteria 7725
145 Ga0157369_10236378 3300013105 Bacteria 1909
146 Ga0157369_10399732 3300013105 Bacteria 1425
147 Ga0157378_10036223 3300013297 Bacteria 4367
148 Ga0163162_10000007 3300013306 Bacteria 368084
149 Ga0157372_10003801 3300013307 Bacteria 16211
150 Ga0157372_10015387 3300013307 Bacteria 8198
151 Ga0157372_10149646 3300013307 Bacteria 2694
152 Ga0157372_10235558 3300013307 Bacteria 2123
153 Ga0157372_10328623 3300013307 Bacteria 1780
154 Ga0157372_10486300 3300013307 Bacteria 1439
155 Ga0157375_10000256 3300013308 Bacteria 48304
156 Ga0157375_10048294 3300013308 Bacteria 4163
157 Ga0157375_10301943 3300013308 Bacteria 1764
158 Ga0182008_10000142 3300014497 Bacteria 55320
159 Ga0182008_10008964 3300014497 Bacteria 5422
160 Ga0182008_10031525 3300014497 Bacteria 2668
161 Ga0157376_10001188 3300014969 Bacteria 17183
162 Ga0182006_1013905 3300015261 Bacteria 3479
163 Ga0182006_1019604 3300015261 Bacteria 2845
164 Ga0182006_1031233 3300015261 Bacteria 2148
165 Ga0182007_10000287 3300015262 Bacteria 33403
166 Ga0182007_10011339 3300015262 Bacteria 3472
167 Ga0182007_10047471 3300015262 Bacteria 1420
168 Ga0182005_1002348 3300015265 Bacteria 6824
169 Ga0183360_10001 3300015689 Bacteria 3943671
170 Ga0163161_10001348 3300017792 Bacteria 18260
171 Ga0163161_10021106 3300017792 Bacteria 4578
172 Ga0206354_10831098 3300020081 Bacteria 13528
173 Ga0154015_1062321 3300020610 Bacteria 2446
174 Ga0207427_100115 3300025231 Bacteria 104282
175 Ga0207427_100130 3300025231 Bacteria 94510
176 Ga0209437_100020 3300025233 Bacteria 656374
177 Ga0209437_100079 3300025233 Bacteria 275948
178 Ga0207425_1000030 3300025245 Bacteria 268200
179 Ga0207425_1019940 3300025245 Bacteria 1439
180 Ga0209026_1000051 3300025250 Bacteria 250792
181 Ga0209129_1000063 3300025258 Bacteria 240205
182 Ga0209233_1000020 3300025261 Bacteria 798224
183 Ga0209233_1000121 3300025261 Bacteria 233309
184 Ga0209565_1000022 3300025263 Bacteria 390888
185 Ga0209565_1000048 3300025263 Bacteria 224961
186 Ga0209673_1000001 3300025273 Bacteria 3176258
187 Ga0209673_1000104 3300025273 Bacteria 186569
188 Ga0209673_1012935 3300025273 Bacteria 3324
189 Ga0209130_1014151 3300025284 Bacteria 2014
190 Ga0209675_1000045 3300025291 Bacteria 225750
191 Ga0209675_1000048 3300025291 Bacteria 221457
192 Ga0209675_1006536 3300025291 Bacteria 4652
193 Ga0209676_1000024 3300025292 Bacteria 578839
194 Ga0209676_1000091 3300025292 Bacteria 251328
195 Ga0209676_1000117 3300025292 Bacteria 203251
196 Ga0209676_1001772 3300025292 Bacteria 18192
197 Ga0209676_1004431 3300025292 Bacteria 7834
198 Ga0209676_1017119 3300025292 Bacteria 2580
199 Ga0209025_1000005 3300025294 Bacteria 1272149
200 Ga0209025_1000013 3300025294 Bacteria 871757
201 Ga0209025_1001699 3300025294 Bacteria 26850
202 Ga0209025_1011986 3300025294 Bacteria 5623
203 Ga0209564_1000001 3300025295 Bacteria 3176258
204 Ga0209564_1000213 3300025295 Bacteria 132985
205 Ga0209564_1007904 3300025295 Bacteria 5373
206 Ga0209758_1000014 3300025297 Bacteria 871757
207 Ga0209758_1024714 3300025297 Bacteria 2666
208 Ga0209050_1000603 3300025298 Bacteria 57120
209 Ga0209050_1001640 3300025298 Bacteria 22906
210 Ga0209050_1005300 3300025298 Bacteria 8195
211 Ga0209256_1000002 3300025299 Bacteria 1906740
212 Ga0209256_1003125 3300025299 Bacteria 12074
213 Ga0209256_1004506 3300025299 Bacteria 8700
214 Ga0209256_1004759 3300025299 Bacteria 8282
215 Ga0209256_1005517 3300025299 Bacteria 7236
216 Ga0209256_1020821 3300025299 Bacteria 2034
217 Ga0209051_1006048 3300025303 Bacteria 6908
218 Ga0209051_1012596 3300025303 Bacteria 4082
219 Ga0209257_1000062 3300025304 Bacteria 362413
220 Ga0209257_1000122 3300025304 Bacteria 219678
221 Ga0209257_1000217 3300025304 Bacteria 136049
222 Ga0209257_1000243 3300025304 Bacteria 126291
223 Ga0209257_1001409 3300025304 Bacteria 28685
224 Ga0209257_1001842 3300025304 Bacteria 23103
225 Ga0209257_1003711 3300025304 Bacteria 12692
226 Ga0209257_1004748 3300025304 Bacteria 10151
227 Ga0209257_1005770 3300025304 Bacteria 8451
228 Ga0209257_1013027 3300025304 Bacteria 3753
229 Ga0209257_1014540 3300025304 Bacteria 3373
230 Ga0207713_1016794 3300025735 Bacteria 3701
231 Ga0207692_10089366 3300025898 Bacteria 1667
232 Ga0207680_10292890 3300025903 Bacteria 1133
233 Ga0207647_10065285 3300025904 Bacteria 2210
234 Ga0207705_10000968 3300025909 Bacteria 23502
235 Ga0207654_10073192 3300025911 Bacteria 2041
236 Ga0207707_10000216 3300025912 Bacteria 61797
237 Ga0207707_10000285 3300025912 Bacteria 53692
238 Ga0207707_10002882 3300025912 Bacteria 15354
239 Ga0207707_10006803 3300025912 Bacteria 9976
240 Ga0207695_10002942 3300025913 Bacteria 24581
241 Ga0207671_10003439 3300025914 Bacteria 15793
242 Ga0207660_10009145 3300025917 Bacteria 6415
243 Ga0207660_10014673 3300025917 Bacteria 5160
244 Ga0207660_10335654 3300025917 Bacteria 1209
245 Ga0207649_10132106 3300025920 Bacteria 1697
246 Ga0207652_10001445 3300025921 Bacteria 21033
247 Ga0207652_10001658 3300025921 Bacteria 19533
248 Ga0207652_10004611 3300025921 Bacteria 11168
249 Ga0207652_10028948 3300025921 Bacteria 4625
250 Ga0207652_10040233 3300025921 Bacteria 3969
251 Ga0207681_10005175 3300025923 Bacteria 8010
252 Ga0207694_10001329 3300025924 Bacteria 21273
253 Ga0207694_10065310 3300025924 Bacteria 2837
254 Ga0207694_10074612 3300025924 Bacteria 2655
255 Ga0207694_10093609 3300025924 Bacteria 2374
256 Ga0207694_10124398 3300025924 Bacteria 2062
257 Ga0207687_10184891 3300025927 Bacteria 1617
258 Ga0207700_10001685 3300025928 Bacteria 12544
259 Ga0207664_10000300 3300025929 Bacteria 36867
260 Ga0207664_10000884 3300025929 Bacteria 20225
261 Ga0207664_10469911 3300025929 Bacteria 1124
262 Ga0207644_10019547 3300025931 Bacteria 4595
263 Ga0207690_10013740 3300025932 Bacteria 4874
264 Ga0207690_10079526 3300025932 Bacteria 2285
265 Ga0207690_10086988 3300025932 Bacteria 2198
266 Ga0207706_10275037 3300025933 Bacteria 1469
267 Ga0207706_10469701 3300025933 Bacteria 1087
268 Ga0207686_10090069 3300025934 Bacteria 2023
269 Ga0207709_10001041 3300025935 Bacteria 20489
270 Ga0207691_10001351 3300025940 Bacteria 24456
271 Ga0207667_10001277 3300025949 Bacteria 31581
272 Ga0207667_10005450 3300025949 Bacteria 15509
273 Ga0207667_10051224 3300025949 Bacteria 4353
274 Ga0207667_10251289 3300025949 Bacteria 1809
275 Ga0207668_10153578 3300025972 Bacteria 1785
276 Ga0207668_10366736 3300025972 Bacteria 1208
277 Ga0207640_10009981 3300025981 Bacteria 5334
278 Ga0207658_10353571 3300025986 Bacteria 1280
279 Ga0207639_10013523 3300026041 Bacteria 5715
280 Ga0207639_10312141 3300026041 Bacteria 1393
281 Ga0207678_10113753 3300026067 Bacteria 2309
282 Ga0207678_10240017 3300026067 Bacteria 1552
283 Ga0207678_10308580 3300026067 Bacteria 1360
284 Ga0207678_10425972 3300026067 Bacteria 1151
285 Ga0207702_10000113 3300026078 Bacteria 94003
286 Ga0207702_10000474 3300026078 Bacteria 45055
287 Ga0207702_10113288 3300026078 Bacteria 2415
288 Ga0207641_10153524 3300026088 Bacteria 2087
289 Ga0207641_10321894 3300026088 Bacteria 1467
290 Ga0207648_10143860 3300026089 Bacteria 2103
291 Ga0207674_10015151 3300026116 Bacteria 8484
292 Ga0207674_10025973 3300026116 Bacteria 6232
293 Ga0207675_100008513 3300026118 Bacteria 9651
294 Ga0207698_10000276 3300026142 Bacteria 31255
295 Ga0207698_10003769 3300026142 Bacteria 9161
296 Ga0209371_1000007 3300027312 Bacteria 1050654
297 Ga0209371_1000016 3300027312 Bacteria 646301
298 Ga0209999_1007733 3300027543 Bacteria 1932
299 Ga0209982_1006567 3300027552 Bacteria 1694
300 Ga0209983_1004486 3300027665 Bacteria 2934
301 Ga0209971_1001850 3300027682 Bacteria 5179
302 Ga0209974_10002513 3300027876 Bacteria 6647
303 Ga0209974_10022211 3300027876 Bacteria 2102
304 Ga0268266_10166883 3300028379 Bacteria 1995
305 Ga0268266_10174276 3300028379 Bacteria 1954
306 Ga0268264_10106646 3300028381 Bacteria 2446
307 Ga0307515_10268053 3300028794 Bacteria 1433
308 Ga0268256_1000008 3300030500 Bacteria 1050654
309 Ga0268256_1000015 3300030500 Bacteria 646300
310 Ga0316177_1154661 3300030731 Bacteria 3036
311 Ga0316176_1196688 3300030732 Bacteria 2111
312 Ga0316183_1165678 3300030742 Bacteria 4311
313 Ga0316181_1116568 3300030744 Bacteria 2745
314 Ga0316182_1032687 3300030745 Bacteria 1599
315 Ga0316182_1045838 3300030745 Bacteria 1920
316 Ga0307513_10001515 3300031456 Bacteria 33354
317 Ga0307408_100103013 3300031548 Bacteria 2178
318 Ga0316579_10051224 3300031691 Bacteria 1931
319 Ga0316576_10101615 3300031727 Bacteria 2149
320 Ga0307516_10023137 3300031730 Bacteria 6375
321 Ga0316577_10262752 3300031733 Bacteria 976
322 Ga0307413_10020201 3300031824 Bacteria 3536
323 Ga0307413_10106519 3300031824 Bacteria 1866
324 Ga0307413_10108752 3300031824 Bacteria 1851
325 Ga0307413_10337769 3300031824 Bacteria 1157
326 Ga0307410_10022805 3300031852 Bacteria 3877
327 Ga0307410_10167656 3300031852 Bacteria 1652
328 Ga0307406_10097183 3300031901 Bacteria 1997
329 Ga0307406_10153855 3300031901 Bacteria 1644
330 Ga0307406_10241399 3300031901 Bacteria 1355
331 Ga0307412_10003464 3300031911 Bacteria 8772
332 Ga0307409_100302032 3300031995 Bacteria 1489
333 Ga0307416_100043968 3300032002 Bacteria 3503
334 Ga0307414_10007328 3300032004 Bacteria 6198
335 Ga0307414_10008024 3300032004 Bacteria 5968
336 Ga0307414_10047686 3300032004 Bacteria 2950
337 Ga0307414_10320160 3300032004 Bacteria 1319
338 Ga0307411_10014333 3300032005 Bacteria 4406
339 Ga0307411_10384424 3300032005 Bacteria 1155
340 Ga0373926_0171250 3300035083 Bacteria 831
341 Ga0373944_0032391 3300035089 Bacteria 1578
342 Ga0373923_0173399 3300035111 Bacteria 989
343 Ga0373945_0102135 3300035116 Bacteria 1123
344 Ga0373956_0085433 3300035119 Bacteria 1451
345 Ga0373943_0220229 3300035170 Bacteria 1057
346 Ga0316574_0066867 3300035398 Bacteria 2265
347 Ga0316582_0084641 3300036647 Bacteria 2076
348 Ga0395899_0021274 3300037312 Bacteria 4921
349 Ga0395899_0378782 3300037312 Bacteria 941
350 Ga0395900_0000175 3300037418 Bacteria 102937
351 Ga0395900_0031426 3300037418 Bacteria 5455
352 Ga0395900_0098626 3300037418 Bacteria 3002
353 Ga0395900_0274081 3300037418 Bacteria 1681
354 Ga0395898_0260825 3300037466 Bacteria 1653
355 Ga0395905_0000503 3300037471 Bacteria 53661
356 Ga0395905_0019782 3300037471 Bacteria 6382
357 Ga0395901_0001216 3300038443 Bacteria 27417
358 Ga0395901_0400550 3300038443 Bacteria 1410
359 Ga0237819_00151 3300038705 Bacteria 25521
360 Ga0237816_00052 3300039145 Bacteria 7620
361 Ga0439436_0008498 3300041404 Bacteria 3158
362 Ga0439436_0017952 3300041404 Bacteria 2117
363 Ga0439436_0023615 3300041404 Bacteria 1818
364 Ga0439436_0031231 3300041404 Bacteria 1546
365 Ga0439447_007420 3300041407 Bacteria 3482
366 Ga0439465_0001513 3300041413 Bacteria 7550
367 Ga0439465_0004624 3300041413 Bacteria 4442
368 Ga0451789_1189856 3300041443 Bacteria 1177
369 Ga0451791_0501601 3300041451 Bacteria 984
370 Ga0451791_0669101 3300041451 Bacteria 1999
371 Ga0451793_0382579 3300041452 Bacteria 1042
372 Ga0451800_1497069 3300041459 Bacteria 7935
373 Ga0451802_0225807 3300041460 Bacteria 4748
374 Ga0451802_1329035 3300041460 Bacteria 1426
375 Ga0451806_254328 3300041462 Bacteria 6559
376 Ga0451807_0519353 3300041486 Bacteria 7299
377 Ga0451807_2648432 3300041486 Bacteria 1298
378 Ga0451837_0224093 3300041494 Bacteria 2030
379 Ga0451837_1853913 3300041494 Bacteria 1568
380 Ga0451843_0405619 3300041509 Bacteria 2215
381 Ga0451843_0406729 3300041509 Bacteria 3050
382 Ga0451843_0502913 3300041509 Bacteria 1554
383 Ga0451853_0391743 3300041512 Bacteria 3098
384 Ga0451853_0518947 3300041512 Bacteria 1099
385 Ga0439432_015906 3300042006 Bacteria 2534
386 Ga0439449_0000018 3300042007 Bacteria 46636
387 Ga0439449_0003124 3300042007 Bacteria 6445
388 Ga0439449_0004679 3300042007 Bacteria 5287
389 Ga0439449_0011438 3300042007 Bacteria 3339
390 Ga0451577_0058752 3300042876 Bacteria 3429
391 Ga0495603_0134539 3300046455 Bacteria 1439
392 Ga0495638_0031329 3300046460 Bacteria 3419
393 Ga0495580_0030395 3300046472 Bacteria 3912
394 Ga0495582_0013614 3300046473 Bacteria 4478
395 Ga0495639_0038071 3300046475 Bacteria 2158
396 Ga0495606_0013802 3300046507 Bacteria 6351
397 Ga0495610_0007418 3300046512 Bacteria 7303
398 Ga0495628_0427513 3300046516 Bacteria 964
399 Ga0495630_0065527 3300046517 Bacteria 2730
400 Ga0495643_0003677 3300046522 Bacteria 11123
401 Ga0495663_0001399 3300046525 Bacteria 7615
402 Ga0495663_0003825 3300046525 Bacteria 4294
403 Ga0495663_0013691 3300046525 Bacteria 2268
404 Ga0495663_0026508 3300046525 Bacteria 1697
405 Ga0495665_0056512 3300046531 Bacteria 2072
406 Ga0495586_0077862 3300046535 Bacteria 1819
407 Ga0495621_0029869 3300046539 Bacteria 1860
408 Ga0495633_0027302 3300046558 Bacteria 2791
409 Ga0495656_0027624 3300046615 Bacteria 2268
410 Ga0495656_0029083 3300046615 Bacteria 2221
411 Ga0495668_0008487 3300046616 Bacteria 6402
412 Ga0495668_0022639 3300046616 Bacteria 3591
413 Ga0495625_0137231 3300046660 Bacteria 1652
414 Ga0495635_0225497 3300046663 Bacteria 1267
415 Ga0495647_0013704 3300046681 Bacteria 2814
416 Ga0495658_0004968 3300046683 Bacteria 6524
417 Ga0495671_0070657 3300046692 Bacteria 1715
418 Ga0495600_0147419 3300046809 Bacteria 1525
419 Ga0495636_0000567 3300047318 Bacteria 13609
420 Ga0495636_0018370 3300047318 Bacteria 2805
421 Ga0495636_0108742 3300047318 Bacteria 1218
422 Ga0495672_0000073 3300047320 Bacteria 179398
423 Ga0495672_0083386 3300047320 Bacteria 1776
424 Ga0495684_0318318 3300047471 Bacteria 1113
425 Ga0496100_0190319 3300048903 Bacteria 1489
426 Ga0496100_0364400 3300048903 Bacteria 1094
427 Ga0496104_0000011 3300048907 Bacteria 459358
428 Ga0496105_0000014 3300048908 Bacteria 220911
429 Ga0496106_0328530 3300048909 Bacteria 1228
430 Ga0496109_0031793 3300048912 Bacteria 4739
431 Ga0496110_0525235 3300048913 Bacteria 1076
432 Ga0496112_0054916 3300048915 Bacteria 3914
433 Ga0496113_0012572 3300048916 Bacteria 5694
434 Ga0496113_0024103 3300048916 Bacteria 4321
435 Ga0496116_0008602 3300048919 Bacteria 8833
436 Ga0496116_0121941 3300048919 Bacteria 1506
437 Ga0496117_0002324 3300048920 Bacteria 24332
438 Ga0496117_0003747 3300048920 Bacteria 17400
439 Ga0496117_0030699 3300048920 Bacteria 4118
440 Ga0496117_0083404 3300048920 Bacteria 2090
441 Ga0496118_0000344 3300048921 Bacteria 78989
442 Ga0496118_0003355 3300048921 Bacteria 20262
443 Ga0496118_0024226 3300048921 Bacteria 5247
444 Ga0496118_0061448 3300048921 Bacteria 2782
445 Ga0496119_0002556 3300048922 Bacteria 19810
446 Ga0496120_0002304 3300048923 Bacteria 19766
447 Ga0496121_0014643 3300048924 Bacteria 8294
448 Ga0496122_0005815 3300048925 Bacteria 14499
449 Ga0496122_0034822 3300048925 Bacteria 4111
450 Ga0496122_0036737 3300048925 Bacteria 3955
451 Ga0496122_0063232 3300048925 Bacteria 2702
452 Ga0496122_0124389 3300048925 Bacteria 1654
453 Ga0496122_0166372 3300048925 Bacteria 1336
454 Ga0496123_0004555 3300048926 Bacteria 14460
455 Ga0496123_0029269 3300048926 Bacteria 4059
456 Ga0496123_0074519 3300048926 Bacteria 2100
457 Ga0496123_0079332 3300048926 Bacteria 2006
458 Ga0496124_0000009 3300048927 Bacteria 734820
459 Ga0496124_0003468 3300048927 Bacteria 19254
460 Ga0496124_0004080 3300048927 Bacteria 17281
461 Ga0496124_0012072 3300048927 Bacteria 8574
462 Ga0496124_0040855 3300048927 Bacteria 4007
463 Ga0496124_0052040 3300048927 Bacteria 3481
464 Ga0496124_0090072 3300048927 Bacteria 2503
465 Ga0496125_0006523 3300048928 Bacteria 12582
466 Ga0496125_0014622 3300048928 Bacteria 7632
467 Ga0496125_0044590 3300048928 Bacteria 3747
468 Ga0496125_0056647 3300048928 Bacteria 3181
469 Ga0496126_0007989 3300048929 Bacteria 11486
470 Ga0496126_0026779 3300048929 Bacteria 5521
471 Ga0496126_0144782 3300048929 Bacteria 2042
472 Ga0501290_000770 3300049513 Bacteria 4751
473 Ga0501031_0010110 3300049568 Bacteria 6148
474 Ga0501031_0028463 3300049568 Bacteria 3642
475 Ga0501031_0142997 3300049568 Bacteria 1563
476 Ga0501033_0001489 3300049570 Bacteria 20740
477 Ga0501033_0002438 3300049570 Bacteria 15799
478 Ga0501033_0007341 3300049570 Bacteria 8586
479 Ga0501033_0011027 3300049570 Bacteria 6921
480 Ga0501034_0000122 3300049571 Bacteria 144085
481 Ga0501034_0001021 3300049571 Bacteria 40111
482 Ga0501034_0037891 3300049571 Bacteria 4883
483 Ga0501034_0054343 3300049571 Bacteria 4032
484 Ga0501034_0510628 3300049571 Bacteria 1115
485 Ga0501036_0023761 3300049572 Bacteria 5164
486 Ga0501036_0118547 3300049572 Bacteria 2235
487 Ga0501037_0002420 3300049573 Bacteria 13491
488 Ga0501038_0004044 3300049574 Bacteria 13629
489 Ga0501038_0021112 3300049574 Bacteria 5849
490 Ga0501038_0120182 3300049574 Bacteria 2168
491 Ga0501038_0215908 3300049574 Bacteria 1532
492 Ga0501039_0003853 3300049575 Bacteria 11261
493 Ga0501039_0325279 3300049575 Bacteria 1208
494 Ga0501040_0001206 3300049576 Bacteria 16460
495 Ga0501041_0001968 3300049577 Bacteria 11551
496 Ga0501042_0000931 3300049578 Bacteria 16497
497 Ga0501043_0002449 3300049579 Bacteria 15701
498 Ga0501043_0021394 3300049579 Bacteria 5070
499 Ga0501043_0037824 3300049579 Bacteria 3796
500 Ga0501043_0099869 3300049579 Bacteria 2281
501 Ga0501046_0011112 3300049580 Bacteria 7710
502 Ga0501046_0133120 3300049580 Bacteria 1884
503 Ga0501047_0059411 3300049581 Bacteria 3691
504 Ga0501047_0094597 3300049581 Bacteria 2867
505 Ga0501048_0011120 3300049582 Bacteria 6710
506 Ga0501068_0000860 3300049584 Bacteria 15814
507 Ga0501069_0090472 3300049585 Bacteria 1730
508 Ga0501070_0003058 3300049586 Bacteria 14565
509 Ga0501070_0068580 3300049586 Bacteria 2936
510 Ga0501070_0077087 3300049586 Bacteria 2759
511 Ga0501071_0006996 3300049587 Bacteria 7366
512 Ga0501072_0001665 3300049588 Bacteria 16559
513 Ga0501073_0004387 3300049589 Bacteria 10598
514 Ga0501074_0001678 3300049590 Bacteria 15070
515 Ga0501074_0072784 3300049590 Bacteria 2468
516 Ga0501074_0104354 3300049590 Bacteria 2029
517 Ga0501075_0000858 3300049591 Bacteria 19148
518 Ga0501076_0002159 3300049592 Bacteria 13483
519 Ga0501076_0031032 3300049592 Bacteria 4165
520 Ga0501077_0004578 3300049593 Bacteria 8401
521 Ga0501249_008222 3300049679 Bacteria 2163
522 Ga0501259_001711 3300049688 Bacteria 3647
523 Ga0501225_0013529 3300049705 Bacteria 2283
524 Ga0501079_0002189 3300049741 Bacteria 14087
525 Ga0501080_0009101 3300049742 Bacteria 9039
526 Ga0501081_0000359 3300049743 Bacteria 24723
527 Ga0501081_0352406 3300049743 Unclassified 1085
528 Ga0501035_0003215 3300049822 Bacteria 15660
529 Ga0501035_0003472 3300049822 Bacteria 15084
530 Ga0501035_0006572 3300049822 Bacteria 10894
531 Ga0501035_0035887 3300049822 Bacteria 4497
532 Ga0501035_0054814 3300049822 Bacteria 3561
533 Ga0501035_0057075 3300049822 Bacteria 3481
534 Ga0501044_0027026 3300049823 Bacteria 6071
535 Ga0501044_0165761 3300049823 Bacteria 2184
536 Ga0501044_0506485 3300049823 Bacteria 1108
537 Ga0501044_0519466 3300049823 Bacteria 1090
538 Ga0501045_0031495 3300049824 Bacteria 3841
539 nmdc:mga00v17_202_c2 3300050491 Bacteria 31082
540 nmdc:mga06r32_252131_c1 3300050510 Bacteria 1752
541 Ga0500610_0000087 3300053079 Bacteria 27865
542 Ga0500634_0000048 3300053161 Bacteria 55497
543 Ga0501084_0007709 3300054114 Bacteria 8869
544 Ga0501082_0000368 3300060353 Bacteria 39768
545 Ga0530510_0000025 3300061734 Bacteria 67946

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027543 Ga0209999_1007733 Ga0209999_10077333 236
2 3300027552 Ga0209982_1006567 Ga0209982_10065671 236
3 3300027665 Ga0209983_1004486 Ga0209983_10044861 236
4 3300027682 Ga0209971_1001850 Ga0209971_10018501 236
5 3300027876 Ga0209974_10002513 Ga0209974_100025132 236
6 3300035111 Ga0373923_0173399 Ga0373923_0173399_232_969 240
7 3300025921 Ga0207652_10001445 Ga0207652_1000144521 245
8 3300048925 Ga0496122_0124389 Ga0496122_0124389_871_1611 246
9 3300032004 Ga0307414_10320160 Ga0307414_103201601 251
10 3300005347 Ga0070668_100003985 Ga0070668_1000039855 259
11 3300025972 Ga0207668_10153578 Ga0207668_101535782 259
12 3300035083 Ga0373926_0171250 Ga0373926_0171250_22_816 259
13 3300046516 Ga0495628_0427513 Ga0495628_0427513_22_816 259
14 3300041452 Ga0451793_0382579 Ga0451793_0382579_208_1005 265
15 3300049568 Ga0501031_0028463 Ga0501031_0028463_1744_2586 269
16 3300049572 Ga0501036_0118547 Ga0501036_0118547_570_1412 269
17 3300049581 Ga0501047_0094597 Ga0501047_0094597_1002_1844 269
18 3300049586 Ga0501070_0068580 Ga0501070_0068580_320_1162 269
19 3300049822 Ga0501035_0057075 Ga0501035_0057075_2582_3424 269
20 3300050510 nmdc:mga06r32_252131_c1 nmdc:mga06r32_252131_c1_862_1734 271
21 3300049589 Ga0501073_0004387 Ga0501073_0004387_6378_7220 272
22 3300006948 Ga0099826_10113365 Ga0099826_101133652 274
23 3300048920 Ga0496117_0002324 Ga0496117_0002324_2732_3574 274
24 3300048921 Ga0496118_0000344 Ga0496118_0000344_20671_21513 274
25 3300049571 Ga0501034_0000122 Ga0501034_0000122_128727_129572 274
26 3300049571 Ga0501034_0001021 Ga0501034_0001021_9709_10560 274
27 iso_pu_bacteria 2537561836 2538832404 274
28 iso_pu_bacteria 2643221562 2643830425 274
29 iso_pu_bacteria 2895395659 2895398819 274
30 iso_pu_bacteria 2939611941 2939612383 274
31 3300049513 Ga0501290_000770 Ga0501290_000770_1438_2334 275
32 iso_pu_bacteria 8002869464 8002872550 275
33 3300041494 Ga0451837_0224093 Ga0451837_0224093_972_1820 276
34 3300041509 Ga0451843_0502913 Ga0451843_0502913_119_967 276
35 iso_pu_bacteria 2524614729 2525556930 276
36 iso_pu_bacteria 2547132130 2547500033 276
37 iso_pu_bacteria 2547132130 2547500757 276
38 iso_pu_bacteria 2571042365 2572253551 276
39 iso_pu_bacteria 2576861471 2578457574 276
40 iso_pu_bacteria 2627854209 2630648526 276
41 iso_pu_bacteria 2643221579 2643908740 276
42 iso_pu_bacteria 2643221581 2643916168 276
43 iso_pu_bacteria 2643221695 2644528887 276
44 iso_pu_bacteria 2747842428 2747948084 276
45 iso_pu_bacteria 2765235840 2765579908 276
46 iso_pu_bacteria 2816332141 2816519049 276
47 iso_pu_bacteria 2842391507 2842394866 276
48 iso_pu_bacteria 2842757796 2842760605 276
49 iso_pu_bacteria 2842780639 2842781123 276
50 iso_pu_bacteria 2852649853 2852649995 276
51 iso_pu_bacteria 2857442823 2857444772 276
52 iso_pu_bacteria 2874220319 2874222592 276
53 iso_pu_bacteria 2919089067 2919090533 276
54 iso_pu_bacteria 2919134579 2919137538 276
55 iso_pu_bacteria 2923516293 2923517950 276
56 iso_pu_bacteria 2928496128 2928498368 276
57 iso_pu_bacteria 2931380184 2931383951 276
58 iso_pu_bacteria 2937610967 2937614488 276
59 iso_pu_bacteria 2939589442 2939591134 276
60 iso_pu_bacteria 2939622612 2939624629 276
61 iso_pu_bacteria 2939626828 2939628297 276
62 iso_pu_bacteria 2941475908 2941476660 276
63 iso_pu_bacteria 2961047084 2961049357 276
64 iso_pu_bacteria 2961064222 2961065955 276
65 iso_pu_bacteria 2974307012 2974308200 276
66 iso_pu_bacteria 2977247770 2977248952 276
67 iso_pu_bacteria 2984514374 2984516591 276
68 iso_pu_bacteria 2987605356 2987607389 276
69 3300005435 Ga0070714_100010639 Ga0070714_1000106394 277
70 3300005437 Ga0070710_10081272 Ga0070710_100812722 277
71 3300013104 Ga0157370_10083839 Ga0157370_100838392 277
72 3300014497 Ga0182008_10031525 Ga0182008_100315253 277
73 3300015261 Ga0182006_1019604 Ga0182006_10196044 277
74 3300015262 Ga0182007_10011339 Ga0182007_100113394 277
75 3300025898 Ga0207692_10089366 Ga0207692_100893662 277
76 3300025929 Ga0207664_10000884 Ga0207664_1000088418 277
77 iso_pu_bacteria 2643221559 2643815283 277
78 iso_pu_bacteria 2643221573 2643879322 277
79 iso_pu_bacteria 2643221586 2643939960 277
80 iso_pu_bacteria 2643221593 2643976181 277
81 iso_pu_bacteria 2643221612 2644077016 277
82 iso_pu_bacteria 2643221720 2644660621 277
83 iso_pu_bacteria 2643221727 2644695330 277
84 iso_pu_bacteria 2643221728 2644697982 277
85 iso_pu_bacteria 2747842501 2748018304 277
86 iso_pu_bacteria 2818991457 2819660093 277
87 iso_pu_bacteria 2852684882 2852685091 277
88 iso_pu_bacteria 2894414249 2894415907 277
89 iso_pu_bacteria 2895498888 2895502602 277
90 iso_pu_bacteria 2895511927 2895514068 277
91 iso_pu_bacteria 2895522137 2895524453 277
92 iso_pu_bacteria 2895525241 2895526550 277
93 iso_pu_bacteria 2919130084 2919130631 277
94 iso_pu_bacteria 2919513703 2919516134 277
95 iso_pu_bacteria 2919675420 2919677967 277
96 iso_pu_bacteria 2929195423 2929198366 277
97 iso_pu_bacteria 2941489479 2941491151 277
98 iso_pu_bacteria 2995948881 2995952082 277
99 iso_pu_bacteria 8003014200 8003014590 277
100 3300002737 JGI25162J39368_1001808 JGI25162J39368_10018082 278
101 3300002737 JGI25162J39368_1001810 JGI25162J39368_10018109 278
102 3300002741 JGI25157J39369_1000764 JGI25157J39369_100076415 278
103 3300002772 JGI25164J39214_1000891 JGI25164J39214_10008912 278
104 3300002772 JGI25164J39214_1001247 JGI25164J39214_10012475 278
105 3300003214 JGI25165J46597_1001382 JGI25165J46597_10013829 278
106 3300003214 JGI25165J46597_1001877 JGI25165J46597_10018777 278
107 3300005435 Ga0070714_100000309 Ga0070714_10000030917 278
108 3300005436 Ga0070713_100007035 Ga0070713_1000070355 278
109 3300005458 Ga0070681_10562173 Ga0070681_105621731 278
110 3300005530 Ga0070679_100016047 Ga0070679_1000160475 278
111 3300005546 Ga0070696_100002455 Ga0070696_1000024559 278
112 3300009174 Ga0105241_10381857 Ga0105241_103818571 278
113 3300013308 Ga0157375_10000256 Ga0157375_1000025618 278
114 3300014969 Ga0157376_10001188 Ga0157376_100011888 278
115 3300015262 Ga0182007_10047471 Ga0182007_100474712 278
116 3300025231 Ga0207427_100115 Ga0207427_100115101 278
117 3300025231 Ga0207427_100130 Ga0207427_10013094 278
118 3300025233 Ga0209437_100020 Ga0209437_100020237 278
119 3300025233 Ga0209437_100079 Ga0209437_100079173 278
120 3300025250 Ga0209026_1000051 Ga0209026_1000051100 278
121 3300025261 Ga0209233_1000020 Ga0209233_1000020388 278
122 3300025261 Ga0209233_1000121 Ga0209233_1000121130 278
123 3300025297 Ga0209758_1024714 Ga0209758_10247143 278
124 3300025904 Ga0207647_10065285 Ga0207647_100652852 278
125 3300025921 Ga0207652_10040233 Ga0207652_100402335 278
126 3300025928 Ga0207700_10001685 Ga0207700_100016859 278
127 3300025929 Ga0207664_10000300 Ga0207664_1000030027 278
128 3300025929 Ga0207664_10469911 Ga0207664_104699111 278
129 3300025933 Ga0207706_10275037 Ga0207706_102750372 278
130 3300025934 Ga0207686_10090069 Ga0207686_100900692 278
131 3300026078 Ga0207702_10113288 Ga0207702_101132883 278
132 3300035089 Ga0373944_0032391 Ga0373944_0032391_193_1044 278
133 3300035119 Ga0373956_0085433 Ga0373956_0085433_504_1355 278
134 3300035170 Ga0373943_0220229 Ga0373943_0220229_55_906 278
135 3300038443 Ga0395901_0001216 Ga0395901_0001216_23934_24773 278
136 3300046455 Ga0495603_0134539 Ga0495603_0134539_165_1016 278
137 3300046472 Ga0495580_0030395 Ga0495580_0030395_2307_3158 278
138 3300046473 Ga0495582_0013614 Ga0495582_0013614_2982_3833 278
139 3300046475 Ga0495639_0038071 Ga0495639_0038071_318_1169 278
140 3300046517 Ga0495630_0065527 Ga0495630_0065527_1756_2607 278
141 3300046531 Ga0495665_0056512 Ga0495665_0056512_1021_1872 278
142 3300046535 Ga0495586_0077862 Ga0495586_0077862_301_1152 278
143 3300046663 Ga0495635_0225497 Ga0495635_0225497_194_1045 278
144 3300046681 Ga0495647_0013704 Ga0495647_0013704_1890_2741 278
145 3300046683 Ga0495658_0004968 Ga0495658_0004968_3931_4782 278
146 3300046809 Ga0495600_0147419 Ga0495600_0147419_359_1210 278
147 3300047471 Ga0495684_0318318 Ga0495684_0318318_64_915 278
148 3300048907 Ga0496104_0000011 Ga0496104_0000011_64630_65481 278
149 3300048908 Ga0496105_0000014 Ga0496105_0000014_64657_65508 278
150 3300049568 Ga0501031_0142997 Ga0501031_0142997_35_880 278
151 3300049570 Ga0501033_0007341 Ga0501033_0007341_4227_5072 278
152 3300049574 Ga0501038_0215908 Ga0501038_0215908_20_865 278
153 3300049575 Ga0501039_0325279 Ga0501039_0325279_179_1024 278
154 3300049579 Ga0501043_0002449 Ga0501043_0002449_13764_14609 278
155 3300049580 Ga0501046_0133120 Ga0501046_0133120_866_1711 278
156 3300049822 Ga0501035_0003215 Ga0501035_0003215_13785_14630 278
157 3300001915 JGI24741J21665_1001939 JGI24741J21665_10019391 279
158 3300001979 JGI24740J21852_10002530 JGI24740J21852_1000253010 279
159 3300005329 Ga0070683_100002993 Ga0070683_10000299314 279
160 3300005336 Ga0070680_100035853 Ga0070680_1000358532 279
161 3300005345 Ga0070692_10001511 Ga0070692_1000151110 279
162 3300005455 Ga0070663_100007817 Ga0070663_1000078172 279
163 3300005458 Ga0070681_10007131 Ga0070681_100071312 279
164 3300005530 Ga0070679_100000372 Ga0070679_10000037213 279
165 3300005530 Ga0070679_100005054 Ga0070679_10000505413 279
166 3300005535 Ga0070684_100007023 Ga0070684_10000702312 279
167 3300005546 Ga0070696_100016626 Ga0070696_1000166267 279
168 3300005563 Ga0068855_100011338 Ga0068855_1000113383 279
169 3300005563 Ga0068855_100027527 Ga0068855_1000275271 279
170 3300005563 Ga0068855_100559354 Ga0068855_1005593541 279
171 3300005578 Ga0068854_100071896 Ga0068854_1000718962 279
172 3300009093 Ga0105240_10028762 Ga0105240_1002876210 279
173 3300009093 Ga0105240_10092734 Ga0105240_100927344 279
174 3300009551 Ga0105238_10047996 Ga0105238_100479963 279
175 3300013100 Ga0157373_10059372 Ga0157373_100593723 279
176 3300013102 Ga0157371_10012336 Ga0157371_100123362 279
177 3300013104 Ga0157370_10008833 Ga0157370_100088335 279
178 3300013104 Ga0157370_10117649 Ga0157370_101176494 279
179 3300013105 Ga0157369_10017641 Ga0157369_100176412 279
180 3300013105 Ga0157369_10399732 Ga0157369_103997322 279
181 3300013306 Ga0163162_10000007 Ga0163162_1000000720 279
182 3300013307 Ga0157372_10003801 Ga0157372_100038012 279
183 3300013307 Ga0157372_10015387 Ga0157372_1001538711 279
184 3300020081 Ga0206354_10831098 Ga0206354_1083109810 279
185 3300020610 Ga0154015_1062321 Ga0154015_10623213 279
186 3300025909 Ga0207705_10000968 Ga0207705_1000096811 279
187 3300025912 Ga0207707_10000216 Ga0207707_1000021650 279
188 3300025912 Ga0207707_10002882 Ga0207707_1000288215 279
189 3300025917 Ga0207660_10009145 Ga0207660_100091456 279
190 3300025917 Ga0207660_10014673 Ga0207660_100146734 279
191 3300025921 Ga0207652_10001658 Ga0207652_1000165810 279
192 3300025921 Ga0207652_10004611 Ga0207652_100046115 279
193 3300025924 Ga0207694_10093609 Ga0207694_100936092 279
194 3300025949 Ga0207667_10001277 Ga0207667_1000127714 279
195 3300025949 Ga0207667_10051224 Ga0207667_100512244 279
196 3300025949 Ga0207667_10251289 Ga0207667_102512892 279
197 3300025981 Ga0207640_10009981 Ga0207640_100099815 279
198 3300026078 Ga0207702_10000474 Ga0207702_1000047425 279
199 3300026142 Ga0207698_10000276 Ga0207698_1000027625 279
200 3300032002 Ga0307416_100043968 Ga0307416_1000439683 279
201 3300037418 Ga0395900_0000175 Ga0395900_0000175_2365_3204 279
202 3300048903 Ga0496100_0364400 Ga0496100_0364400_183_1055 279
203 3300049571 Ga0501034_0510628 Ga0501034_0510628_64_954 279
204 3300049574 Ga0501038_0120182 Ga0501038_0120182_442_1332 279
205 3300049581 Ga0501047_0059411 Ga0501047_0059411_88_978 279
206 3300049585 Ga0501069_0090472 Ga0501069_0090472_694_1584 279
207 3300049586 Ga0501070_0003058 Ga0501070_0003058_6383_7273 279
208 3300049586 Ga0501070_0077087 Ga0501070_0077087_1408_2325 279
209 3300049590 Ga0501074_0001678 Ga0501074_0001678_8596_9486 279
210 3300049590 Ga0501074_0072784 Ga0501074_0072784_1015_1905 279
211 3300049590 Ga0501074_0104354 Ga0501074_0104354_817_1734 279
212 3300049743 Ga0501081_0352406 Ga0501081_0352406_109_969 279
213 3300049822 Ga0501035_0006572 Ga0501035_0006572_6982_7872 279
214 3300049823 Ga0501044_0506485 Ga0501044_0506485_71_910 279
215 3300049823 Ga0501044_0519466 Ga0501044_0519466_168_1058 279
216 3300003771 Ga0055526_1000486 Ga0055526_100048622 280
217 3300003775 Ga0055524_1036326 Ga0055524_10363262 280
218 3300003781 Ga0055536_1003210 Ga0055536_10032102 280
219 3300003781 Ga0055536_1010253 Ga0055536_10102533 280
220 3300003781 Ga0055536_1010288 Ga0055536_10102883 280
221 3300003784 Ga0055534_1000034 Ga0055534_100003416 280
222 3300003790 Ga0055528_1000671 Ga0055528_100067116 280
223 3300003791 Ga0055530_10003879 Ga0055530_100038797 280
224 3300003791 Ga0055530_10003891 Ga0055530_100038912 280
225 3300003794 Ga0055531_10001755 Ga0055531_100017558 280
226 3300003794 Ga0055531_10013574 Ga0055531_100135743 280
227 3300003794 Ga0055531_10014194 Ga0055531_100141943 280
228 3300003794 Ga0055531_10015882 Ga0055531_100158823 280
229 3300003856 Ga0058692_1000011 Ga0058692_100001121 280
230 3300005293 Ga0065715_10119645 Ga0065715_101196452 280
231 3300005333 Ga0070677_10144016 Ga0070677_101440161 280
232 3300005336 Ga0070680_100462075 Ga0070680_1004620752 280
233 3300005337 Ga0070682_100002010 Ga0070682_1000020104 280
234 3300005339 Ga0070660_100062724 Ga0070660_1000627242 280
235 3300005444 Ga0070694_100016102 Ga0070694_1000161024 280
236 3300005458 Ga0070681_10000029 Ga0070681_1000002937 280
237 3300005458 Ga0070681_10011742 Ga0070681_100117426 280
238 3300005458 Ga0070681_10136745 Ga0070681_101367453 280
239 3300005458 Ga0070681_10422246 Ga0070681_104222462 280
240 3300005458 Ga0070681_10652263 Ga0070681_106522631 280
241 3300005539 Ga0068853_100000560 Ga0068853_1000005606 280
242 3300005539 Ga0068853_100003691 Ga0068853_10000369110 280
243 3300005539 Ga0068853_100164047 Ga0068853_1001640471 280
244 3300005546 Ga0070696_100012046 Ga0070696_1000120464 280
245 3300005547 Ga0070693_100012474 Ga0070693_1000124743 280
246 3300005547 Ga0070693_100016710 Ga0070693_1000167103 280
247 3300005614 Ga0068856_100000234 Ga0068856_10000023432 280
248 3300005616 Ga0068852_100005378 Ga0068852_1000053782 280
249 3300005617 Ga0068859_100047374 Ga0068859_1000473744 280
250 3300005618 Ga0068864_100217571 Ga0068864_1002175712 280
251 3300005841 Ga0068863_100361920 Ga0068863_1003619202 280
252 3300006038 Ga0075365_10060969 Ga0075365_100609692 280
253 3300006051 Ga0075364_10000020 Ga0075364_100000208 280
254 3300006186 Ga0075369_10055806 Ga0075369_100558062 280
255 3300006931 Ga0097620_100047374 Ga0097620_1000473743 280
256 3300009011 Ga0105251_10006353 Ga0105251_100063533 280
257 3300009036 Ga0105244_10038939 Ga0105244_100389392 280
258 3300009098 Ga0105245_10218788 Ga0105245_102187882 280
259 3300009551 Ga0105238_10007073 Ga0105238_100070733 280
260 3300009551 Ga0105238_10029020 Ga0105238_100290202 280
261 3300009551 Ga0105238_10039845 Ga0105238_100398454 280
262 3300010375 Ga0105239_10195593 Ga0105239_101955933 280
263 3300013100 Ga0157373_10008924 Ga0157373_100089246 280
264 3300013100 Ga0157373_10027422 Ga0157373_100274222 280
265 3300013102 Ga0157371_10000154 Ga0157371_1000015423 280
266 3300013102 Ga0157371_10002651 Ga0157371_1000265119 280
267 3300013102 Ga0157371_10070183 Ga0157371_100701832 280
268 3300013102 Ga0157371_10338334 Ga0157371_103383342 280
269 3300013104 Ga0157370_10004589 Ga0157370_1000458913 280
270 3300013104 Ga0157370_10012597 Ga0157370_100125976 280
271 3300013104 Ga0157370_10013540 Ga0157370_100135407 280
272 3300013104 Ga0157370_10052040 Ga0157370_100520403 280
273 3300013105 Ga0157369_10236378 Ga0157369_102363781 280
274 3300013307 Ga0157372_10149646 Ga0157372_101496462 280
275 3300013307 Ga0157372_10235558 Ga0157372_102355583 280
276 3300013307 Ga0157372_10486300 Ga0157372_104863002 280
277 3300013308 Ga0157375_10301943 Ga0157375_103019432 280
278 3300014497 Ga0182008_10000142 Ga0182008_1000014232 280
279 3300014497 Ga0182008_10008964 Ga0182008_100089642 280
280 3300015261 Ga0182006_1013905 Ga0182006_10139053 280
281 3300015261 Ga0182006_1031233 Ga0182006_10312332 280
282 3300015262 Ga0182007_10000287 Ga0182007_1000028726 280
283 3300017792 Ga0163161_10001348 Ga0163161_100013487 280
284 3300017792 Ga0163161_10021106 Ga0163161_100211064 280
285 3300025245 Ga0207425_1019940 Ga0207425_10199402 280
286 3300025263 Ga0209565_1000022 Ga0209565_1000022324 280
287 3300025273 Ga0209673_1000104 Ga0209673_100010471 280
288 3300025291 Ga0209675_1000048 Ga0209675_1000048173 280
289 3300025292 Ga0209676_1000024 Ga0209676_1000024286 280
290 3300025292 Ga0209676_1000091 Ga0209676_1000091163 280
291 3300025292 Ga0209676_1000117 Ga0209676_1000117143 280
292 3300025294 Ga0209025_1011986 Ga0209025_10119862 280
293 3300025295 Ga0209564_1000213 Ga0209564_100021349 280
294 3300025298 Ga0209050_1001640 Ga0209050_10016402 280
295 3300025298 Ga0209050_1005300 Ga0209050_10053007 280
296 3300025299 Ga0209256_1004506 Ga0209256_10045068 280
297 3300025299 Ga0209256_1020821 Ga0209256_10208212 280
298 3300025303 Ga0209051_1006048 Ga0209051_10060484 280
299 3300025304 Ga0209257_1000062 Ga0209257_100006244 280
300 3300025304 Ga0209257_1000217 Ga0209257_100021745 280
301 3300025304 Ga0209257_1005770 Ga0209257_10057707 280
302 3300025304 Ga0209257_1013027 Ga0209257_10130272 280
303 3300025304 Ga0209257_1014540 Ga0209257_10145403 280
304 3300025735 Ga0207713_1016794 Ga0207713_10167943 280
305 3300025911 Ga0207654_10073192 Ga0207654_100731922 280
306 3300025912 Ga0207707_10000285 Ga0207707_100002856 280
307 3300025912 Ga0207707_10006803 Ga0207707_100068032 280
308 3300025917 Ga0207660_10335654 Ga0207660_103356541 280
309 3300025921 Ga0207652_10028948 Ga0207652_100289483 280
310 3300025924 Ga0207694_10065310 Ga0207694_100653103 280
311 3300025924 Ga0207694_10074612 Ga0207694_100746123 280
312 3300025924 Ga0207694_10124398 Ga0207694_101243982 280
313 3300025927 Ga0207687_10184891 Ga0207687_101848912 280
314 3300025932 Ga0207690_10013740 Ga0207690_100137402 280
315 3300025932 Ga0207690_10086988 Ga0207690_100869883 280
316 3300025935 Ga0207709_10001041 Ga0207709_100010417 280
317 3300025949 Ga0207667_10005450 Ga0207667_1000545013 280
318 3300025972 Ga0207668_10366736 Ga0207668_103667362 280
319 3300026041 Ga0207639_10312141 Ga0207639_103121412 280
320 3300026067 Ga0207678_10113753 Ga0207678_101137531 280
321 3300026067 Ga0207678_10240017 Ga0207678_102400172 280
322 3300026078 Ga0207702_10000113 Ga0207702_100001139 280
323 3300026088 Ga0207641_10153524 Ga0207641_101535243 280
324 3300026116 Ga0207674_10015151 Ga0207674_100151516 280
325 3300026116 Ga0207674_10025973 Ga0207674_100259736 280
326 3300026142 Ga0207698_10003769 Ga0207698_1000376910 280
327 3300027312 Ga0209371_1000007 Ga0209371_1000007416 280
328 3300027876 Ga0209974_10022211 Ga0209974_100222113 280
329 3300028379 Ga0268266_10174276 Ga0268266_101742761 280
330 3300030500 Ga0268256_1000008 Ga0268256_1000008534 280
331 3300030731 Ga0316177_1154661 Ga0316177_11546612 280
332 3300030732 Ga0316176_1196688 Ga0316176_11966882 280
333 3300030742 Ga0316183_1165678 Ga0316183_11656782 280
334 3300030744 Ga0316181_1116568 Ga0316181_11165682 280
335 3300030745 Ga0316182_1032687 Ga0316182_10326872 280
336 3300030745 Ga0316182_1045838 Ga0316182_10458381 280
337 3300031548 Ga0307408_100103013 Ga0307408_1001030132 280
338 3300031824 Ga0307413_10106519 Ga0307413_101065192 280
339 3300031824 Ga0307413_10108752 Ga0307413_101087521 280
340 3300031824 Ga0307413_10337769 Ga0307413_103377691 280
341 3300031852 Ga0307410_10167656 Ga0307410_101676562 280
342 3300031911 Ga0307412_10003464 Ga0307412_100034643 280
343 3300032004 Ga0307414_10008024 Ga0307414_100080243 280
344 3300032004 Ga0307414_10047686 Ga0307414_100476864 280
345 3300032005 Ga0307411_10384424 Ga0307411_103844241 280
346 3300037418 Ga0395900_0031426 Ga0395900_0031426_3719_4561 280
347 3300041404 Ga0439436_0023615 Ga0439436_0023615_844_1716 280
348 3300041404 Ga0439436_0031231 Ga0439436_0031231_600_1442 280
349 3300041451 Ga0451791_0501601 Ga0451791_0501601_65_907 280
350 3300041460 Ga0451802_1329035 Ga0451802_1329035_512_1354 280
351 3300041494 Ga0451837_1853913 Ga0451837_1853913_455_1297 280
352 3300041509 Ga0451843_0405619 Ga0451843_0405619_108_956 280
353 3300042006 Ga0439432_015906 Ga0439432_015906_436_1308 280
354 3300042007 Ga0439449_0003124 Ga0439449_0003124_4327_5199 280
355 3300046460 Ga0495638_0031329 Ga0495638_0031329_1330_2172 280
356 3300046507 Ga0495606_0013802 Ga0495606_0013802_431_1273 280
357 3300046512 Ga0495610_0007418 Ga0495610_0007418_1358_2200 280
358 3300046522 Ga0495643_0003677 Ga0495643_0003677_8826_9668 280
359 3300046525 Ga0495663_0003825 Ga0495663_0003825_1150_1992 280
360 3300046525 Ga0495663_0013691 Ga0495663_0013691_1223_2065 280
361 3300046539 Ga0495621_0029869 Ga0495621_0029869_422_1291 280
362 3300046558 Ga0495633_0027302 Ga0495633_0027302_664_1506 280
363 3300046616 Ga0495668_0022639 Ga0495668_0022639_2453_3322 280
364 3300046660 Ga0495625_0137231 Ga0495625_0137231_320_1162 280
365 3300047318 Ga0495636_0000567 Ga0495636_0000567_1375_2247 280
366 3300047318 Ga0495636_0018370 Ga0495636_0018370_591_1463 280
367 3300047320 Ga0495672_0000073 Ga0495672_0000073_149180_150022 280
368 3300047320 Ga0495672_0083386 Ga0495672_0083386_731_1576 280
369 3300048919 Ga0496116_0008602 Ga0496116_0008602_6554_7396 280
370 3300048919 Ga0496116_0121941 Ga0496116_0121941_227_1069 280
371 3300048920 Ga0496117_0003747 Ga0496117_0003747_10793_11635 280
372 3300048920 Ga0496117_0030699 Ga0496117_0030699_952_1794 280
373 3300048921 Ga0496118_0003355 Ga0496118_0003355_1314_2156 280
374 3300048921 Ga0496118_0024226 Ga0496118_0024226_2788_3630 280
375 3300048922 Ga0496119_0002556 Ga0496119_0002556_17960_18802 280
376 3300048923 Ga0496120_0002304 Ga0496120_0002304_17962_18804 280
377 3300048924 Ga0496121_0014643 Ga0496121_0014643_6121_6963 280
378 3300048925 Ga0496122_0005815 Ga0496122_0005815_3325_4167 280
379 3300048925 Ga0496122_0036737 Ga0496122_0036737_2764_3606 280
380 3300048925 Ga0496122_0063232 Ga0496122_0063232_158_1000 280
381 3300048925 Ga0496122_0166372 Ga0496122_0166372_158_1000 280
382 3300048926 Ga0496123_0004555 Ga0496123_0004555_3328_4170 280
383 3300048926 Ga0496123_0074519 Ga0496123_0074519_1127_1969 280
384 3300048926 Ga0496123_0079332 Ga0496123_0079332_954_1796 280
385 3300048927 Ga0496124_0000009 Ga0496124_0000009_143384_144226 280
386 3300048927 Ga0496124_0003468 Ga0496124_0003468_3562_4404 280
387 3300048927 Ga0496124_0004080 Ga0496124_0004080_12043_12885 280
388 3300048927 Ga0496124_0012072 Ga0496124_0012072_5858_6700 280
389 3300048927 Ga0496124_0040855 Ga0496124_0040855_690_1532 280
390 3300048927 Ga0496124_0052040 Ga0496124_0052040_1101_1943 280
391 3300048927 Ga0496124_0090072 Ga0496124_0090072_551_1393 280
392 3300048928 Ga0496125_0006523 Ga0496125_0006523_1347_2189 280
393 3300048928 Ga0496125_0014622 Ga0496125_0014622_858_1700 280
394 3300048928 Ga0496125_0044590 Ga0496125_0044590_2199_3041 280
395 3300048928 Ga0496125_0056647 Ga0496125_0056647_707_1549 280
396 3300048929 Ga0496126_0007989 Ga0496126_0007989_9293_10135 280
397 3300049568 Ga0501031_0010110 Ga0501031_0010110_3185_4027 280
398 3300049570 Ga0501033_0001489 Ga0501033_0001489_4058_4906 280
399 3300049570 Ga0501033_0002438 Ga0501033_0002438_1231_2073 280
400 3300049573 Ga0501037_0002420 Ga0501037_0002420_2962_3804 280
401 3300049574 Ga0501038_0021112 Ga0501038_0021112_1275_2117 280
402 3300049822 Ga0501035_0003472 Ga0501035_0003472_11126_11968 280
403 3300049822 Ga0501035_0054814 Ga0501035_0054814_2398_3246 280
404 3300049823 Ga0501044_0027026 Ga0501044_0027026_2988_3830 280
405 3300050491 nmdc:mga00v17_202_c2 nmdc:mga00v17_202_c2_21702_22547 280
406 3300053079 Ga0500610_0000087 Ga0500610_0000087_18249_19100 280
407 3300053161 Ga0500634_0000048 Ga0500634_0000048_44325_45167 280
408 2162886007 SwRhRL2b_contig_3430003 SwRhRL2b_0470.00006820 281
409 3300002773 JGI25152J39213_1000548 JGI25152J39213_100054815 281
410 3300002774 JGI25150J39212_1000114 JGI25150J39212_100011445 281
411 3300003187 JGI25151J46595_10000100 JGI25151J46595_1000010014 281
412 3300003187 JGI25151J46595_10000128 JGI25151J46595_1000012842 281
413 3300003215 JGI25153J46596_10000071 JGI25153J46596_1000007114 281
414 3300003771 Ga0055526_1000021 Ga0055526_100002148 281
415 3300003773 Ga0055537_1000141 Ga0055537_100014128 281
416 3300003775 Ga0055524_1000128 Ga0055524_100012830 281
417 3300003784 Ga0055534_1000054 Ga0055534_100005430 281
418 3300003790 Ga0055528_1000009 Ga0055528_100000948 281
419 3300003791 Ga0055530_10006699 Ga0055530_100066993 281
420 3300003794 Ga0055531_10023878 Ga0055531_100238781 281
421 3300003794 Ga0055531_10034919 Ga0055531_100349191 281
422 3300003856 Ga0058692_1000024 Ga0058692_1000024176 281
423 3300005289 Ga0065704_10070427 Ga0065704_100704275 281
424 3300005335 Ga0070666_10161546 Ga0070666_101615461 281
425 3300005335 Ga0070666_10357797 Ga0070666_103577971 281
426 3300005344 Ga0070661_100174837 Ga0070661_1001748371 281
427 3300005353 Ga0070669_100021116 Ga0070669_1000211164 281
428 3300005354 Ga0070675_100183973 Ga0070675_1001839732 281
429 3300005354 Ga0070675_100215198 Ga0070675_1002151981 281
430 3300005356 Ga0070674_100380553 Ga0070674_1003805532 281
431 3300005367 Ga0070667_100326170 Ga0070667_1003261702 281
432 3300005435 Ga0070714_100461773 Ga0070714_1004617731 281
433 3300005459 Ga0068867_100185165 Ga0068867_1001851652 281
434 3300005539 Ga0068853_100011050 Ga0068853_1000110505 281
435 3300005539 Ga0068853_100186624 Ga0068853_1001866242 281
436 3300005543 Ga0070672_100004894 Ga0070672_1000048946 281
437 3300005548 Ga0070665_100200891 Ga0070665_1002008912 281
438 3300005578 Ga0068854_100156886 Ga0068854_1001568862 281
439 3300005578 Ga0068854_100180122 Ga0068854_1001801222 281
440 3300005843 Ga0068860_100039783 Ga0068860_1000397833 281
441 3300009093 Ga0105240_10011255 Ga0105240_100112555 281
442 3300009098 Ga0105245_10276405 Ga0105245_102764052 281
443 3300009148 Ga0105243_10065350 Ga0105243_100653503 281
444 3300009177 Ga0105248_10331750 Ga0105248_103317502 281
445 3300009545 Ga0105237_10011506 Ga0105237_100115065 281
446 3300009551 Ga0105238_10004604 Ga0105238_100046048 281
447 3300009979 Ga0105032_100180 Ga0105032_1001801 281
448 3300013102 Ga0157371_10032246 Ga0157371_100322462 281
449 3300013104 Ga0157370_10015401 Ga0157370_100154015 281
450 3300013104 Ga0157370_10043506 Ga0157370_100435064 281
451 3300013104 Ga0157370_10315849 Ga0157370_103158492 281
452 3300013105 Ga0157369_10000148 Ga0157369_1000014884 281
453 3300013105 Ga0157369_10018886 Ga0157369_100188866 281
454 3300013297 Ga0157378_10036223 Ga0157378_100362234 281
455 3300013307 Ga0157372_10328623 Ga0157372_103286232 281
456 3300013308 Ga0157375_10048294 Ga0157375_100482944 281
457 3300015265 Ga0182005_1002348 Ga0182005_10023485 281
458 3300015689 Ga0183360_10001 Ga0183360_100011157 281
459 3300025245 Ga0207425_1000030 Ga0207425_1000030130 281
460 3300025258 Ga0209129_1000063 Ga0209129_100006392 281
461 3300025263 Ga0209565_1000048 Ga0209565_100004849 281
462 3300025273 Ga0209673_1000001 Ga0209673_10000012645 281
463 3300025273 Ga0209673_1012935 Ga0209673_10129352 281
464 3300025284 Ga0209130_1014151 Ga0209130_10141513 281
465 3300025291 Ga0209675_1000045 Ga0209675_1000045117 281
466 3300025291 Ga0209675_1006536 Ga0209675_10065362 281
467 3300025292 Ga0209676_1001772 Ga0209676_100177217 281
468 3300025292 Ga0209676_1004431 Ga0209676_10044316 281
469 3300025292 Ga0209676_1017119 Ga0209676_10171192 281
470 3300025294 Ga0209025_1000005 Ga0209025_1000005410 281
471 3300025294 Ga0209025_1000013 Ga0209025_1000013664 281
472 3300025294 Ga0209025_1001699 Ga0209025_10016997 281
473 3300025295 Ga0209564_1000001 Ga0209564_100000149 281
474 3300025295 Ga0209564_1007904 Ga0209564_10079043 281
475 3300025297 Ga0209758_1000014 Ga0209758_1000014664 281
476 3300025298 Ga0209050_1000603 Ga0209050_100060325 281
477 3300025299 Ga0209256_1000002 Ga0209256_10000021503 281
478 3300025299 Ga0209256_1003125 Ga0209256_100312510 281
479 3300025299 Ga0209256_1004759 Ga0209256_10047593 281
480 3300025299 Ga0209256_1005517 Ga0209256_10055174 281
481 3300025303 Ga0209051_1012596 Ga0209051_10125964 281
482 3300025304 Ga0209257_1000122 Ga0209257_100012264 281
483 3300025304 Ga0209257_1000243 Ga0209257_100024319 281
484 3300025304 Ga0209257_1001409 Ga0209257_100140917 281
485 3300025304 Ga0209257_1001842 Ga0209257_10018422 281
486 3300025304 Ga0209257_1003711 Ga0209257_10037112 281
487 3300025304 Ga0209257_1004748 Ga0209257_10047482 281
488 3300025903 Ga0207680_10292890 Ga0207680_102928901 281
489 3300025913 Ga0207695_10002942 Ga0207695_1000294212 281
490 3300025914 Ga0207671_10003439 Ga0207671_100034396 281
491 3300025920 Ga0207649_10132106 Ga0207649_101321061 281
492 3300025923 Ga0207681_10005175 Ga0207681_100051751 281
493 3300025924 Ga0207694_10001329 Ga0207694_1000132916 281
494 3300025931 Ga0207644_10019547 Ga0207644_100195472 281
495 3300025932 Ga0207690_10079526 Ga0207690_100795262 281
496 3300025933 Ga0207706_10469701 Ga0207706_104697011 281
497 3300025940 Ga0207691_10001351 Ga0207691_1000135123 281
498 3300025986 Ga0207658_10353571 Ga0207658_103535712 281
499 3300026041 Ga0207639_10013523 Ga0207639_100135233 281
500 3300026067 Ga0207678_10308580 Ga0207678_103085802 281
501 3300026067 Ga0207678_10425972 Ga0207678_104259722 281
502 3300026088 Ga0207641_10321894 Ga0207641_103218941 281
503 3300026089 Ga0207648_10143860 Ga0207648_101438602 281
504 3300026118 Ga0207675_100008513 Ga0207675_1000085138 281
505 3300027312 Ga0209371_1000016 Ga0209371_1000016394 281
506 3300028379 Ga0268266_10166883 Ga0268266_101668832 281
507 3300028381 Ga0268264_10106646 Ga0268264_101066463 281
508 3300028794 Ga0307515_10268053 Ga0307515_102680532 281
509 3300030500 Ga0268256_1000015 Ga0268256_1000015176 281
510 3300031456 Ga0307513_10001515 Ga0307513_1000151534 281
511 3300031691 Ga0316579_10051224 Ga0316579_100512241 281
512 3300031727 Ga0316576_10101615 Ga0316576_101016152 281
513 3300031730 Ga0307516_10023137 Ga0307516_100231372 281
514 3300031733 Ga0316577_10262752 Ga0316577_102627521 281
515 3300031824 Ga0307413_10020201 Ga0307413_100202013 281
516 3300031852 Ga0307410_10022805 Ga0307410_100228052 281
517 3300031901 Ga0307406_10097183 Ga0307406_100971832 281
518 3300031901 Ga0307406_10153855 Ga0307406_101538552 281
519 3300031901 Ga0307406_10241399 Ga0307406_102413992 281
520 3300031995 Ga0307409_100302032 Ga0307409_1003020322 281
521 3300032004 Ga0307414_10007328 Ga0307414_100073282 281
522 3300032005 Ga0307411_10014333 Ga0307411_100143333 281
523 3300035116 Ga0373945_0102135 Ga0373945_0102135_226_1071 281
524 3300035398 Ga0316574_0066867 Ga0316574_0066867_48_965 281
525 3300036647 Ga0316582_0084641 Ga0316582_0084641_322_1239 281
526 3300037312 Ga0395899_0021274 Ga0395899_0021274_1547_2584 281
527 3300037312 Ga0395899_0378782 Ga0395899_0378782_14_907 281
528 3300037418 Ga0395900_0098626 Ga0395900_0098626_36_980 281
529 3300037418 Ga0395900_0274081 Ga0395900_0274081_264_1109 281
530 3300037466 Ga0395898_0260825 Ga0395898_0260825_151_1173 281
531 3300037471 Ga0395905_0000503 Ga0395905_0000503_27699_28643 281
532 3300037471 Ga0395905_0019782 Ga0395905_0019782_1197_2096 281
533 3300038443 Ga0395901_0400550 Ga0395901_0400550_101_1123 281
534 3300038705 Ga0237819_00151 Ga0237819_00151_5680_6525 281
535 3300039145 Ga0237816_00052 Ga0237816_00052_4573_5418 281
536 3300041404 Ga0439436_0008498 Ga0439436_0008498_1776_2630 281
537 3300041404 Ga0439436_0017952 Ga0439436_0017952_508_1362 281
538 3300041407 Ga0439447_007420 Ga0439447_007420_1791_2639 281
539 3300041413 Ga0439465_0001513 Ga0439465_0001513_767_1621 281
540 3300041413 Ga0439465_0004624 Ga0439465_0004624_1794_2648 281
541 3300041443 Ga0451789_1189856 Ga0451789_1189856_257_1123 281
542 3300041451 Ga0451791_0669101 Ga0451791_0669101_337_1182 281
543 3300041459 Ga0451800_1497069 Ga0451800_1497069_915_1763 281
544 3300041460 Ga0451802_0225807 Ga0451802_0225807_1899_2765 281
545 3300041462 Ga0451806_254328 Ga0451806_254328_2028_2876 281
546 3300041486 Ga0451807_0519353 Ga0451807_0519353_1491_2339 281
547 3300041486 Ga0451807_2648432 Ga0451807_2648432_34_879 281
548 3300041509 Ga0451843_0406729 Ga0451843_0406729_704_1552 281
549 3300041512 Ga0451853_0391743 Ga0451853_0391743_787_1653 281
550 3300041512 Ga0451853_0518947 Ga0451853_0518947_170_1015 281
551 3300042007 Ga0439449_0000018 Ga0439449_0000018_1255_2109 281
552 3300042007 Ga0439449_0004679 Ga0439449_0004679_23_910 281
553 3300042007 Ga0439449_0011438 Ga0439449_0011438_610_1455 281
554 3300042876 Ga0451577_0058752 Ga0451577_0058752_1484_2335 281
555 3300046525 Ga0495663_0001399 Ga0495663_0001399_5290_6144 281
556 3300046525 Ga0495663_0026508 Ga0495663_0026508_197_1051 281
557 3300046615 Ga0495656_0027624 Ga0495656_0027624_655_1533 281
558 3300046615 Ga0495656_0029083 Ga0495656_0029083_1185_2057 281
559 3300046616 Ga0495668_0008487 Ga0495668_0008487_2445_3293 281
560 3300046692 Ga0495671_0070657 Ga0495671_0070657_125_979 281
561 3300047318 Ga0495636_0108742 Ga0495636_0108742_270_1148 281
562 3300048903 Ga0496100_0190319 Ga0496100_0190319_134_1078 281
563 3300048909 Ga0496106_0328530 Ga0496106_0328530_13_885 281
564 3300048912 Ga0496109_0031793 Ga0496109_0031793_3080_4024 281
565 3300048913 Ga0496110_0525235 Ga0496110_0525235_177_1049 281
566 3300048915 Ga0496112_0054916 Ga0496112_0054916_2591_3535 281
567 3300048916 Ga0496113_0012572 Ga0496113_0012572_1981_2925 281
568 3300048916 Ga0496113_0024103 Ga0496113_0024103_3076_3948 281
569 3300048920 Ga0496117_0083404 Ga0496117_0083404_12_887 281
570 3300048921 Ga0496118_0061448 Ga0496118_0061448_922_1770 281
571 3300048925 Ga0496122_0034822 Ga0496122_0034822_3198_4046 281
572 3300048926 Ga0496123_0029269 Ga0496123_0029269_46_894 281
573 3300048929 Ga0496126_0026779 Ga0496126_0026779_3377_4225 281
574 3300048929 Ga0496126_0144782 Ga0496126_0144782_215_1063 281
575 3300049570 Ga0501033_0011027 Ga0501033_0011027_2062_2949 281
576 3300049571 Ga0501034_0037891 Ga0501034_0037891_2577_3425 281
577 3300049571 Ga0501034_0054343 Ga0501034_0054343_2015_2863 281
578 3300049572 Ga0501036_0023761 Ga0501036_0023761_3933_4820 281
579 3300049574 Ga0501038_0004044 Ga0501038_0004044_11250_12137 281
580 3300049575 Ga0501039_0003853 Ga0501039_0003853_8833_9720 281
581 3300049576 Ga0501040_0001206 Ga0501040_0001206_7545_8432 281
582 3300049577 Ga0501041_0001968 Ga0501041_0001968_5933_6820 281
583 3300049578 Ga0501042_0000931 Ga0501042_0000931_6309_7196 281
584 3300049579 Ga0501043_0021394 Ga0501043_0021394_1049_1942 281
585 3300049579 Ga0501043_0037824 Ga0501043_0037824_2884_3747 281
586 3300049579 Ga0501043_0099869 Ga0501043_0099869_889_1776 281
587 3300049580 Ga0501046_0011112 Ga0501046_0011112_3673_4560 281
588 3300049582 Ga0501048_0011120 Ga0501048_0011120_4465_5352 281
589 3300049584 Ga0501068_0000860 Ga0501068_0000860_10597_11484 281
590 3300049587 Ga0501071_0006996 Ga0501071_0006996_3451_4338 281
591 3300049588 Ga0501072_0001665 Ga0501072_0001665_12411_13298 281
592 3300049591 Ga0501075_0000858 Ga0501075_0000858_16250_17137 281
593 3300049592 Ga0501076_0002159 Ga0501076_0002159_6027_6914 281
594 3300049592 Ga0501076_0031032 Ga0501076_0031032_279_1154 281
595 3300049593 Ga0501077_0004578 Ga0501077_0004578_1068_1955 281
596 3300049679 Ga0501249_008222 Ga0501249_008222_111_986 281
597 3300049688 Ga0501259_001711 Ga0501259_001711_1866_2741 281
598 3300049705 Ga0501225_0013529 Ga0501225_0013529_240_1091 281
599 3300049741 Ga0501079_0002189 Ga0501079_0002189_7588_8475 281
600 3300049742 Ga0501080_0009101 Ga0501080_0009101_5858_6745 281
601 3300049743 Ga0501081_0000359 Ga0501081_0000359_14561_15448 281
602 3300049822 Ga0501035_0035887 Ga0501035_0035887_1670_2557 281
603 3300049823 Ga0501044_0165761 Ga0501044_0165761_169_1056 281
604 3300049824 Ga0501045_0031495 Ga0501045_0031495_2383_3258 281
605 3300054114 Ga0501084_0007709 Ga0501084_0007709_5130_6017 281
606 3300060353 Ga0501082_0000368 Ga0501082_0000368_36900_37787 281
607 3300061734 Ga0530510_0000025 Ga0530510_0000025_20006_20893 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

109

341

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cnx-assembly2.cif.gz_E crystal structure of apo psd from e. coli (2.63 a) 0.9545 5 246
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.9393 1 246
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.9356 1 246
7cnx-assembly2.cif.gz_E crystal structure of apo psd from e. coli (2.63 a) 0.9247 5 246
6zjl-assembly1.cif.gz_4 respiratory complex i from thermus thermophilus, nad+ dataset, major state 0.6799 181 201
ID Description Score Start End Superfamily
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9751 61 277 2.70.70.10
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9451 61 277 2.70.70.10
af_C7FZZ8_173_397_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9114 62 278 2.70.70.10
af_A1A5T2_181_425_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9004 62 277 2.70.70.10
af_O14333_232_431_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8986 130 278 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A0R0DQG4-F1-model_v4 deleted 0.9992 81 279
AF-A0A0R0DQG4-F1-model_v4 deleted 0.9892 81 279
AF-A0A3D2SL59-F1-model_v4 phosphatidylserine decarboxylase (EC 4.1.1.65) 0.9868 22 147 GO:0004609
GO:0006646
AF-W7WJA4-F1-model_v4 phosphatidylserine decarboxylase (EC 4.1.1.65) 0.9848 86 277 GO:0004609
GO:0006646
AF-A0A2E3MJK1-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9847 9 281 GO:0004609
GO:0005886
GO:0006646

Feature Viewer

pLDDT pTM Quality
89.46 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map