F468635

General Info

Members Datasets Scaffolds Average Seq Length
606 257 604 209

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0442926|Ga0501069_0442926_78_752
Length 224
Sequence MLPRRHFRDREEDRRMSARELLQHYLNESPLVAIIRGVTPEEADAIGQAIFDGGIRIIEVPLNSPDPLQSIERLAKRFGDQALVGAGTVLDAANVQRVKDVGGRIIVSPDTNHEVIASAAAAGLVSSPGYFTPSEAFGALRAGAHALKLFPAEAATPGVLKAQLAVIPREVPVIVVGGVKPDNMRPWLEAGAAGFGLGSGLYKPGQSAEETLEKARAYVAGERA

Samples

Sample ID Description Type Environment
1 2842711865 Duganella sp. R-73148 Isolate Unclassified
2 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
146 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
205 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
226 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
227 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
228 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
232 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
233 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
234 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
235 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
236 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
240 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
241 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
244 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
245 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
246 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
247 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
248 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
249 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.83
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 4.46
Rhizosphere 91.58
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002553 3300002738 Bacteria 4597
2 Ga0055526_1000020 3300003771 Bacteria 188230
3 Ga0070658_10006059 3300005327 Bacteria 9803
4 Ga0070658_10006506 3300005327 Bacteria 9473
5 Ga0070658_10012808 3300005327 Bacteria 6728
6 Ga0070658_10297615 3300005327 Bacteria 1376
7 Ga0070676_10131453 3300005328 Bacteria 1583
8 Ga0070683_100144414 3300005329 Bacteria 2254
9 Ga0070683_100227076 3300005329 Bacteria 1775
10 Ga0070683_100379534 3300005329 Bacteria 1347
11 Ga0070670_100025931 3300005331 Bacteria 5043
12 Ga0070670_100055618 3300005331 Bacteria 3397
13 Ga0070670_100403694 3300005331 Bacteria 1207
14 Ga0070677_10024733 3300005333 Bacteria 2236
15 Ga0070677_10323012 3300005333 Bacteria 791
16 Ga0070680_100001008 3300005336 Bacteria 20096
17 Ga0070680_100019131 3300005336 Bacteria 5423
18 Ga0070680_100219621 3300005336 Bacteria 1604
19 Ga0070682_100063720 3300005337 Bacteria 2338
20 Ga0070682_100575233 3300005337 Bacteria 885
21 Ga0070660_100002984 3300005339 Bacteria 11653
22 Ga0070660_100004103 3300005339 Bacteria 10050
23 Ga0070660_100119596 3300005339 Bacteria 2101
24 Ga0070660_100121490 3300005339 Bacteria 2085
25 Ga0070660_100208906 3300005339 Bacteria 1584
26 Ga0070660_100625317 3300005339 Bacteria 901
27 Ga0070661_100000055 3300005344 Bacteria 88266
28 Ga0070661_100051101 3300005344 Bacteria 3025
29 Ga0070661_100828975 3300005344 Bacteria 760
30 Ga0070692_10105586 3300005345 Bacteria 1551
31 Ga0070692_10203099 3300005345 Unclassified 1162
32 Ga0070668_100141220 3300005347 Bacteria 1941
33 Ga0070668_100692406 3300005347 Bacteria 898
34 Ga0070669_100000547 3300005353 Bacteria 27940
35 Ga0070669_100359985 3300005353 Unclassified 1183
36 Ga0070669_100418620 3300005353 Bacteria 1099
37 Ga0070675_100035280 3300005354 Bacteria 4063
38 Ga0070675_100051833 3300005354 Bacteria 3373
39 Ga0070675_100096026 3300005354 Bacteria 2490
40 Ga0070671_100062944 3300005355 Bacteria 3089
41 Ga0070671_100082537 3300005355 Bacteria 2687
42 Ga0070671_100160172 3300005355 Bacteria 1902
43 Ga0070673_100172043 3300005364 Bacteria 1849
44 Ga0070688_100143690 3300005365 Bacteria 1624
45 Ga0070659_100105485 3300005366 Bacteria 2271
46 Ga0070667_100187605 3300005367 Bacteria 1830
47 Ga0070714_100042960 3300005435 Bacteria 3820
48 Ga0070714_100270690 3300005435 Bacteria 1575
49 Ga0070701_10226211 3300005438 Bacteria 1118
50 Ga0070663_100029938 3300005455 Bacteria 3725
51 Ga0070663_100081426 3300005455 Bacteria 2380
52 Ga0070663_100228393 3300005455 Unclassified 1464
53 Ga0070663_100560873 3300005455 Bacteria 956
54 Ga0070678_100243741 3300005456 Unclassified 1504
55 Ga0070662_100082516 3300005457 Bacteria 2397
56 Ga0070681_10010375 3300005458 Bacteria 9199
57 Ga0070681_10121944 3300005458 Bacteria 2541
58 Ga0070679_100000027 3300005530 Bacteria 114873
59 Ga0070679_100062631 3300005530 Bacteria 3709
60 Ga0070679_100400093 3300005530 Bacteria 1319
61 Ga0070684_100320958 3300005535 Bacteria 1423
62 Ga0070684_100371451 3300005535 Bacteria 1317
63 Ga0068853_100165213 3300005539 Bacteria 2000
64 Ga0068853_100190509 3300005539 Bacteria 1863
65 Ga0068853_100234020 3300005539 Bacteria 1681
66 Ga0070672_100038689 3300005543 Bacteria 3647
67 Ga0070686_100002270 3300005544 Bacteria 10605
68 Ga0070693_100552621 3300005547 Bacteria 824
69 Ga0070665_100014746 3300005548 Bacteria 7843
70 Ga0070665_100046017 3300005548 Bacteria 4383
71 Ga0070704_100202539 3300005549 Bacteria 1603
72 Ga0070704_100908527 3300005549 Bacteria 792
73 Ga0068855_100004220 3300005563 Bacteria 17542
74 Ga0068855_100009899 3300005563 Bacteria 11499
75 Ga0068855_100093581 3300005563 Bacteria 3466
76 Ga0068855_100443236 3300005563 Bacteria 1418
77 Ga0070664_100009697 3300005564 Bacteria 7811
78 Ga0070664_100028729 3300005564 Bacteria 4629
79 Ga0070664_100170628 3300005564 Unclassified 1930
80 Ga0068857_100186676 3300005577 Bacteria 1888
81 Ga0068857_100799562 3300005577 Bacteria 900
82 Ga0068854_100346178 3300005578 Bacteria 1215
83 Ga0068854_100609855 3300005578 Bacteria 933
84 Ga0068856_100014100 3300005614 Bacteria 7728
85 Ga0068856_100204867 3300005614 Bacteria 1987
86 Ga0068856_100518261 3300005614 Bacteria 1213
87 Ga0068856_100541755 3300005614 Bacteria 1185
88 Ga0068856_100636101 3300005614 Unclassified 1087
89 Ga0068852_100005882 3300005616 Bacteria 8817
90 Ga0068852_100017135 3300005616 Bacteria 5675
91 Ga0068852_100094527 3300005616 Bacteria 2682
92 Ga0068852_100146319 3300005616 Bacteria 2192
93 Ga0068852_100902246 3300005616 Bacteria 901
94 Ga0068852_100937669 3300005616 Bacteria 883
95 Ga0068859_100005794 3300005617 Bacteria 12552
96 Ga0068864_100027734 3300005618 Bacteria 4785
97 Ga0068870_10287341 3300005840 Unclassified 1033
98 Ga0068870_10394034 3300005840 Bacteria 899
99 Ga0068863_100014935 3300005841 Bacteria 7459
100 Ga0068863_100026341 3300005841 Bacteria 5548
101 Ga0068863_100030247 3300005841 Bacteria 5172
102 Ga0068858_100001349 3300005842 Bacteria 25309
103 Ga0068862_100212388 3300005844 Bacteria 1749
104 Ga0068871_100606190 3300006358 Bacteria 996
105 Ga0097620_100005794 3300006931 Bacteria 12552
106 Ga0105240_10022230 3300009093 Bacteria 8414
107 Ga0105240_10078780 3300009093 Bacteria 4057
108 Ga0105240_10670175 3300009093 Bacteria 1135
109 Ga0111539_10352557 3300009094 Bacteria 1712
110 Ga0105245_10054041 3300009098 Bacteria 3607
111 Ga0105248_10001489 3300009177 Bacteria 26067
112 Ga0105248_10100588 3300009177 Bacteria 3258
113 Ga0105248_10448372 3300009177 Bacteria 1454
114 Ga0105238_10086527 3300009551 Bacteria 3122
115 Ga0105238_10344433 3300009551 Bacteria 1479
116 Ga0105249_10327508 3300009553 Bacteria 1545
117 Ga0105239_10025225 3300010375 Bacteria 6547
118 Ga0157373_10026122 3300013100 Bacteria 4220
119 Ga0157373_10031719 3300013100 Bacteria 3803
120 Ga0157373_10076934 3300013100 Bacteria 2354
121 Ga0157373_10119088 3300013100 Bacteria 1856
122 Ga0157373_10446998 3300013100 Bacteria 930
123 Ga0157371_10034327 3300013102 Bacteria 3639
124 Ga0157371_10034504 3300013102 Bacteria 3628
125 Ga0157371_10098003 3300013102 Bacteria 2079
126 Ga0157371_10135738 3300013102 Bacteria 1752
127 Ga0157371_10226498 3300013102 Bacteria 1343
128 Ga0157370_10073881 3300013104 Bacteria 3217
129 Ga0157370_10117344 3300013104 Bacteria 2486
130 Ga0157370_10153077 3300013104 Bacteria 2146
131 Ga0157370_10217418 3300013104 Bacteria 1770
132 Ga0157370_10306174 3300013104 Bacteria 1466
133 Ga0157369_10018913 3300013105 Bacteria 7719
134 Ga0157369_10294755 3300013105 Bacteria 1688
135 Ga0157369_10404817 3300013105 Unclassified 1415
136 Ga0157369_10521749 3300013105 Bacteria 1229
137 Ga0157369_10521750 3300013105 Bacteria 1229
138 Ga0157369_10736385 3300013105 Bacteria 1015
139 Ga0157374_10005525 3300013296 Bacteria 10631
140 Ga0157374_10140292 3300013296 Bacteria 2346
141 Ga0157372_10383950 3300013307 Bacteria 1636
142 Ga0157375_10491152 3300013308 Bacteria 1392
143 Ga0163163_10048029 3300014325 Bacteria 4196
144 Ga0163163_10585406 3300014325 Bacteria 1179
145 Ga0157376_10360555 3300014969 Bacteria 1394
146 Ga0163161_10316353 3300017792 Bacteria 1233
147 Ga0206356_11302048 3300020070 Bacteria 4031
148 Ga0206354_10325713 3300020081 Bacteria 2918
149 Ga0206354_11360577 3300020081 Bacteria 4207
150 Ga0206353_10818709 3300020082 Bacteria 6203
151 Ga0206353_11812148 3300020082 Bacteria 1994
152 Ga0213873_10000006 3300021358 Bacteria 408723
153 Ga0213873_10092942 3300021358 Bacteria 859
154 Ga0213876_10000004 3300021384 Bacteria 943822
155 Ga0209646_1000028 3300025246 Bacteria 387986
156 Ga0209564_1000006 3300025295 Bacteria 1100927
157 Ga0207682_10002744 3300025893 Bacteria 7798
158 Ga0207682_10133001 3300025893 Bacteria 1111
159 Ga0207647_10082289 3300025904 Bacteria 1928
160 Ga0207645_10121318 3300025907 Bacteria 1697
161 Ga0207643_10245058 3300025908 Bacteria 1103
162 Ga0207705_10000945 3300025909 Bacteria 23724
163 Ga0207705_10007630 3300025909 Bacteria 7956
164 Ga0207705_10007767 3300025909 Bacteria 7878
165 Ga0207705_10039385 3300025909 Bacteria 3387
166 Ga0207705_10042461 3300025909 Bacteria 3264
167 Ga0207705_10090152 3300025909 Bacteria 2244
168 Ga0207705_10161699 3300025909 Bacteria 1682
169 Ga0207705_10234722 3300025909 Bacteria 1396
170 Ga0207705_10473438 3300025909 Bacteria 972
171 Ga0207705_10475997 3300025909 Bacteria 969
172 Ga0207705_10483991 3300025909 Bacteria 961
173 Ga0207707_10033033 3300025912 Bacteria 4529
174 Ga0207695_10001533 3300025913 Bacteria 38143
175 Ga0207660_10001023 3300025917 Bacteria 18531
176 Ga0207660_10064336 3300025917 Bacteria 2647
177 Ga0207660_10219710 3300025917 Bacteria 1491
178 Ga0207657_10000267 3300025919 Bacteria 55426
179 Ga0207657_10002664 3300025919 Bacteria 19268
180 Ga0207657_10006383 3300025919 Bacteria 12243
181 Ga0207657_10007939 3300025919 Bacteria 10823
182 Ga0207657_10043824 3300025919 Bacteria 3938
183 Ga0207657_10048214 3300025919 Bacteria 3720
184 Ga0207657_10340458 3300025919 Bacteria 1184
185 Ga0207649_10000103 3300025920 Bacteria 69885
186 Ga0207649_10000538 3300025920 Bacteria 26239
187 Ga0207649_10067246 3300025920 Bacteria 2274
188 Ga0207649_10238036 3300025920 Bacteria 1305
189 Ga0207652_10000001 3300025921 Bacteria 1006643
190 Ga0207652_10014570 3300025921 Bacteria 6373
191 Ga0207652_10356718 3300025921 Bacteria 1320
192 Ga0207681_10000528 3300025923 Bacteria 26417
193 Ga0207681_10219583 3300025923 Bacteria 1470
194 Ga0207681_10340994 3300025923 Unclassified 1197
195 Ga0207694_10941260 3300025924 Bacteria 731
196 Ga0207650_10080246 3300025925 Bacteria 2473
197 Ga0207650_10096149 3300025925 Bacteria 2272
198 Ga0207650_10333360 3300025925 Bacteria 1245
199 Ga0207664_10061161 3300025929 Bacteria 3004
200 Ga0207644_10000005 3300025931 Bacteria 441948
201 Ga0207644_10000954 3300025931 Bacteria 18456
202 Ga0207644_10049061 3300025931 Bacteria 3020
203 Ga0207690_10007847 3300025932 Bacteria 6339
204 Ga0207690_10035199 3300025932 Bacteria 3233
205 Ga0207690_10573795 3300025932 Bacteria 919
206 Ga0207706_10000475 3300025933 Bacteria 42955
207 Ga0207706_10003614 3300025933 Bacteria 14775
208 Ga0207706_10356918 3300025933 Bacteria 1270
209 Ga0207691_10106398 3300025940 Bacteria 2499
210 Ga0207691_10245787 3300025940 Bacteria 1546
211 Ga0207711_10030857 3300025941 Bacteria 4522
212 Ga0207711_10051635 3300025941 Bacteria 3522
213 Ga0207711_10179168 3300025941 Unclassified 1926
214 Ga0207661_10114491 3300025944 Bacteria 2287
215 Ga0207661_10116126 3300025944 Bacteria 2271
216 Ga0207679_10019935 3300025945 Bacteria 4517
217 Ga0207679_10335679 3300025945 Bacteria 1313
218 Ga0207667_10007813 3300025949 Bacteria 12784
219 Ga0207667_10022805 3300025949 Bacteria 6904
220 Ga0207667_10031385 3300025949 Bacteria 5736
221 Ga0207651_10407276 3300025960 Bacteria 1158
222 Ga0207668_10167883 3300025972 Bacteria 1718
223 Ga0207668_10567673 3300025972 Bacteria 985
224 Ga0207640_10000469 3300025981 Bacteria 24706
225 Ga0207640_10027615 3300025981 Bacteria 3460
226 Ga0207640_10190138 3300025981 Bacteria 1547
227 Ga0207640_10310214 3300025981 Bacteria 1252
228 Ga0207640_10931349 3300025981 Bacteria 761
229 Ga0207658_10118367 3300025986 Bacteria 2107
230 Ga0207658_10124621 3300025986 Bacteria 2060
231 Ga0207658_10651867 3300025986 Bacteria 949
232 Ga0207703_10001781 3300026035 Bacteria 19226
233 Ga0207639_10265957 3300026041 Bacteria 1502
234 Ga0207678_10000740 3300026067 Bacteria 29953
235 Ga0207678_10013949 3300026067 Bacteria 7063
236 Ga0207678_10014499 3300026067 Bacteria 6930
237 Ga0207678_10056232 3300026067 Bacteria 3387
238 Ga0207678_10188974 3300026067 Bacteria 1760
239 Ga0207678_10595530 3300026067 Bacteria 969
240 Ga0207702_10022914 3300026078 Bacteria 5181
241 Ga0207702_10052756 3300026078 Bacteria 3442
242 Ga0207702_10063312 3300026078 Bacteria 3162
243 Ga0207702_10552650 3300026078 Bacteria 1126
244 Ga0207641_10019400 3300026088 Bacteria 5581
245 Ga0207676_10687280 3300026095 Bacteria 990
246 Ga0207674_10109149 3300026116 Bacteria 2743
247 Ga0207674_10160076 3300026116 Bacteria 2206
248 Ga0207674_10237991 3300026116 Bacteria 1768
249 Ga0207674_10438284 3300026116 Bacteria 1263
250 Ga0207698_10017594 3300026142 Bacteria 4855
251 Ga0207698_10027096 3300026142 Bacteria 4064
252 Ga0207698_10049925 3300026142 Bacteria 3188
253 Ga0207698_10152176 3300026142 Bacteria 2010
254 Ga0209974_10004908 3300027876 Bacteria 4731
255 Ga0209974_10058526 3300027876 Bacteria 1303
256 Ga0268266_10000061 3300028379 Bacteria 255207
257 Ga0268266_10047306 3300028379 Bacteria 3685
258 Ga0268266_10502576 3300028379 Bacteria 1158
259 Ga0268266_10664009 3300028379 Bacteria 1004
260 Ga0268264_10107797 3300028381 Bacteria 2434
261 Ga0265325_10166712 3300031241 Bacteria 1033
262 Ga0265339_10283867 3300031249 Bacteria 793
263 Ga0307509_10022123 3300031507 Bacteria 7177
264 Ga0307408_100023382 3300031548 Bacteria 4209
265 Ga0307408_100047469 3300031548 Bacteria 3076
266 Ga0307408_100203229 3300031548 Bacteria 1605
267 Ga0307408_100246058 3300031548 Bacteria 1472
268 Ga0307408_100253148 3300031548 Bacteria 1454
269 Ga0307408_100531482 3300031548 Bacteria 1035
270 Ga0316576_10139354 3300031727 Bacteria 1826
271 Ga0307405_10002876 3300031731 Bacteria 7742
272 Ga0307405_10020772 3300031731 Bacteria 3676
273 Ga0307405_10024801 3300031731 Bacteria 3433
274 Ga0307405_10026460 3300031731 Bacteria 3346
275 Ga0307405_10038511 3300031731 Bacteria 2883
276 Ga0307405_10135107 3300031731 Bacteria 1711
277 Ga0307405_10582705 3300031731 Bacteria 910
278 Ga0307405_10913628 3300031731 Bacteria 743
279 Ga0307413_10000144 3300031824 Bacteria 19106
280 Ga0307413_10010609 3300031824 Bacteria 4482
281 Ga0307413_10033408 3300031824 Bacteria 2929
282 Ga0307413_10055139 3300031824 Bacteria 2416
283 Ga0307413_10140686 3300031824 Bacteria 1667
284 Ga0307413_10184471 3300031824 Bacteria 1491
285 Ga0307413_10341803 3300031824 Bacteria 1151
286 Ga0307413_10407692 3300031824 Bacteria 1067
287 Ga0307413_10408038 3300031824 Bacteria 1066
288 Ga0307413_10972085 3300031824 Bacteria 726
289 Ga0307410_10000229 3300031852 Bacteria 21150
290 Ga0307410_10009555 3300031852 Bacteria 5446
291 Ga0307410_10014749 3300031852 Bacteria 4611
292 Ga0307410_10073440 3300031852 Bacteria 2378
293 Ga0307410_10074495 3300031852 Bacteria 2364
294 Ga0307410_10137309 3300031852 Bacteria 1804
295 Ga0307410_10173605 3300031852 Bacteria 1626
296 Ga0307410_10352381 3300031852 Bacteria 1177
297 Ga0307410_11020024 3300031852 Bacteria 714
298 Ga0307406_10009310 3300031901 Bacteria 5504
299 Ga0307406_10047226 3300031901 Bacteria 2713
300 Ga0307406_10078339 3300031901 Bacteria 2189
301 Ga0307406_10216754 3300031901 Bacteria 1420
302 Ga0307406_10432805 3300031901 Bacteria 1051
303 Ga0307406_10770431 3300031901 Bacteria 809
304 Ga0307407_10003042 3300031903 Bacteria 6751
305 Ga0307407_10009558 3300031903 Bacteria 4524
306 Ga0307407_10100640 3300031903 Bacteria 1793
307 Ga0307407_10113305 3300031903 Bacteria 1706
308 Ga0307407_10121059 3300031903 Bacteria 1659
309 Ga0307407_10186153 3300031903 Bacteria 1380
310 Ga0307412_10007341 3300031911 Bacteria 6250
311 Ga0307412_10015387 3300031911 Bacteria 4535
312 Ga0307412_10029057 3300031911 Bacteria 3466
313 Ga0307412_10054270 3300031911 Bacteria 2659
314 Ga0307412_10073092 3300031911 Bacteria 2345
315 Ga0307412_10091325 3300031911 Bacteria 2131
316 Ga0307412_10099271 3300031911 Bacteria 2055
317 Ga0307412_10146008 3300031911 Bacteria 1739
318 Ga0307412_10836067 3300031911 Bacteria 802
319 Ga0307412_10892251 3300031911 Bacteria 778
320 Ga0307409_100000049 3300031995 Bacteria 42215
321 Ga0307409_100010794 3300031995 Bacteria 5708
322 Ga0307409_100023898 3300031995 Bacteria 4247
323 Ga0307409_100024938 3300031995 Bacteria 4183
324 Ga0307409_100064481 3300031995 Bacteria 2878
325 Ga0307409_100132192 3300031995 Bacteria 2135
326 Ga0307409_100152813 3300031995 Bacteria 2007
327 Ga0307409_100154897 3300031995 Bacteria 1995
328 Ga0307409_100176192 3300031995 Bacteria 1888
329 Ga0307409_100579331 3300031995 Bacteria 1106
330 Ga0307409_100861559 3300031995 Bacteria 917
331 Ga0307409_101019903 3300031995 Bacteria 846
332 Ga0307416_100011585 3300032002 Bacteria 5891
333 Ga0307416_100014720 3300032002 Bacteria 5374
334 Ga0307416_100137748 3300032002 Bacteria 2212
335 Ga0307416_100270459 3300032002 Bacteria 1668
336 Ga0307416_100806633 3300032002 Bacteria 1035
337 Ga0307416_101043884 3300032002 Bacteria 921
338 Ga0307414_10000735 3300032004 Bacteria 16778
339 Ga0307414_10021051 3300032004 Bacteria 4081
340 Ga0307414_10023406 3300032004 Bacteria 3917
341 Ga0307414_10034656 3300032004 Bacteria 3350
342 Ga0307414_10045191 3300032004 Bacteria 3014
343 Ga0307414_10149878 3300032004 Bacteria 1838
344 Ga0307414_10293495 3300032004 Bacteria 1372
345 Ga0307411_10000702 3300032005 Bacteria 12290
346 Ga0307411_10014921 3300032005 Bacteria 4341
347 Ga0307411_10040262 3300032005 Bacteria 2963
348 Ga0307411_10053530 3300032005 Bacteria 2645
349 Ga0307411_10059763 3300032005 Bacteria 2528
350 Ga0307411_10128706 3300032005 Bacteria 1846
351 Ga0307411_10278246 3300032005 Bacteria 1331
352 Ga0307411_10331850 3300032005 Bacteria 1233
353 Ga0307411_10494714 3300032005 Bacteria 1032
354 Ga0307411_10528616 3300032005 Bacteria 1002
355 Ga0307415_100007655 3300032126 Bacteria 5926
356 Ga0307415_100034422 3300032126 Bacteria 3298
357 Ga0307415_100037701 3300032126 Bacteria 3179
358 Ga0307415_100044609 3300032126 Bacteria 2965
359 Ga0307415_100882078 3300032126 Bacteria 823
360 Ga0373948_0052294 3300034817 Unclassified 880
361 Ga0373947_0201025 3300035725 Bacteria 1304
362 Ga0373925_0452155 3300037068 Bacteria 1052
363 Ga0395899_0005357 3300037312 Bacteria 9967
364 Ga0395899_0012269 3300037312 Bacteria 6563
365 Ga0395899_0018651 3300037312 Bacteria 5271
366 Ga0395899_0026996 3300037312 Bacteria 4331
367 Ga0395899_0047284 3300037312 Bacteria 3204
368 Ga0395899_0052302 3300037312 Bacteria 3028
369 Ga0395899_0052687 3300037312 Bacteria 3015
370 Ga0395899_0114793 3300037312 Bacteria 1933
371 Ga0395900_0000447 3300037418 Bacteria 59069
372 Ga0395900_0008912 3300037418 Bacteria 10293
373 Ga0395900_0036937 3300037418 Bacteria 5035
374 Ga0395900_0051071 3300037418 Bacteria 4259
375 Ga0395900_0168699 3300037418 Bacteria 2229
376 Ga0395900_0211034 3300037418 Bacteria 1960
377 Ga0395900_0284498 3300037418 Bacteria 1644
378 Ga0395900_0431114 3300037418 Bacteria 1277
379 Ga0395900_0519761 3300037418 Bacteria 1138
380 Ga0395900_0589052 3300037418 Bacteria 1053
381 Ga0395900_0815249 3300037418 Bacteria 860
382 Ga0395898_0002889 3300037466 Bacteria 19582
383 Ga0395898_0005900 3300037466 Bacteria 13169
384 Ga0395898_0010805 3300037466 Bacteria 9538
385 Ga0395898_0018867 3300037466 Bacteria 7027
386 Ga0395898_0040488 3300037466 Bacteria 4607
387 Ga0395898_0086695 3300037466 Bacteria 3017
388 Ga0395898_0244801 3300037466 Bacteria 1710
389 Ga0395898_0942699 3300037466 Bacteria 800
390 Ga0395905_0000104 3300037471 Bacteria 141965
391 Ga0395905_0053493 3300037471 Bacteria 3778
392 Ga0395905_0070723 3300037471 Bacteria 3270
393 Ga0395905_0180539 3300037471 Bacteria 1981
394 Ga0395905_0219723 3300037471 Bacteria 1778
395 Ga0395905_0230377 3300037471 Bacteria 1732
396 Ga0395905_0682445 3300037471 Bacteria 929
397 Ga0395901_0000324 3300038443 Bacteria 59134
398 Ga0395901_0028167 3300038443 Bacteria 5778
399 Ga0395901_0033908 3300038443 Bacteria 5271
400 Ga0395901_0100974 3300038443 Bacteria 3027
401 Ga0395901_0107127 3300038443 Bacteria 2933
402 Ga0395901_0130050 3300038443 Bacteria 2645
403 Ga0395901_0276186 3300038443 Bacteria 1747
404 Ga0395901_0284625 3300038443 Bacteria 1717
405 Ga0395901_0469167 3300038443 Bacteria 1285
406 Ga0395901_0660439 3300038443 Bacteria 1047
407 Ga0395901_0681680 3300038443 Bacteria 1027
408 Ga0436365_0862833 3300039437 Bacteria 88455
409 Ga0436365_1276851 3300039437 Bacteria 2107
410 Ga0436363_0877393 3300039450 Bacteria 772
411 Ga0436363_1313966 3300039450 Bacteria 1112
412 Ga0436362_0949954 3300039453 Bacteria 89092
413 Ga0436362_1016233 3300039453 Bacteria 760
414 Ga0451802_0480640 3300041460 Bacteria 2188
415 Ga0451806_796222 3300041462 Bacteria 1232
416 Ga0451853_0965935 3300041512 Bacteria 1334
417 Ga0439443_020008 3300042003 Bacteria 1048
418 Ga0439452_042753 3300042010 Bacteria 1061
419 Ga0439452_077487 3300042010 Bacteria 727
420 Ga0450912_000227 3300042116 Bacteria 2406
421 Ga0450890_021680 3300042127 Bacteria 875
422 Ga0451577_0000068 3300042876 Bacteria 241923
423 Ga0466969_0072817 3300044656 Bacteria 1649
424 Ga0466969_0081006 3300044656 Bacteria 1550
425 Ga0466972_0064805 3300044658 Bacteria 1748
426 Ga0466972_0117367 3300044658 Bacteria 1256
427 Ga0466965_0059215 3300044683 Bacteria 1911
428 Ga0466965_0162284 3300044683 Bacteria 1172
429 Ga0466965_0410688 3300044683 Bacteria 749
430 Ga0466966_0000282 3300044684 Bacteria 33331
431 Ga0466966_0003557 3300044684 Bacteria 10278
432 Ga0466966_0188081 3300044684 Bacteria 1252
433 Ga0466961_0007560 3300044693 Bacteria 6917
434 Ga0466961_0027126 3300044693 Bacteria 3682
435 Ga0466961_0045922 3300044693 Bacteria 2794
436 Ga0466961_0226168 3300044693 Bacteria 1152
437 Ga0466961_0465643 3300044693 Bacteria 764
438 Ga0466963_0004048 3300044694 Bacteria 8483
439 Ga0466963_0009815 3300044694 Bacteria 5778
440 Ga0466963_0034334 3300044694 Bacteria 3299
441 Ga0466964_0005827 3300044706 Bacteria 4585
442 Ga0453684_0000126 3300044712 Bacteria 336395
443 Ga0466971_0017635 3300044719 Bacteria 3160
444 Ga0466971_0333093 3300044719 Bacteria 732
445 Ga0466970_0042569 3300044765 Bacteria 2415
446 Ga0466957_0009505 3300044842 Bacteria 5551
447 Ga0466957_0137558 3300044842 Archaea 1571
448 Ga0466957_0156758 3300044842 Bacteria 1476
449 Ga0466957_0397047 3300044842 Bacteria 943
450 Ga0466957_0414293 3300044842 Bacteria 923
451 Ga0466960_0043862 3300044901 Bacteria 2130
452 Ga0466959_0004747 3300045049 Bacteria 9155
453 Ga0466959_0229100 3300045049 Bacteria 1286
454 Ga0466959_0259819 3300045049 Bacteria 1195
455 Ga0466959_0531699 3300045049 Bacteria 794
456 Ga0451576_0003891 3300045051 Bacteria 19977
457 Ga0466958_0000394 3300045836 Bacteria 17873
458 Ga0466958_0067133 3300045836 Bacteria 2190
459 Ga0466967_0252055 3300045976 Bacteria 1686
460 Ga0466967_1087574 3300045976 Unclassified 797
461 Ga0495627_015820 3300046453 Bacteria 2598
462 Ga0495627_044654 3300046453 Bacteria 1352
463 Ga0495627_104078 3300046453 Bacteria 808
464 Ga0495590_0000004 3300046457 Bacteria 402091
465 Ga0495638_0000366 3300046460 Bacteria 55970
466 Ga0495650_0000169 3300046471 Bacteria 145238
467 Ga0495650_0009581 3300046471 Bacteria 5494
468 Ga0495580_0229445 3300046472 Bacteria 1275
469 Ga0495605_0024767 3300046474 Bacteria 3136
470 Ga0495639_0013763 3300046475 Bacteria 3498
471 Ga0495584_0010554 3300046491 Bacteria 4744
472 Ga0495585_0007599 3300046492 Bacteria 6621
473 Ga0495585_0067026 3300046492 Bacteria 1964
474 Ga0495596_0000149 3300046500 Bacteria 48579
475 Ga0495596_0042260 3300046500 Bacteria 1796
476 Ga0495607_0001291 3300046501 Bacteria 22407
477 Ga0495607_0035309 3300046501 Bacteria 3025
478 Ga0495583_0000431 3300046506 Bacteria 63149
479 Ga0495583_0000508 3300046506 Bacteria 55961
480 Ga0495606_0000713 3300046507 Bacteria 51369
481 Ga0495606_0002943 3300046507 Bacteria 18804
482 Ga0495606_0007026 3300046507 Bacteria 10207
483 Ga0495606_0018274 3300046507 Bacteria 5264
484 Ga0495610_0003102 3300046512 Bacteria 13240
485 Ga0495610_0021105 3300046512 Bacteria 3590
486 Ga0495610_0145563 3300046512 Bacteria 1015
487 Ga0495616_0056758 3300046513 Bacteria 1932
488 Ga0495631_0053468 3300046518 Bacteria 1762
489 Ga0495632_0002076 3300046519 Bacteria 15693
490 Ga0495632_0198445 3300046519 Bacteria 915
491 Ga0495643_0000425 3300046522 Bacteria 54854
492 Ga0495644_0158835 3300046523 Bacteria 866
493 Ga0495648_0000045 3300046524 Bacteria 172587
494 Ga0495642_0005275 3300046528 Bacteria 4966
495 Ga0495642_0041598 3300046528 Bacteria 1869
496 Ga0495642_0046273 3300046528 Bacteria 1780
497 Ga0495609_0012718 3300046538 Bacteria 3988
498 Ga0495609_0059979 3300046538 Bacteria 1682
499 Ga0495597_0002143 3300046542 Bacteria 13043
500 Ga0495597_0002409 3300046542 Bacteria 11906
501 Ga0495597_0072048 3300046542 Bacteria 1487
502 Ga0495597_0083722 3300046542 Bacteria 1361
503 Ga0495622_0000003 3300046557 Bacteria 268681
504 Ga0495622_0001233 3300046557 Bacteria 13132
505 Ga0495633_0000113 3300046558 Bacteria 109307
506 Ga0495633_0000356 3300046558 Bacteria 49639
507 Ga0495633_0005368 3300046558 Bacteria 7860
508 Ga0495633_0019395 3300046558 Bacteria 3440
509 Ga0495633_0031382 3300046558 Bacteria 2576
510 Ga0495668_0000369 3300046616 Bacteria 59509
511 Ga0495668_0001920 3300046616 Bacteria 18482
512 Ga0495668_0042967 3300046616 Bacteria 2514
513 Ga0495611_0017036 3300046648 Bacteria 3106
514 Ga0495625_0004323 3300046660 Bacteria 13489
515 Ga0495625_0042922 3300046660 Bacteria 3283
516 Ga0495661_0191240 3300046665 Bacteria 1077
517 Ga0495661_0344232 3300046665 Bacteria 735
518 Ga0495669_0007706 3300046684 Bacteria 4519
519 Ga0495669_0011202 3300046684 Bacteria 3804
520 Ga0495669_0094217 3300046684 Bacteria 1386
521 Ga0495670_0020640 3300046691 Bacteria 3249
522 Ga0495671_0025873 3300046692 Bacteria 3047
523 Ga0495649_0177970 3300046694 Bacteria 1110
524 Ga0495589_0054285 3300046794 Bacteria 1976
525 Ga0495660_0002893 3300046810 Bacteria 10779
526 Ga0495660_0004832 3300046810 Bacteria 8130
527 Ga0495683_0033438 3300047323 Bacteria 2616
528 Ga0495687_003314 3300047443 Bacteria 11811
529 Ga0495687_008410 3300047443 Bacteria 5909
530 Ga0495677_0009316 3300047445 Bacteria 3628
531 Ga0495677_0063320 3300047445 Bacteria 1373
532 Ga0495679_001444 3300047446 Bacteria 13471
533 Ga0495681_0004629 3300047470 Bacteria 9332
534 Ga0495681_0014546 3300047470 Bacteria 4502
535 Ga0495615_0030665 3300048090 Bacteria 1285
536 Ga0495626_0006858 3300048091 Bacteria 6426
537 Ga0495626_0031132 3300048091 Bacteria 2569
538 Ga0496101_0085317 3300048904 Bacteria 2340
539 Ga0496101_0230788 3300048904 Bacteria 1438
540 Ga0496102_0185148 3300048905 Bacteria 1962
541 Ga0496102_0284087 3300048905 Bacteria 1560
542 Ga0496104_0011189 3300048907 Bacteria 8028
543 Ga0496104_0020209 3300048907 Bacteria 6101
544 Ga0496106_0000685 3300048909 Bacteria 24284
545 Ga0496107_0003034 3300048910 Bacteria 11130
546 Ga0496108_0217229 3300048911 Bacteria 1660
547 Ga0496108_0921023 3300048911 Bacteria 749
548 Ga0496109_0462263 3300048912 Bacteria 1198
549 Ga0496109_0544385 3300048912 Bacteria 1095
550 Ga0496110_0443558 3300048913 Bacteria 1183
551 Ga0496110_0581876 3300048913 Bacteria 1016
552 Ga0496111_0070902 3300048914 Unclassified 2536
553 Ga0496111_0355263 3300048914 Bacteria 1085
554 Ga0496111_0700494 3300048914 Bacteria 737
555 Ga0496112_0004292 3300048915 Bacteria 12040
556 Ga0496112_0018585 3300048915 Bacteria 6549
557 Ga0496112_0414468 3300048915 Bacteria 1286
558 Ga0496113_0001740 3300048916 Bacteria 12330
559 Ga0496114_0045527 3300048917 Bacteria 3645
560 Ga0496114_0626346 3300048917 Bacteria 948
561 Ga0496115_0000691 3300048918 Bacteria 25050
562 Ga0496115_0602607 3300048918 Bacteria 873
563 Ga0496116_0239798 3300048919 Bacteria 912
564 Ga0496117_0061452 3300048920 Bacteria 2582
565 Ga0496121_0000520 3300048924 Bacteria 73411
566 Ga0496124_0093521 3300048927 Bacteria 2447
567 Ga0496126_0022079 3300048929 Bacteria 6200
568 Ga0495678_017193 3300049459 Bacteria 3284
569 Ga0495678_099218 3300049459 Bacteria 1012
570 Ga0501290_003097 3300049513 Bacteria 2110
571 Ga0501292_000035 3300049515 Bacteria 33554
572 Ga0501294_000145 3300049517 Bacteria 8361
573 Ga0501300_000782 3300049523 Bacteria 4817
574 Ga0501300_001219 3300049523 Bacteria 3909
575 Ga0501067_0084117 3300049583 Bacteria 1765
576 Ga0501069_0442926 3300049585 Bacteria 772
577 Ga0501202_021011 3300049652 Bacteria 1301
578 Ga0501222_001052 3300049662 Bacteria 3915
579 Ga0501223_000384 3300049663 Bacteria 10906
580 Ga0501224_000065 3300049664 Bacteria 11865
581 Ga0501227_002342 3300049665 Bacteria 4196
582 Ga0501233_000527 3300049668 Bacteria 6145
583 Ga0501235_007630 3300049669 Bacteria 2357
584 Ga0501257_000008 3300049686 Bacteria 54624
585 Ga0501259_000065 3300049688 Bacteria 14592
586 Ga0501261_000039 3300049690 Bacteria 25955
587 Ga0501221_012099 3300049704 Bacteria 1565
588 Ga0501225_0000627 3300049705 Bacteria 11003
589 Ga0501264_002229 3300049761 Bacteria 1830
590 Ga0501279_000033 3300049775 Bacteria 33688
591 Ga0501280_000826 3300049776 Bacteria 6705
592 Ga0501281_00024 3300049777 Bacteria 18869
593 Ga0501282_000686 3300049778 Bacteria 3884
594 Ga0501283_000175 3300049779 Bacteria 8357
595 Ga0500578_0335973 3300053086 Bacteria 887
596 Ga0500641_0002371 3300053096 Bacteria 6672
597 Ga0500594_0009845 3300053118 Bacteria 2207
598 Ga0500595_000916 3300053119 Bacteria 16804
599 Ga0500658_0016262 3300053134 Bacteria 2770
600 Ga0500568_0000245 3300053139 Bacteria 46212
601 Ga0500586_000367 3300053145 Bacteria 8966
602 Ga0590071_062151 3300059421 Unclassified 914
603 Ga0466962_0010328 3300061719 Bacteria 4484
604 Ga0466962_0156633 3300061719 Bacteria 1106

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031507 Ga0307509_10022123 Ga0307509_100221236 175
2 3300005336 Ga0070680_100019131 Ga0070680_1000191313 177
3 3300005337 Ga0070682_100575233 Ga0070682_1005752331 177
4 3300005455 Ga0070663_100081426 Ga0070663_1000814263 177
5 3300005458 Ga0070681_10010375 Ga0070681_1001037511 177
6 3300005539 Ga0068853_100190509 Ga0068853_1001905092 177
7 3300005564 Ga0070664_100009697 Ga0070664_1000096973 177
8 3300005578 Ga0068854_100609855 Ga0068854_1006098552 177
9 3300005614 Ga0068856_100541755 Ga0068856_1005417552 177
10 3300005616 Ga0068852_100094527 Ga0068852_1000945272 177
11 3300013100 Ga0157373_10119088 Ga0157373_101190882 177
12 3300025909 Ga0207705_10007630 Ga0207705_100076309 177
13 3300025912 Ga0207707_10033033 Ga0207707_100330332 177
14 3300025917 Ga0207660_10064336 Ga0207660_100643362 177
15 3300025919 Ga0207657_10006383 Ga0207657_100063837 177
16 3300025921 Ga0207652_10014570 Ga0207652_100145702 177
17 3300025945 Ga0207679_10019935 Ga0207679_100199352 177
18 3300044683 Ga0466965_0410688 Ga0466965_0410688_166_729 187
19 3300025923 Ga0207681_10340994 Ga0207681_103409942 190
20 3300005327 Ga0070658_10006059 Ga0070658_100060598 194
21 3300005345 Ga0070692_10203099 Ga0070692_102030992 194
22 3300013104 Ga0157370_10153077 Ga0157370_101530772 194
23 3300037418 Ga0395900_0008912 Ga0395900_0008912_6755_7387 195
24 3300037471 Ga0395905_0000104 Ga0395905_0000104_5329_5961 195
25 3300039437 Ga0436365_1276851 Ga0436365_1276851_15_602 195
26 3300044683 Ga0466965_0162284 Ga0466965_0162284_462_1097 196
27 3300048918 Ga0496115_0602607 Ga0496115_0602607_238_855 197
28 3300005329 Ga0070683_100144414 Ga0070683_1001444143 198
29 3300005331 Ga0070670_100403694 Ga0070670_1004036942 198
30 3300005333 Ga0070677_10323012 Ga0070677_103230122 198
31 3300005344 Ga0070661_100828975 Ga0070661_1008289751 198
32 3300005353 Ga0070669_100418620 Ga0070669_1004186202 198
33 3300005366 Ga0070659_100105485 Ga0070659_1001054851 198
34 3300005455 Ga0070663_100029938 Ga0070663_1000299382 198
35 3300005457 Ga0070662_100082516 Ga0070662_1000825162 198
36 3300005458 Ga0070681_10121944 Ga0070681_101219442 198
37 3300005530 Ga0070679_100062631 Ga0070679_1000626312 198
38 3300005535 Ga0070684_100320958 Ga0070684_1003209582 198
39 3300005617 Ga0068859_100005794 Ga0068859_10000579412 198
40 3300005842 Ga0068858_100001349 Ga0068858_10000134912 198
41 3300005844 Ga0068862_100212388 Ga0068862_1002123882 198
42 3300006931 Ga0097620_100005794 Ga0097620_10000579412 198
43 3300009094 Ga0111539_10352557 Ga0111539_103525572 198
44 3300013100 Ga0157373_10026122 Ga0157373_100261224 198
45 3300025893 Ga0207682_10133001 Ga0207682_101330012 198
46 3300025923 Ga0207681_10219583 Ga0207681_102195832 198
47 3300025925 Ga0207650_10333360 Ga0207650_103333602 198
48 3300025932 Ga0207690_10035199 Ga0207690_100351993 198
49 3300025933 Ga0207706_10000475 Ga0207706_1000047535 198
50 3300025933 Ga0207706_10356918 Ga0207706_103569182 198
51 3300025941 Ga0207711_10051635 Ga0207711_100516353 198
52 3300025944 Ga0207661_10116126 Ga0207661_101161262 198
53 3300025986 Ga0207658_10124621 Ga0207658_101246213 198
54 3300026035 Ga0207703_10001781 Ga0207703_100017814 198
55 3300026067 Ga0207678_10000740 Ga0207678_1000074021 198
56 3300031548 Ga0307408_100023382 Ga0307408_1000233823 198
57 3300031548 Ga0307408_100531482 Ga0307408_1005314822 198
58 3300031731 Ga0307405_10002876 Ga0307405_100028765 198
59 3300031731 Ga0307405_10582705 Ga0307405_105827052 198
60 3300031824 Ga0307413_10055139 Ga0307413_100551392 198
61 3300031901 Ga0307406_10078339 Ga0307406_100783392 198
62 3300031901 Ga0307406_10770431 Ga0307406_107704312 198
63 3300031911 Ga0307412_10015387 Ga0307412_100153873 198
64 3300031995 Ga0307409_101019903 Ga0307409_1010199032 198
65 3300032002 Ga0307416_100806633 Ga0307416_1008066332 198
66 3300032126 Ga0307415_100037701 Ga0307415_1000377013 198
67 3300035725 Ga0373947_0201025 Ga0373947_0201025_242_868 198
68 3300037068 Ga0373925_0452155 Ga0373925_0452155_330_956 198
69 3300037312 Ga0395899_0114793 Ga0395899_0114793_934_1560 198
70 3300037418 Ga0395900_0036937 Ga0395900_0036937_3476_4102 198
71 3300037466 Ga0395898_0010805 Ga0395898_0010805_6058_6684 198
72 3300037471 Ga0395905_0053493 Ga0395905_0053493_1918_2544 198
73 3300038443 Ga0395901_0028167 Ga0395901_0028167_934_1560 198
74 3300042010 Ga0439452_077487 Ga0439452_077487_69_692 198
75 3300048912 Ga0496109_0544385 Ga0496109_0544385_269_907 198
76 3300048913 Ga0496110_0443558 Ga0496110_0443558_291_929 198
77 3300048917 Ga0496114_0045527 Ga0496114_0045527_838_1476 198
78 3300048919 Ga0496116_0239798 Ga0496116_0239798_224_850 198
79 3300048927 Ga0496124_0093521 Ga0496124_0093521_767_1405 198
80 3300048929 Ga0496126_0022079 Ga0496126_0022079_1928_2566 198
81 3300053096 Ga0500641_0002371 Ga0500641_0002371_853_1479 198
82 3300053119 Ga0500595_000916 Ga0500595_000916_3697_4323 198
83 3300005327 Ga0070658_10006506 Ga0070658_100065068 199
84 3300005327 Ga0070658_10012808 Ga0070658_100128085 199
85 3300005327 Ga0070658_10297615 Ga0070658_102976152 199
86 3300005328 Ga0070676_10131453 Ga0070676_101314532 199
87 3300005331 Ga0070670_100025931 Ga0070670_1000259313 199
88 3300005331 Ga0070670_100055618 Ga0070670_1000556182 199
89 3300005333 Ga0070677_10024733 Ga0070677_100247331 199
90 3300005336 Ga0070680_100001008 Ga0070680_10000100815 199
91 3300005336 Ga0070680_100219621 Ga0070680_1002196211 199
92 3300005337 Ga0070682_100063720 Ga0070682_1000637202 199
93 3300005339 Ga0070660_100002984 Ga0070660_1000029847 199
94 3300005339 Ga0070660_100004103 Ga0070660_1000041034 199
95 3300005339 Ga0070660_100119596 Ga0070660_1001195963 199
96 3300005339 Ga0070660_100625317 Ga0070660_1006253172 199
97 3300005344 Ga0070661_100000055 Ga0070661_10000005543 199
98 3300005345 Ga0070692_10105586 Ga0070692_101055862 199
99 3300005347 Ga0070668_100141220 Ga0070668_1001412202 199
100 3300005347 Ga0070668_100692406 Ga0070668_1006924062 199
101 3300005353 Ga0070669_100359985 Ga0070669_1003599852 199
102 3300005354 Ga0070675_100035280 Ga0070675_1000352802 199
103 3300005354 Ga0070675_100096026 Ga0070675_1000960262 199
104 3300005355 Ga0070671_100082537 Ga0070671_1000825371 199
105 3300005364 Ga0070673_100172043 Ga0070673_1001720431 199
106 3300005435 Ga0070714_100042960 Ga0070714_1000429602 199
107 3300005455 Ga0070663_100560873 Ga0070663_1005608731 199
108 3300005456 Ga0070678_100243741 Ga0070678_1002437412 199
109 3300005530 Ga0070679_100000027 Ga0070679_10000002747 199
110 3300005530 Ga0070679_100400093 Ga0070679_1004000932 199
111 3300005543 Ga0070672_100038689 Ga0070672_1000386894 199
112 3300005547 Ga0070693_100552621 Ga0070693_1005526212 199
113 3300005548 Ga0070665_100014746 Ga0070665_1000147464 199
114 3300005563 Ga0068855_100004220 Ga0068855_10000422013 199
115 3300005563 Ga0068855_100093581 Ga0068855_1000935812 199
116 3300005563 Ga0068855_100443236 Ga0068855_1004432361 199
117 3300005564 Ga0070664_100170628 Ga0070664_1001706282 199
118 3300005616 Ga0068852_100017135 Ga0068852_1000171356 199
119 3300005840 Ga0068870_10287341 Ga0068870_102873412 199
120 3300005841 Ga0068863_100014935 Ga0068863_1000149358 199
121 3300009177 Ga0105248_10001489 Ga0105248_1000148921 199
122 3300009177 Ga0105248_10100588 Ga0105248_101005883 199
123 3300009551 Ga0105238_10086527 Ga0105238_100865272 199
124 3300013100 Ga0157373_10076934 Ga0157373_100769343 199
125 3300013100 Ga0157373_10446998 Ga0157373_104469981 199
126 3300013102 Ga0157371_10034504 Ga0157371_100345042 199
127 3300013104 Ga0157370_10306174 Ga0157370_103061742 199
128 3300013308 Ga0157375_10491152 Ga0157375_104911522 199
129 3300014325 Ga0163163_10585406 Ga0163163_105854062 199
130 3300017792 Ga0163161_10316353 Ga0163161_103163532 199
131 3300020081 Ga0206354_10325713 Ga0206354_103257133 199
132 3300020081 Ga0206354_11360577 Ga0206354_113605773 199
133 3300020082 Ga0206353_10818709 Ga0206353_108187094 199
134 3300020082 Ga0206353_11812148 Ga0206353_118121482 199
135 3300021358 Ga0213873_10000006 Ga0213873_10000006160 199
136 3300021384 Ga0213876_10000004 Ga0213876_10000004666 199
137 3300025893 Ga0207682_10002744 Ga0207682_100027447 199
138 3300025907 Ga0207645_10121318 Ga0207645_101213182 199
139 3300025909 Ga0207705_10007767 Ga0207705_100077674 199
140 3300025909 Ga0207705_10042461 Ga0207705_100424613 199
141 3300025909 Ga0207705_10090152 Ga0207705_100901522 199
142 3300025909 Ga0207705_10234722 Ga0207705_102347222 199
143 3300025909 Ga0207705_10473438 Ga0207705_104734382 199
144 3300025909 Ga0207705_10475997 Ga0207705_104759972 199
145 3300025917 Ga0207660_10001023 Ga0207660_1000102310 199
146 3300025917 Ga0207660_10219710 Ga0207660_102197101 199
147 3300025919 Ga0207657_10000267 Ga0207657_1000026710 199
148 3300025919 Ga0207657_10002664 Ga0207657_100026644 199
149 3300025919 Ga0207657_10007939 Ga0207657_1000793911 199
150 3300025919 Ga0207657_10048214 Ga0207657_100482144 199
151 3300025919 Ga0207657_10340458 Ga0207657_103404582 199
152 3300025920 Ga0207649_10000103 Ga0207649_1000010344 199
153 3300025920 Ga0207649_10238036 Ga0207649_102380362 199
154 3300025921 Ga0207652_10000001 Ga0207652_10000001839 199
155 3300025921 Ga0207652_10356718 Ga0207652_103567182 199
156 3300025925 Ga0207650_10080246 Ga0207650_100802463 199
157 3300025925 Ga0207650_10096149 Ga0207650_100961492 199
158 3300025929 Ga0207664_10061161 Ga0207664_100611612 199
159 3300025931 Ga0207644_10000954 Ga0207644_1000095414 199
160 3300025931 Ga0207644_10049061 Ga0207644_100490612 199
161 3300025940 Ga0207691_10106398 Ga0207691_101063983 199
162 3300025940 Ga0207691_10245787 Ga0207691_102457872 199
163 3300025941 Ga0207711_10030857 Ga0207711_100308574 199
164 3300025941 Ga0207711_10179168 Ga0207711_101791682 199
165 3300025949 Ga0207667_10007813 Ga0207667_100078136 199
166 3300025949 Ga0207667_10031385 Ga0207667_100313852 199
167 3300025960 Ga0207651_10407276 Ga0207651_104072762 199
168 3300025972 Ga0207668_10167883 Ga0207668_101678832 199
169 3300025972 Ga0207668_10567673 Ga0207668_105676732 199
170 3300025981 Ga0207640_10931349 Ga0207640_109313491 199
171 3300025986 Ga0207658_10651867 Ga0207658_106518672 199
172 3300026067 Ga0207678_10056232 Ga0207678_100562322 199
173 3300026067 Ga0207678_10188974 Ga0207678_101889742 199
174 3300026078 Ga0207702_10552650 Ga0207702_105526502 199
175 3300026116 Ga0207674_10438284 Ga0207674_104382842 199
176 3300026142 Ga0207698_10017594 Ga0207698_100175942 199
177 3300028379 Ga0268266_10047306 Ga0268266_100473062 199
178 3300031548 Ga0307408_100047469 Ga0307408_1000474693 199
179 3300031731 Ga0307405_10913628 Ga0307405_109136282 199
180 3300031824 Ga0307413_10140686 Ga0307413_101406862 199
181 3300031852 Ga0307410_10074495 Ga0307410_100744952 199
182 3300031852 Ga0307410_10173605 Ga0307410_101736052 199
183 3300031852 Ga0307410_10352381 Ga0307410_103523812 199
184 3300031901 Ga0307406_10216754 Ga0307406_102167542 199
185 3300031901 Ga0307406_10432805 Ga0307406_104328052 199
186 3300031903 Ga0307407_10186153 Ga0307407_101861532 199
187 3300031911 Ga0307412_10836067 Ga0307412_108360671 199
188 3300031995 Ga0307409_100010794 Ga0307409_1000107946 199
189 3300031995 Ga0307409_100152813 Ga0307409_1001528133 199
190 3300031995 Ga0307409_100579331 Ga0307409_1005793312 199
191 3300031995 Ga0307409_100861559 Ga0307409_1008615592 199
192 3300032002 Ga0307416_100011585 Ga0307416_1000115853 199
193 3300032004 Ga0307414_10034656 Ga0307414_100346563 199
194 3300032004 Ga0307414_10293495 Ga0307414_102934952 199
195 3300032005 Ga0307411_10053530 Ga0307411_100535302 199
196 3300032005 Ga0307411_10128706 Ga0307411_101287062 199
197 3300032005 Ga0307411_10278246 Ga0307411_102782462 199
198 3300037312 Ga0395899_0005357 Ga0395899_0005357_1840_2469 199
199 3300037312 Ga0395899_0047284 Ga0395899_0047284_847_1476 199
200 3300037312 Ga0395899_0052302 Ga0395899_0052302_1102_1731 199
201 3300037312 Ga0395899_0052687 Ga0395899_0052687_12_641 199
202 3300037418 Ga0395900_0000447 Ga0395900_0000447_51607_52236 199
203 3300037418 Ga0395900_0051071 Ga0395900_0051071_1527_2156 199
204 3300037418 Ga0395900_0168699 Ga0395900_0168699_516_1145 199
205 3300037418 Ga0395900_0284498 Ga0395900_0284498_768_1397 199
206 3300037418 Ga0395900_0815249 Ga0395900_0815249_138_767 199
207 3300037466 Ga0395898_0005900 Ga0395898_0005900_8450_9079 199
208 3300037466 Ga0395898_0086695 Ga0395898_0086695_615_1244 199
209 3300037466 Ga0395898_0244801 Ga0395898_0244801_430_1059 199
210 3300037466 Ga0395898_0942699 Ga0395898_0942699_34_663 199
211 3300037471 Ga0395905_0070723 Ga0395905_0070723_1152_1781 199
212 3300037471 Ga0395905_0180539 Ga0395905_0180539_1037_1666 199
213 3300037471 Ga0395905_0219723 Ga0395905_0219723_510_1139 199
214 3300037471 Ga0395905_0230377 Ga0395905_0230377_170_799 199
215 3300037471 Ga0395905_0682445 Ga0395905_0682445_29_658 199
216 3300038443 Ga0395901_0000324 Ga0395901_0000324_51639_52268 199
217 3300038443 Ga0395901_0100974 Ga0395901_0100974_1903_2532 199
218 3300038443 Ga0395901_0107127 Ga0395901_0107127_2117_2746 199
219 3300038443 Ga0395901_0130050 Ga0395901_0130050_993_1622 199
220 3300038443 Ga0395901_0284625 Ga0395901_0284625_500_1129 199
221 3300038443 Ga0395901_0469167 Ga0395901_0469167_548_1177 199
222 3300038443 Ga0395901_0660439 Ga0395901_0660439_281_910 199
223 3300038443 Ga0395901_0681680 Ga0395901_0681680_65_694 199
224 3300039437 Ga0436365_0862833 Ga0436365_0862833_67140_67769 199
225 3300039450 Ga0436363_0877393 Ga0436363_0877393_91_720 199
226 3300039450 Ga0436363_1313966 Ga0436363_1313966_365_994 199
227 3300039453 Ga0436362_0949954 Ga0436362_0949954_36095_36724 199
228 3300042127 Ga0450890_021680 Ga0450890_021680_79_708 199
229 3300044658 Ga0466972_0064805 Ga0466972_0064805_754_1383 199
230 3300044684 Ga0466966_0188081 Ga0466966_0188081_604_1233 199
231 3300044693 Ga0466961_0007560 Ga0466961_0007560_1938_2567 199
232 3300044693 Ga0466961_0226168 Ga0466961_0226168_10_663 199
233 3300044842 Ga0466957_0137558 Ga0466957_0137558_622_1251 199
234 3300045049 Ga0466959_0531699 Ga0466959_0531699_50_679 199
235 3300045976 Ga0466967_1087574 Ga0466967_1087574_57_686 199
236 3300048911 Ga0496108_0217229 Ga0496108_0217229_487_1116 199
237 3300048912 Ga0496109_0462263 Ga0496109_0462263_243_872 199
238 3300048914 Ga0496111_0355263 Ga0496111_0355263_116_745 199
239 3300048914 Ga0496111_0700494 Ga0496111_0700494_62_691 199
240 3300048915 Ga0496112_0004292 Ga0496112_0004292_11108_11737 199
241 3300048915 Ga0496112_0018585 Ga0496112_0018585_4764_5393 199
242 3300049583 Ga0501067_0084117 Ga0501067_0084117_776_1405 199
243 3300049585 Ga0501069_0442926 Ga0501069_0442926_78_752 199
244 3300053118 Ga0500594_0009845 Ga0500594_0009845_1486_2115 199
245 3300059421 Ga0590071_062151 Ga0590071_062151_127_756 199
246 3300005329 Ga0070683_100379534 Ga0070683_1003795342 200
247 3300005339 Ga0070660_100121490 Ga0070660_1001214902 200
248 3300005339 Ga0070660_100208906 Ga0070660_1002089062 200
249 3300005344 Ga0070661_100051101 Ga0070661_1000511013 200
250 3300005355 Ga0070671_100160172 Ga0070671_1001601721 200
251 3300005435 Ga0070714_100270690 Ga0070714_1002706901 200
252 3300005455 Ga0070663_100228393 Ga0070663_1002283932 200
253 3300005563 Ga0068855_100009899 Ga0068855_1000098996 200
254 3300005564 Ga0070664_100028729 Ga0070664_1000287296 200
255 3300005577 Ga0068857_100186676 Ga0068857_1001866763 200
256 3300005614 Ga0068856_100014100 Ga0068856_1000141006 200
257 3300005614 Ga0068856_100204867 Ga0068856_1002048672 200
258 3300005614 Ga0068856_100518261 Ga0068856_1005182612 200
259 3300005614 Ga0068856_100636101 Ga0068856_1006361012 200
260 3300005616 Ga0068852_100005882 Ga0068852_1000058827 200
261 3300005616 Ga0068852_100937669 Ga0068852_1009376692 200
262 3300009093 Ga0105240_10022230 Ga0105240_100222306 200
263 3300009093 Ga0105240_10078780 Ga0105240_100787805 200
264 3300009093 Ga0105240_10670175 Ga0105240_106701752 200
265 3300009177 Ga0105248_10448372 Ga0105248_104483722 200
266 3300009551 Ga0105238_10344433 Ga0105238_103444332 200
267 3300010375 Ga0105239_10025225 Ga0105239_100252258 200
268 3300013100 Ga0157373_10031719 Ga0157373_100317192 200
269 3300013102 Ga0157371_10034327 Ga0157371_100343273 200
270 3300013102 Ga0157371_10098003 Ga0157371_100980032 200
271 3300013102 Ga0157371_10135738 Ga0157371_101357381 200
272 3300013102 Ga0157371_10226498 Ga0157371_102264982 200
273 3300013104 Ga0157370_10073881 Ga0157370_100738812 200
274 3300013104 Ga0157370_10117344 Ga0157370_101173442 200
275 3300013104 Ga0157370_10217418 Ga0157370_102174182 200
276 3300013105 Ga0157369_10018913 Ga0157369_100189136 200
277 3300013105 Ga0157369_10404817 Ga0157369_104048172 200
278 3300013105 Ga0157369_10521749 Ga0157369_105217491 200
279 3300013105 Ga0157369_10521750 Ga0157369_105217501 200
280 3300013105 Ga0157369_10736385 Ga0157369_107363851 200
281 3300013296 Ga0157374_10005525 Ga0157374_100055259 200
282 3300013296 Ga0157374_10140292 Ga0157374_101402923 200
283 3300013307 Ga0157372_10383950 Ga0157372_103839502 200
284 3300025904 Ga0207647_10082289 Ga0207647_100822892 200
285 3300025909 Ga0207705_10000945 Ga0207705_1000094518 200
286 3300025909 Ga0207705_10039385 Ga0207705_100393852 200
287 3300025909 Ga0207705_10161699 Ga0207705_101616992 200
288 3300025909 Ga0207705_10483991 Ga0207705_104839911 200
289 3300025913 Ga0207695_10001533 Ga0207695_100015338 200
290 3300025919 Ga0207657_10043824 Ga0207657_100438244 200
291 3300025920 Ga0207649_10000538 Ga0207649_1000053818 200
292 3300025920 Ga0207649_10067246 Ga0207649_100672463 200
293 3300025932 Ga0207690_10007847 Ga0207690_100078473 200
294 3300025932 Ga0207690_10573795 Ga0207690_105737952 200
295 3300025945 Ga0207679_10335679 Ga0207679_103356792 200
296 3300025949 Ga0207667_10022805 Ga0207667_100228054 200
297 3300025981 Ga0207640_10000469 Ga0207640_1000046919 200
298 3300025981 Ga0207640_10027615 Ga0207640_100276152 200
299 3300026067 Ga0207678_10013949 Ga0207678_100139493 200
300 3300026067 Ga0207678_10014499 Ga0207678_100144994 200
301 3300026067 Ga0207678_10595530 Ga0207678_105955301 200
302 3300026078 Ga0207702_10022914 Ga0207702_100229146 200
303 3300026078 Ga0207702_10052756 Ga0207702_100527562 200
304 3300026078 Ga0207702_10063312 Ga0207702_100633123 200
305 3300026116 Ga0207674_10109149 Ga0207674_101091493 200
306 3300026116 Ga0207674_10160076 Ga0207674_101600763 200
307 3300026142 Ga0207698_10027096 Ga0207698_100270963 200
308 3300028379 Ga0268266_10664009 Ga0268266_106640092 200
309 3300031241 Ga0265325_10166712 Ga0265325_101667122 200
310 3300031249 Ga0265339_10283867 Ga0265339_102838671 200
311 3300031548 Ga0307408_100203229 Ga0307408_1002032292 200
312 3300031727 Ga0316576_10139354 Ga0316576_101393542 200
313 3300031731 Ga0307405_10020772 Ga0307405_100207724 200
314 3300031731 Ga0307405_10024801 Ga0307405_100248012 200
315 3300031731 Ga0307405_10038511 Ga0307405_100385113 200
316 3300031731 Ga0307405_10135107 Ga0307405_101351072 200
317 3300031824 Ga0307413_10000144 Ga0307413_100001449 200
318 3300031824 Ga0307413_10010609 Ga0307413_100106095 200
319 3300031824 Ga0307413_10033408 Ga0307413_100334083 200
320 3300031824 Ga0307413_10341803 Ga0307413_103418032 200
321 3300031824 Ga0307413_10408038 Ga0307413_104080381 200
322 3300031852 Ga0307410_10000229 Ga0307410_1000022921 200
323 3300031852 Ga0307410_10009555 Ga0307410_100095555 200
324 3300031852 Ga0307410_10014749 Ga0307410_100147493 200
325 3300031852 Ga0307410_10073440 Ga0307410_100734404 200
326 3300031852 Ga0307410_11020024 Ga0307410_110200241 200
327 3300031901 Ga0307406_10009310 Ga0307406_100093104 200
328 3300031901 Ga0307406_10047226 Ga0307406_100472262 200
329 3300031903 Ga0307407_10003042 Ga0307407_100030429 200
330 3300031903 Ga0307407_10009558 Ga0307407_100095581 200
331 3300031903 Ga0307407_10113305 Ga0307407_101133052 200
332 3300031903 Ga0307407_10121059 Ga0307407_101210592 200
333 3300031911 Ga0307412_10007341 Ga0307412_100073414 200
334 3300031911 Ga0307412_10029057 Ga0307412_100290572 200
335 3300031911 Ga0307412_10146008 Ga0307412_101460082 200
336 3300031911 Ga0307412_10892251 Ga0307412_108922511 200
337 3300031995 Ga0307409_100000049 Ga0307409_10000004926 200
338 3300031995 Ga0307409_100023898 Ga0307409_1000238983 200
339 3300031995 Ga0307409_100024938 Ga0307409_1000249383 200
340 3300031995 Ga0307409_100064481 Ga0307409_1000644813 200
341 3300031995 Ga0307409_100176192 Ga0307409_1001761922 200
342 3300032002 Ga0307416_100014720 Ga0307416_1000147204 200
343 3300032002 Ga0307416_100137748 Ga0307416_1001377482 200
344 3300032002 Ga0307416_100270459 Ga0307416_1002704592 200
345 3300032002 Ga0307416_101043884 Ga0307416_1010438842 200
346 3300032004 Ga0307414_10000735 Ga0307414_100007357 200
347 3300032004 Ga0307414_10021051 Ga0307414_100210514 200
348 3300032004 Ga0307414_10045191 Ga0307414_100451914 200
349 3300032004 Ga0307414_10149878 Ga0307414_101498782 200
350 3300032005 Ga0307411_10000702 Ga0307411_100007029 200
351 3300032005 Ga0307411_10014921 Ga0307411_100149215 200
352 3300032005 Ga0307411_10040262 Ga0307411_100402622 200
353 3300032005 Ga0307411_10059763 Ga0307411_100597633 200
354 3300032005 Ga0307411_10331850 Ga0307411_103318502 200
355 3300032005 Ga0307411_10494714 Ga0307411_104947142 200
356 3300032005 Ga0307411_10528616 Ga0307411_105286162 200
357 3300032126 Ga0307415_100007655 Ga0307415_1000076554 200
358 3300032126 Ga0307415_100034422 Ga0307415_1000344222 200
359 3300032126 Ga0307415_100044609 Ga0307415_1000446092 200
360 3300032126 Ga0307415_100882078 Ga0307415_1008820782 200
361 3300037312 Ga0395899_0012269 Ga0395899_0012269_5540_6172 200
362 3300037312 Ga0395899_0018651 Ga0395899_0018651_1006_1638 200
363 3300037312 Ga0395899_0026996 Ga0395899_0026996_1372_2004 200
364 3300037418 Ga0395900_0211034 Ga0395900_0211034_323_955 200
365 3300037418 Ga0395900_0431114 Ga0395900_0431114_261_893 200
366 3300037418 Ga0395900_0519761 Ga0395900_0519761_184_816 200
367 3300037418 Ga0395900_0589052 Ga0395900_0589052_146_778 200
368 3300037466 Ga0395898_0002889 Ga0395898_0002889_7223_7855 200
369 3300037466 Ga0395898_0018867 Ga0395898_0018867_2906_3538 200
370 3300037466 Ga0395898_0040488 Ga0395898_0040488_2626_3258 200
371 3300038443 Ga0395901_0033908 Ga0395901_0033908_3634_4266 200
372 3300038443 Ga0395901_0276186 Ga0395901_0276186_834_1466 200
373 3300042010 Ga0439452_042753 Ga0439452_042753_107_739 200
374 3300042116 Ga0450912_000227 Ga0450912_000227_936_1568 200
375 3300044656 Ga0466969_0072817 Ga0466969_0072817_328_960 200
376 3300044656 Ga0466969_0081006 Ga0466969_0081006_310_942 200
377 3300044684 Ga0466966_0000282 Ga0466966_0000282_21795_22427 200
378 3300044684 Ga0466966_0003557 Ga0466966_0003557_2448_3080 200
379 3300044693 Ga0466961_0045922 Ga0466961_0045922_1606_2238 200
380 3300044693 Ga0466961_0465643 Ga0466961_0465643_57_689 200
381 3300044694 Ga0466963_0004048 Ga0466963_0004048_7713_8345 200
382 3300044694 Ga0466963_0009815 Ga0466963_0009815_3501_4133 200
383 3300044719 Ga0466971_0017635 Ga0466971_0017635_2250_2882 200
384 3300044719 Ga0466971_0333093 Ga0466971_0333093_22_654 200
385 3300044765 Ga0466970_0042569 Ga0466970_0042569_682_1314 200
386 3300044842 Ga0466957_0009505 Ga0466957_0009505_2863_3495 200
387 3300044842 Ga0466957_0397047 Ga0466957_0397047_79_711 200
388 3300044842 Ga0466957_0414293 Ga0466957_0414293_160_792 200
389 3300045049 Ga0466959_0229100 Ga0466959_0229100_65_697 200
390 3300045049 Ga0466959_0259819 Ga0466959_0259819_499_1131 200
391 3300045836 Ga0466958_0000394 Ga0466958_0000394_4972_5604 200
392 3300046512 Ga0495610_0021105 Ga0495610_0021105_2524_3156 200
393 3300046684 Ga0495669_0011202 Ga0495669_0011202_1828_2460 200
394 3300048904 Ga0496101_0085317 Ga0496101_0085317_1301_1933 200
395 3300048913 Ga0496110_0581876 Ga0496110_0581876_112_744 200
396 3300048914 Ga0496111_0070902 Ga0496111_0070902_1535_2167 200
397 3300048915 Ga0496112_0414468 Ga0496112_0414468_564_1196 200
398 3300048918 Ga0496115_0000691 Ga0496115_0000691_2911_3543 200
399 3300061719 Ga0466962_0156633 Ga0466962_0156633_458_1090 200
400 3300005544 Ga0070686_100002270 Ga0070686_1000022704 201
401 3300006358 Ga0068871_100606190 Ga0068871_1006061902 201
402 3300021358 Ga0213873_10092942 Ga0213873_100929422 201
403 3300028379 Ga0268266_10000061 Ga0268266_10000061109 201
404 3300028379 Ga0268266_10502576 Ga0268266_105025762 201
405 3300031548 Ga0307408_100246058 Ga0307408_1002460582 201
406 3300031824 Ga0307413_10407692 Ga0307413_104076922 201
407 3300031852 Ga0307410_10137309 Ga0307410_101373092 201
408 3300031903 Ga0307407_10100640 Ga0307407_101006402 201
409 3300031995 Ga0307409_100154897 Ga0307409_1001548973 201
410 3300039453 Ga0436362_1016233 Ga0436362_1016233_48_683 201
411 3300046542 Ga0495597_0083722 Ga0495597_0083722_608_1246 201
412 3300048917 Ga0496114_0626346 Ga0496114_0626346_10_660 201
413 3300049513 Ga0501290_003097 Ga0501290_003097_306_941 201
414 3300049515 Ga0501292_000035 Ga0501292_000035_19985_20620 201
415 3300049517 Ga0501294_000145 Ga0501294_000145_5378_6013 201
416 3300049523 Ga0501300_000782 Ga0501300_000782_3623_4258 201
417 3300049652 Ga0501202_021011 Ga0501202_021011_306_941 201
418 3300049662 Ga0501222_001052 Ga0501222_001052_1331_1966 201
419 3300049663 Ga0501223_000384 Ga0501223_000384_411_1046 201
420 3300049664 Ga0501224_000065 Ga0501224_000065_1773_2408 201
421 3300049665 Ga0501227_002342 Ga0501227_002342_1450_2085 201
422 3300049668 Ga0501233_000527 Ga0501233_000527_2913_3548 201
423 3300049669 Ga0501235_007630 Ga0501235_007630_553_1188 201
424 3300049688 Ga0501259_000065 Ga0501259_000065_1728_2363 201
425 3300049690 Ga0501261_000039 Ga0501261_000039_13010_13645 201
426 3300049704 Ga0501221_012099 Ga0501221_012099_86_721 201
427 3300049705 Ga0501225_0000627 Ga0501225_0000627_3964_4599 201
428 3300049761 Ga0501264_002229 Ga0501264_002229_556_1191 201
429 3300049775 Ga0501279_000033 Ga0501279_000033_13045_13680 201
430 3300049776 Ga0501280_000826 Ga0501280_000826_1808_2443 201
431 3300049777 Ga0501281_00024 Ga0501281_00024_4375_5010 201
432 3300049778 Ga0501282_000686 Ga0501282_000686_585_1220 201
433 3300049779 Ga0501283_000175 Ga0501283_000175_1441_2076 201
434 3300053086 Ga0500578_0335973 Ga0500578_0335973_116_754 201
435 3300053139 Ga0500568_0000245 Ga0500568_0000245_27783_28418 201
436 3300005353 Ga0070669_100000547 Ga0070669_1000005476 202
437 3300005367 Ga0070667_100187605 Ga0070667_1001876051 202
438 3300005548 Ga0070665_100046017 Ga0070665_1000460172 202
439 3300005841 Ga0068863_100026341 Ga0068863_1000263413 202
440 3300025923 Ga0207681_10000528 Ga0207681_1000052819 202
441 3300025931 Ga0207644_10000005 Ga0207644_10000005215 202
442 3300025986 Ga0207658_10118367 Ga0207658_101183672 202
443 3300026088 Ga0207641_10019400 Ga0207641_100194003 202
444 3300026095 Ga0207676_10687280 Ga0207676_106872801 202
445 3300028381 Ga0268264_10107797 Ga0268264_101077972 202
446 3300031548 Ga0307408_100253148 Ga0307408_1002531481 202
447 3300031824 Ga0307413_10972085 Ga0307413_109720851 202
448 3300041460 Ga0451802_0480640 Ga0451802_0480640_483_1121 202
449 3300041462 Ga0451806_796222 Ga0451806_796222_443_1081 202
450 3300044683 Ga0466965_0059215 Ga0466965_0059215_721_1365 202
451 3300044693 Ga0466961_0027126 Ga0466961_0027126_1907_2551 202
452 3300044694 Ga0466963_0034334 Ga0466963_0034334_894_1538 202
453 3300044706 Ga0466964_0005827 Ga0466964_0005827_2505_3149 202
454 3300045049 Ga0466959_0004747 Ga0466959_0004747_2161_2805 202
455 3300045836 Ga0466958_0067133 Ga0466958_0067133_1066_1710 202
456 3300045976 Ga0466967_0252055 Ga0466967_0252055_660_1304 202
457 3300048904 Ga0496101_0230788 Ga0496101_0230788_707_1366 202
458 3300048905 Ga0496102_0185148 Ga0496102_0185148_692_1351 202
459 3300048907 Ga0496104_0020209 Ga0496104_0020209_2374_3033 202
460 3300048909 Ga0496106_0000685 Ga0496106_0000685_15743_16402 202
461 3300048910 Ga0496107_0003034 Ga0496107_0003034_4006_4665 202
462 3300048911 Ga0496108_0921023 Ga0496108_0921023_15_674 202
463 3300048916 Ga0496113_0001740 Ga0496113_0001740_2903_3562 202
464 3300049523 Ga0501300_001219 Ga0501300_001219_21_671 202
465 3300049686 Ga0501257_000008 Ga0501257_000008_12929_13567 202
466 3300061719 Ga0466962_0010328 Ga0466962_0010328_983_1627 202
467 iso_pu_bacteria 2842711865 2842716720 202
468 iso_pu_bacteria 2882806704 2882808845 202
469 3300005329 Ga0070683_100227076 Ga0070683_1002270762 203
470 3300005354 Ga0070675_100051833 Ga0070675_1000518333 203
471 3300005355 Ga0070671_100062944 Ga0070671_1000629443 203
472 3300005365 Ga0070688_100143690 Ga0070688_1001436902 203
473 3300005438 Ga0070701_10226211 Ga0070701_102262112 203
474 3300005535 Ga0070684_100371451 Ga0070684_1003714512 203
475 3300005539 Ga0068853_100165213 Ga0068853_1001652131 203
476 3300005539 Ga0068853_100234020 Ga0068853_1002340202 203
477 3300005549 Ga0070704_100202539 Ga0070704_1002025392 203
478 3300005549 Ga0070704_100908527 Ga0070704_1009085271 203
479 3300005577 Ga0068857_100799562 Ga0068857_1007995622 203
480 3300005578 Ga0068854_100346178 Ga0068854_1003461782 203
481 3300005616 Ga0068852_100902246 Ga0068852_1009022462 203
482 3300005618 Ga0068864_100027734 Ga0068864_1000277343 203
483 3300005840 Ga0068870_10394034 Ga0068870_103940341 203
484 3300005841 Ga0068863_100030247 Ga0068863_1000302474 203
485 3300009098 Ga0105245_10054041 Ga0105245_100540412 203
486 3300009553 Ga0105249_10327508 Ga0105249_103275082 203
487 3300013105 Ga0157369_10294755 Ga0157369_102947552 203
488 3300014325 Ga0163163_10048029 Ga0163163_100480293 203
489 3300014969 Ga0157376_10360555 Ga0157376_103605551 203
490 3300020070 Ga0206356_11302048 Ga0206356_113020482 203
491 3300025908 Ga0207643_10245058 Ga0207643_102450582 203
492 3300025924 Ga0207694_10941260 Ga0207694_109412601 203
493 3300025944 Ga0207661_10114491 Ga0207661_101144912 203
494 3300025981 Ga0207640_10190138 Ga0207640_101901382 203
495 3300025981 Ga0207640_10310214 Ga0207640_103102142 203
496 3300026041 Ga0207639_10265957 Ga0207639_102659572 203
497 3300026116 Ga0207674_10237991 Ga0207674_102379912 203
498 3300026142 Ga0207698_10152176 Ga0207698_101521762 203
499 3300027876 Ga0209974_10058526 Ga0209974_100585262 203
500 3300031731 Ga0307405_10026460 Ga0307405_100264602 203
501 3300031824 Ga0307413_10184471 Ga0307413_101844712 203
502 3300031911 Ga0307412_10054270 Ga0307412_100542702 203
503 3300031911 Ga0307412_10073092 Ga0307412_100730923 203
504 3300031911 Ga0307412_10091325 Ga0307412_100913252 203
505 3300031911 Ga0307412_10099271 Ga0307412_100992713 203
506 3300031995 Ga0307409_100132192 Ga0307409_1001321923 203
507 3300032004 Ga0307414_10023406 Ga0307414_100234063 203
508 3300034817 Ga0373948_0052294 Ga0373948_0052294_106_747 203
509 3300042003 Ga0439443_020008 Ga0439443_020008_305_952 203
510 3300044842 Ga0466957_0156758 Ga0466957_0156758_334_963 203
511 3300044901 Ga0466960_0043862 Ga0466960_0043862_905_1540 203
512 3300046472 Ga0495580_0229445 Ga0495580_0229445_378_1004 203
513 3300048905 Ga0496102_0284087 Ga0496102_0284087_14_658 203
514 3300048907 Ga0496104_0011189 Ga0496104_0011189_1248_1892 203
515 3300048920 Ga0496117_0061452 Ga0496117_0061452_1098_1742 203
516 3300048924 Ga0496121_0000520 Ga0496121_0000520_14181_14825 203
517 3300053134 Ga0500658_0016262 Ga0500658_0016262_1108_1752 203
518 3300005616 Ga0068852_100146319 Ga0068852_1001463192 204
519 3300025933 Ga0207706_10003614 Ga0207706_1000361415 204
520 3300026142 Ga0207698_10049925 Ga0207698_100499253 204
521 3300044658 Ga0466972_0117367 Ga0466972_0117367_321_959 205
522 3300046507 Ga0495606_0000713 Ga0495606_0000713_46462_47079 205
523 3300048091 Ga0495626_0006858 Ga0495626_0006858_2968_3585 205
524 3300003771 Ga0055526_1000020 Ga0055526_100002040 206
525 3300025295 Ga0209564_1000006 Ga0209564_1000006170 206
526 3300042876 Ga0451577_0000068 Ga0451577_0000068_113715_114353 206
527 3300044712 Ga0453684_0000126 Ga0453684_0000126_23666_24304 206
528 3300045051 Ga0451576_0003891 Ga0451576_0003891_1167_1805 206
529 3300046453 Ga0495627_015820 Ga0495627_015820_1132_1752 206
530 3300046453 Ga0495627_044654 Ga0495627_044654_635_1255 206
531 3300046453 Ga0495627_104078 Ga0495627_104078_164_784 206
532 3300046457 Ga0495590_0000004 Ga0495590_0000004_319635_320255 206
533 3300046460 Ga0495638_0000366 Ga0495638_0000366_3696_4316 206
534 3300046471 Ga0495650_0009581 Ga0495650_0009581_1232_1852 206
535 3300046474 Ga0495605_0024767 Ga0495605_0024767_492_1112 206
536 3300046475 Ga0495639_0013763 Ga0495639_0013763_1149_1769 206
537 3300046491 Ga0495584_0010554 Ga0495584_0010554_3235_3855 206
538 3300046492 Ga0495585_0007599 Ga0495585_0007599_3646_4266 206
539 3300046492 Ga0495585_0067026 Ga0495585_0067026_42_662 206
540 3300046500 Ga0495596_0042260 Ga0495596_0042260_389_1009 206
541 3300046501 Ga0495607_0001291 Ga0495607_0001291_12196_12816 206
542 3300046501 Ga0495607_0035309 Ga0495607_0035309_2312_2932 206
543 3300046506 Ga0495583_0000431 Ga0495583_0000431_49452_50072 206
544 3300046506 Ga0495583_0000508 Ga0495583_0000508_51665_52285 206
545 3300046507 Ga0495606_0002943 Ga0495606_0002943_9746_10366 206
546 3300046507 Ga0495606_0007026 Ga0495606_0007026_3379_3999 206
547 3300046512 Ga0495610_0003102 Ga0495610_0003102_7939_8559 206
548 3300046512 Ga0495610_0145563 Ga0495610_0145563_370_990 206
549 3300046513 Ga0495616_0056758 Ga0495616_0056758_364_984 206
550 3300046518 Ga0495631_0053468 Ga0495631_0053468_679_1299 206
551 3300046519 Ga0495632_0002076 Ga0495632_0002076_7694_8314 206
552 3300046522 Ga0495643_0000425 Ga0495643_0000425_50642_51262 206
553 3300046523 Ga0495644_0158835 Ga0495644_0158835_94_714 206
554 3300046524 Ga0495648_0000045 Ga0495648_0000045_3696_4316 206
555 3300046528 Ga0495642_0005275 Ga0495642_0005275_651_1271 206
556 3300046528 Ga0495642_0041598 Ga0495642_0041598_350_970 206
557 3300046528 Ga0495642_0046273 Ga0495642_0046273_750_1370 206
558 3300046538 Ga0495609_0012718 Ga0495609_0012718_1643_2263 206
559 3300046538 Ga0495609_0059979 Ga0495609_0059979_946_1566 206
560 3300046542 Ga0495597_0002143 Ga0495597_0002143_3590_4210 206
561 3300046542 Ga0495597_0002409 Ga0495597_0002409_7682_8302 206
562 3300046542 Ga0495597_0072048 Ga0495597_0072048_745_1365 206
563 3300046557 Ga0495622_0000003 Ga0495622_0000003_19741_20388 206
564 3300046557 Ga0495622_0001233 Ga0495622_0001233_8829_9449 206
565 3300046558 Ga0495633_0000113 Ga0495633_0000113_104270_104890 206
566 3300046558 Ga0495633_0000356 Ga0495633_0000356_3695_4315 206
567 3300046558 Ga0495633_0005368 Ga0495633_0005368_3625_4245 206
568 3300046558 Ga0495633_0019395 Ga0495633_0019395_1291_1911 206
569 3300046558 Ga0495633_0031382 Ga0495633_0031382_461_1081 206
570 3300046616 Ga0495668_0000369 Ga0495668_0000369_8347_8967 206
571 3300046616 Ga0495668_0001920 Ga0495668_0001920_13113_13733 206
572 3300046616 Ga0495668_0042967 Ga0495668_0042967_1187_1807 206
573 3300046648 Ga0495611_0017036 Ga0495611_0017036_42_662 206
574 3300046660 Ga0495625_0004323 Ga0495625_0004323_9175_9795 206
575 3300046660 Ga0495625_0042922 Ga0495625_0042922_1815_2435 206
576 3300046665 Ga0495661_0191240 Ga0495661_0191240_364_984 206
577 3300046665 Ga0495661_0344232 Ga0495661_0344232_31_651 206
578 3300046684 Ga0495669_0007706 Ga0495669_0007706_387_1007 206
579 3300046684 Ga0495669_0094217 Ga0495669_0094217_32_652 206
580 3300046691 Ga0495670_0020640 Ga0495670_0020640_1931_2551 206
581 3300046692 Ga0495671_0025873 Ga0495671_0025873_452_1072 206
582 3300046694 Ga0495649_0177970 Ga0495649_0177970_373_993 206
583 3300046794 Ga0495589_0054285 Ga0495589_0054285_138_758 206
584 3300046810 Ga0495660_0002893 Ga0495660_0002893_625_1245 206
585 3300046810 Ga0495660_0004832 Ga0495660_0004832_7337_7957 206
586 3300047323 Ga0495683_0033438 Ga0495683_0033438_1918_2538 206
587 3300047443 Ga0495687_003314 Ga0495687_003314_4071_4691 206
588 3300047443 Ga0495687_008410 Ga0495687_008410_4076_4696 206
589 3300047445 Ga0495677_0009316 Ga0495677_0009316_2062_2682 206
590 3300047445 Ga0495677_0063320 Ga0495677_0063320_638_1258 206
591 3300047446 Ga0495679_001444 Ga0495679_001444_6771_7391 206
592 3300047470 Ga0495681_0004629 Ga0495681_0004629_7636_8256 206
593 3300047470 Ga0495681_0014546 Ga0495681_0014546_3774_4394 206
594 3300048090 Ga0495615_0030665 Ga0495615_0030665_240_860 206
595 3300048091 Ga0495626_0031132 Ga0495626_0031132_1708_2328 206
596 3300049459 Ga0495678_017193 Ga0495678_017193_225_845 206
597 3300049459 Ga0495678_099218 Ga0495678_099218_185_805 206
598 3300053145 Ga0500586_000367 Ga0500586_000367_7194_7814 206
599 3300002738 JGI25154J39366_1002553 JGI25154J39366_10025534 207
600 3300025246 Ga0209646_1000028 Ga0209646_100002831 207
601 3300027876 Ga0209974_10004908 Ga0209974_100049084 207
602 3300041512 Ga0451853_0965935 Ga0451853_0965935_245_871 207
603 3300046471 Ga0495650_0000169 Ga0495650_0000169_110130_110762 207
604 3300046500 Ga0495596_0000149 Ga0495596_0000149_16905_17528 207
605 3300046507 Ga0495606_0018274 Ga0495606_0018274_4567_5199 207
606 3300046519 Ga0495632_0198445 Ga0495632_0198445_214_846 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

22

216

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.9767 7 206
2v81-assembly1.cif.gz_A native kdpgal structure 0.9762 7 207
2v81-assembly1.cif.gz_A native kdpgal structure 0.9484 7 207
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.9398 7 206
8di1-assembly1.cif.gz_A bfo2294: tannerella forsythia 2-keto-3-deoxy-6-phosphogluconate aldolase (kdpg) and 4-hydroxy-2-oxoglutarate aldolase (khg) 0.923 9 204
ID Description Score Start End Superfamily
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.976 7 207 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9525 7 207 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9203 10 205 3.20.20.70
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9121 32 200 3.20.20.70
af_K7LFS0_36_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9008 10 200 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A520DGF5-F1-model_v4 deleted 0.9899 61 205
AF-A0A512APH9-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9888 8 204 GO:0016829
AF-A0A6L8L701-F1-model_v4 deleted 0.9872 1 207
AF-A0A841LAR4-F1-model_v4 2-dehydro-3-deoxyphosphogalactonate aldolase (EC 4.1.2.21) 0.9862 8 202 GO:0016829
AF-A0A1A9HIH2-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9857 8 204 GO:0016829

Feature Viewer

pLDDT pTM Quality
96.28 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map