F468635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 257 | 604 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300049585|Ga0501069_0442926|Ga0501069_0442926_78_752 |
| Length | 224 |
| Sequence | MLPRRHFRDREEDRRMSARELLQHYLNESPLVAIIRGVTPEEADAIGQAIFDGGIRIIEVPLNSPDPLQSIERLAKRFGDQALVGAGTVLDAANVQRVKDVGGRIIVSPDTNHEVIASAAAAGLVSSPGYFTPSEAFGALRAGAHALKLFPAEAATPGVLKAQLAVIPREVPVIVVGGVKPDNMRPWLEAGAAGFGLGSGLYKPGQSAEETLEKARAYVAGERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 2 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 114 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 118 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 120 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 131 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 139 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 140 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 144 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 145 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 146 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 149 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 155 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 156 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 157 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 162 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 214 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 215 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 216 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 220 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 221 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 222 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 223 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 224 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 226 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 227 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 228 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 229 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 232 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 233 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 239 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 240 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 241 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 242 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 244 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 245 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 246 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 247 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 248 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 249 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 250 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 251 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 252 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 253 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 255 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 256 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 0.83 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.49 |
| Nodule | 0 |
| Rhizoplane | 4.46 |
| Rhizosphere | 91.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1002553 | 3300002738 | Bacteria | 4597 |
| 2 | Ga0055526_1000020 | 3300003771 | Bacteria | 188230 |
| 3 | Ga0070658_10006059 | 3300005327 | Bacteria | 9803 |
| 4 | Ga0070658_10006506 | 3300005327 | Bacteria | 9473 |
| 5 | Ga0070658_10012808 | 3300005327 | Bacteria | 6728 |
| 6 | Ga0070658_10297615 | 3300005327 | Bacteria | 1376 |
| 7 | Ga0070676_10131453 | 3300005328 | Bacteria | 1583 |
| 8 | Ga0070683_100144414 | 3300005329 | Bacteria | 2254 |
| 9 | Ga0070683_100227076 | 3300005329 | Bacteria | 1775 |
| 10 | Ga0070683_100379534 | 3300005329 | Bacteria | 1347 |
| 11 | Ga0070670_100025931 | 3300005331 | Bacteria | 5043 |
| 12 | Ga0070670_100055618 | 3300005331 | Bacteria | 3397 |
| 13 | Ga0070670_100403694 | 3300005331 | Bacteria | 1207 |
| 14 | Ga0070677_10024733 | 3300005333 | Bacteria | 2236 |
| 15 | Ga0070677_10323012 | 3300005333 | Bacteria | 791 |
| 16 | Ga0070680_100001008 | 3300005336 | Bacteria | 20096 |
| 17 | Ga0070680_100019131 | 3300005336 | Bacteria | 5423 |
| 18 | Ga0070680_100219621 | 3300005336 | Bacteria | 1604 |
| 19 | Ga0070682_100063720 | 3300005337 | Bacteria | 2338 |
| 20 | Ga0070682_100575233 | 3300005337 | Bacteria | 885 |
| 21 | Ga0070660_100002984 | 3300005339 | Bacteria | 11653 |
| 22 | Ga0070660_100004103 | 3300005339 | Bacteria | 10050 |
| 23 | Ga0070660_100119596 | 3300005339 | Bacteria | 2101 |
| 24 | Ga0070660_100121490 | 3300005339 | Bacteria | 2085 |
| 25 | Ga0070660_100208906 | 3300005339 | Bacteria | 1584 |
| 26 | Ga0070660_100625317 | 3300005339 | Bacteria | 901 |
| 27 | Ga0070661_100000055 | 3300005344 | Bacteria | 88266 |
| 28 | Ga0070661_100051101 | 3300005344 | Bacteria | 3025 |
| 29 | Ga0070661_100828975 | 3300005344 | Bacteria | 760 |
| 30 | Ga0070692_10105586 | 3300005345 | Bacteria | 1551 |
| 31 | Ga0070692_10203099 | 3300005345 | Unclassified | 1162 |
| 32 | Ga0070668_100141220 | 3300005347 | Bacteria | 1941 |
| 33 | Ga0070668_100692406 | 3300005347 | Bacteria | 898 |
| 34 | Ga0070669_100000547 | 3300005353 | Bacteria | 27940 |
| 35 | Ga0070669_100359985 | 3300005353 | Unclassified | 1183 |
| 36 | Ga0070669_100418620 | 3300005353 | Bacteria | 1099 |
| 37 | Ga0070675_100035280 | 3300005354 | Bacteria | 4063 |
| 38 | Ga0070675_100051833 | 3300005354 | Bacteria | 3373 |
| 39 | Ga0070675_100096026 | 3300005354 | Bacteria | 2490 |
| 40 | Ga0070671_100062944 | 3300005355 | Bacteria | 3089 |
| 41 | Ga0070671_100082537 | 3300005355 | Bacteria | 2687 |
| 42 | Ga0070671_100160172 | 3300005355 | Bacteria | 1902 |
| 43 | Ga0070673_100172043 | 3300005364 | Bacteria | 1849 |
| 44 | Ga0070688_100143690 | 3300005365 | Bacteria | 1624 |
| 45 | Ga0070659_100105485 | 3300005366 | Bacteria | 2271 |
| 46 | Ga0070667_100187605 | 3300005367 | Bacteria | 1830 |
| 47 | Ga0070714_100042960 | 3300005435 | Bacteria | 3820 |
| 48 | Ga0070714_100270690 | 3300005435 | Bacteria | 1575 |
| 49 | Ga0070701_10226211 | 3300005438 | Bacteria | 1118 |
| 50 | Ga0070663_100029938 | 3300005455 | Bacteria | 3725 |
| 51 | Ga0070663_100081426 | 3300005455 | Bacteria | 2380 |
| 52 | Ga0070663_100228393 | 3300005455 | Unclassified | 1464 |
| 53 | Ga0070663_100560873 | 3300005455 | Bacteria | 956 |
| 54 | Ga0070678_100243741 | 3300005456 | Unclassified | 1504 |
| 55 | Ga0070662_100082516 | 3300005457 | Bacteria | 2397 |
| 56 | Ga0070681_10010375 | 3300005458 | Bacteria | 9199 |
| 57 | Ga0070681_10121944 | 3300005458 | Bacteria | 2541 |
| 58 | Ga0070679_100000027 | 3300005530 | Bacteria | 114873 |
| 59 | Ga0070679_100062631 | 3300005530 | Bacteria | 3709 |
| 60 | Ga0070679_100400093 | 3300005530 | Bacteria | 1319 |
| 61 | Ga0070684_100320958 | 3300005535 | Bacteria | 1423 |
| 62 | Ga0070684_100371451 | 3300005535 | Bacteria | 1317 |
| 63 | Ga0068853_100165213 | 3300005539 | Bacteria | 2000 |
| 64 | Ga0068853_100190509 | 3300005539 | Bacteria | 1863 |
| 65 | Ga0068853_100234020 | 3300005539 | Bacteria | 1681 |
| 66 | Ga0070672_100038689 | 3300005543 | Bacteria | 3647 |
| 67 | Ga0070686_100002270 | 3300005544 | Bacteria | 10605 |
| 68 | Ga0070693_100552621 | 3300005547 | Bacteria | 824 |
| 69 | Ga0070665_100014746 | 3300005548 | Bacteria | 7843 |
| 70 | Ga0070665_100046017 | 3300005548 | Bacteria | 4383 |
| 71 | Ga0070704_100202539 | 3300005549 | Bacteria | 1603 |
| 72 | Ga0070704_100908527 | 3300005549 | Bacteria | 792 |
| 73 | Ga0068855_100004220 | 3300005563 | Bacteria | 17542 |
| 74 | Ga0068855_100009899 | 3300005563 | Bacteria | 11499 |
| 75 | Ga0068855_100093581 | 3300005563 | Bacteria | 3466 |
| 76 | Ga0068855_100443236 | 3300005563 | Bacteria | 1418 |
| 77 | Ga0070664_100009697 | 3300005564 | Bacteria | 7811 |
| 78 | Ga0070664_100028729 | 3300005564 | Bacteria | 4629 |
| 79 | Ga0070664_100170628 | 3300005564 | Unclassified | 1930 |
| 80 | Ga0068857_100186676 | 3300005577 | Bacteria | 1888 |
| 81 | Ga0068857_100799562 | 3300005577 | Bacteria | 900 |
| 82 | Ga0068854_100346178 | 3300005578 | Bacteria | 1215 |
| 83 | Ga0068854_100609855 | 3300005578 | Bacteria | 933 |
| 84 | Ga0068856_100014100 | 3300005614 | Bacteria | 7728 |
| 85 | Ga0068856_100204867 | 3300005614 | Bacteria | 1987 |
| 86 | Ga0068856_100518261 | 3300005614 | Bacteria | 1213 |
| 87 | Ga0068856_100541755 | 3300005614 | Bacteria | 1185 |
| 88 | Ga0068856_100636101 | 3300005614 | Unclassified | 1087 |
| 89 | Ga0068852_100005882 | 3300005616 | Bacteria | 8817 |
| 90 | Ga0068852_100017135 | 3300005616 | Bacteria | 5675 |
| 91 | Ga0068852_100094527 | 3300005616 | Bacteria | 2682 |
| 92 | Ga0068852_100146319 | 3300005616 | Bacteria | 2192 |
| 93 | Ga0068852_100902246 | 3300005616 | Bacteria | 901 |
| 94 | Ga0068852_100937669 | 3300005616 | Bacteria | 883 |
| 95 | Ga0068859_100005794 | 3300005617 | Bacteria | 12552 |
| 96 | Ga0068864_100027734 | 3300005618 | Bacteria | 4785 |
| 97 | Ga0068870_10287341 | 3300005840 | Unclassified | 1033 |
| 98 | Ga0068870_10394034 | 3300005840 | Bacteria | 899 |
| 99 | Ga0068863_100014935 | 3300005841 | Bacteria | 7459 |
| 100 | Ga0068863_100026341 | 3300005841 | Bacteria | 5548 |
| 101 | Ga0068863_100030247 | 3300005841 | Bacteria | 5172 |
| 102 | Ga0068858_100001349 | 3300005842 | Bacteria | 25309 |
| 103 | Ga0068862_100212388 | 3300005844 | Bacteria | 1749 |
| 104 | Ga0068871_100606190 | 3300006358 | Bacteria | 996 |
| 105 | Ga0097620_100005794 | 3300006931 | Bacteria | 12552 |
| 106 | Ga0105240_10022230 | 3300009093 | Bacteria | 8414 |
| 107 | Ga0105240_10078780 | 3300009093 | Bacteria | 4057 |
| 108 | Ga0105240_10670175 | 3300009093 | Bacteria | 1135 |
| 109 | Ga0111539_10352557 | 3300009094 | Bacteria | 1712 |
| 110 | Ga0105245_10054041 | 3300009098 | Bacteria | 3607 |
| 111 | Ga0105248_10001489 | 3300009177 | Bacteria | 26067 |
| 112 | Ga0105248_10100588 | 3300009177 | Bacteria | 3258 |
| 113 | Ga0105248_10448372 | 3300009177 | Bacteria | 1454 |
| 114 | Ga0105238_10086527 | 3300009551 | Bacteria | 3122 |
| 115 | Ga0105238_10344433 | 3300009551 | Bacteria | 1479 |
| 116 | Ga0105249_10327508 | 3300009553 | Bacteria | 1545 |
| 117 | Ga0105239_10025225 | 3300010375 | Bacteria | 6547 |
| 118 | Ga0157373_10026122 | 3300013100 | Bacteria | 4220 |
| 119 | Ga0157373_10031719 | 3300013100 | Bacteria | 3803 |
| 120 | Ga0157373_10076934 | 3300013100 | Bacteria | 2354 |
| 121 | Ga0157373_10119088 | 3300013100 | Bacteria | 1856 |
| 122 | Ga0157373_10446998 | 3300013100 | Bacteria | 930 |
| 123 | Ga0157371_10034327 | 3300013102 | Bacteria | 3639 |
| 124 | Ga0157371_10034504 | 3300013102 | Bacteria | 3628 |
| 125 | Ga0157371_10098003 | 3300013102 | Bacteria | 2079 |
| 126 | Ga0157371_10135738 | 3300013102 | Bacteria | 1752 |
| 127 | Ga0157371_10226498 | 3300013102 | Bacteria | 1343 |
| 128 | Ga0157370_10073881 | 3300013104 | Bacteria | 3217 |
| 129 | Ga0157370_10117344 | 3300013104 | Bacteria | 2486 |
| 130 | Ga0157370_10153077 | 3300013104 | Bacteria | 2146 |
| 131 | Ga0157370_10217418 | 3300013104 | Bacteria | 1770 |
| 132 | Ga0157370_10306174 | 3300013104 | Bacteria | 1466 |
| 133 | Ga0157369_10018913 | 3300013105 | Bacteria | 7719 |
| 134 | Ga0157369_10294755 | 3300013105 | Bacteria | 1688 |
| 135 | Ga0157369_10404817 | 3300013105 | Unclassified | 1415 |
| 136 | Ga0157369_10521749 | 3300013105 | Bacteria | 1229 |
| 137 | Ga0157369_10521750 | 3300013105 | Bacteria | 1229 |
| 138 | Ga0157369_10736385 | 3300013105 | Bacteria | 1015 |
| 139 | Ga0157374_10005525 | 3300013296 | Bacteria | 10631 |
| 140 | Ga0157374_10140292 | 3300013296 | Bacteria | 2346 |
| 141 | Ga0157372_10383950 | 3300013307 | Bacteria | 1636 |
| 142 | Ga0157375_10491152 | 3300013308 | Bacteria | 1392 |
| 143 | Ga0163163_10048029 | 3300014325 | Bacteria | 4196 |
| 144 | Ga0163163_10585406 | 3300014325 | Bacteria | 1179 |
| 145 | Ga0157376_10360555 | 3300014969 | Bacteria | 1394 |
| 146 | Ga0163161_10316353 | 3300017792 | Bacteria | 1233 |
| 147 | Ga0206356_11302048 | 3300020070 | Bacteria | 4031 |
| 148 | Ga0206354_10325713 | 3300020081 | Bacteria | 2918 |
| 149 | Ga0206354_11360577 | 3300020081 | Bacteria | 4207 |
| 150 | Ga0206353_10818709 | 3300020082 | Bacteria | 6203 |
| 151 | Ga0206353_11812148 | 3300020082 | Bacteria | 1994 |
| 152 | Ga0213873_10000006 | 3300021358 | Bacteria | 408723 |
| 153 | Ga0213873_10092942 | 3300021358 | Bacteria | 859 |
| 154 | Ga0213876_10000004 | 3300021384 | Bacteria | 943822 |
| 155 | Ga0209646_1000028 | 3300025246 | Bacteria | 387986 |
| 156 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 157 | Ga0207682_10002744 | 3300025893 | Bacteria | 7798 |
| 158 | Ga0207682_10133001 | 3300025893 | Bacteria | 1111 |
| 159 | Ga0207647_10082289 | 3300025904 | Bacteria | 1928 |
| 160 | Ga0207645_10121318 | 3300025907 | Bacteria | 1697 |
| 161 | Ga0207643_10245058 | 3300025908 | Bacteria | 1103 |
| 162 | Ga0207705_10000945 | 3300025909 | Bacteria | 23724 |
| 163 | Ga0207705_10007630 | 3300025909 | Bacteria | 7956 |
| 164 | Ga0207705_10007767 | 3300025909 | Bacteria | 7878 |
| 165 | Ga0207705_10039385 | 3300025909 | Bacteria | 3387 |
| 166 | Ga0207705_10042461 | 3300025909 | Bacteria | 3264 |
| 167 | Ga0207705_10090152 | 3300025909 | Bacteria | 2244 |
| 168 | Ga0207705_10161699 | 3300025909 | Bacteria | 1682 |
| 169 | Ga0207705_10234722 | 3300025909 | Bacteria | 1396 |
| 170 | Ga0207705_10473438 | 3300025909 | Bacteria | 972 |
| 171 | Ga0207705_10475997 | 3300025909 | Bacteria | 969 |
| 172 | Ga0207705_10483991 | 3300025909 | Bacteria | 961 |
| 173 | Ga0207707_10033033 | 3300025912 | Bacteria | 4529 |
| 174 | Ga0207695_10001533 | 3300025913 | Bacteria | 38143 |
| 175 | Ga0207660_10001023 | 3300025917 | Bacteria | 18531 |
| 176 | Ga0207660_10064336 | 3300025917 | Bacteria | 2647 |
| 177 | Ga0207660_10219710 | 3300025917 | Bacteria | 1491 |
| 178 | Ga0207657_10000267 | 3300025919 | Bacteria | 55426 |
| 179 | Ga0207657_10002664 | 3300025919 | Bacteria | 19268 |
| 180 | Ga0207657_10006383 | 3300025919 | Bacteria | 12243 |
| 181 | Ga0207657_10007939 | 3300025919 | Bacteria | 10823 |
| 182 | Ga0207657_10043824 | 3300025919 | Bacteria | 3938 |
| 183 | Ga0207657_10048214 | 3300025919 | Bacteria | 3720 |
| 184 | Ga0207657_10340458 | 3300025919 | Bacteria | 1184 |
| 185 | Ga0207649_10000103 | 3300025920 | Bacteria | 69885 |
| 186 | Ga0207649_10000538 | 3300025920 | Bacteria | 26239 |
| 187 | Ga0207649_10067246 | 3300025920 | Bacteria | 2274 |
| 188 | Ga0207649_10238036 | 3300025920 | Bacteria | 1305 |
| 189 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 190 | Ga0207652_10014570 | 3300025921 | Bacteria | 6373 |
| 191 | Ga0207652_10356718 | 3300025921 | Bacteria | 1320 |
| 192 | Ga0207681_10000528 | 3300025923 | Bacteria | 26417 |
| 193 | Ga0207681_10219583 | 3300025923 | Bacteria | 1470 |
| 194 | Ga0207681_10340994 | 3300025923 | Unclassified | 1197 |
| 195 | Ga0207694_10941260 | 3300025924 | Bacteria | 731 |
| 196 | Ga0207650_10080246 | 3300025925 | Bacteria | 2473 |
| 197 | Ga0207650_10096149 | 3300025925 | Bacteria | 2272 |
| 198 | Ga0207650_10333360 | 3300025925 | Bacteria | 1245 |
| 199 | Ga0207664_10061161 | 3300025929 | Bacteria | 3004 |
| 200 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 201 | Ga0207644_10000954 | 3300025931 | Bacteria | 18456 |
| 202 | Ga0207644_10049061 | 3300025931 | Bacteria | 3020 |
| 203 | Ga0207690_10007847 | 3300025932 | Bacteria | 6339 |
| 204 | Ga0207690_10035199 | 3300025932 | Bacteria | 3233 |
| 205 | Ga0207690_10573795 | 3300025932 | Bacteria | 919 |
| 206 | Ga0207706_10000475 | 3300025933 | Bacteria | 42955 |
| 207 | Ga0207706_10003614 | 3300025933 | Bacteria | 14775 |
| 208 | Ga0207706_10356918 | 3300025933 | Bacteria | 1270 |
| 209 | Ga0207691_10106398 | 3300025940 | Bacteria | 2499 |
| 210 | Ga0207691_10245787 | 3300025940 | Bacteria | 1546 |
| 211 | Ga0207711_10030857 | 3300025941 | Bacteria | 4522 |
| 212 | Ga0207711_10051635 | 3300025941 | Bacteria | 3522 |
| 213 | Ga0207711_10179168 | 3300025941 | Unclassified | 1926 |
| 214 | Ga0207661_10114491 | 3300025944 | Bacteria | 2287 |
| 215 | Ga0207661_10116126 | 3300025944 | Bacteria | 2271 |
| 216 | Ga0207679_10019935 | 3300025945 | Bacteria | 4517 |
| 217 | Ga0207679_10335679 | 3300025945 | Bacteria | 1313 |
| 218 | Ga0207667_10007813 | 3300025949 | Bacteria | 12784 |
| 219 | Ga0207667_10022805 | 3300025949 | Bacteria | 6904 |
| 220 | Ga0207667_10031385 | 3300025949 | Bacteria | 5736 |
| 221 | Ga0207651_10407276 | 3300025960 | Bacteria | 1158 |
| 222 | Ga0207668_10167883 | 3300025972 | Bacteria | 1718 |
| 223 | Ga0207668_10567673 | 3300025972 | Bacteria | 985 |
| 224 | Ga0207640_10000469 | 3300025981 | Bacteria | 24706 |
| 225 | Ga0207640_10027615 | 3300025981 | Bacteria | 3460 |
| 226 | Ga0207640_10190138 | 3300025981 | Bacteria | 1547 |
| 227 | Ga0207640_10310214 | 3300025981 | Bacteria | 1252 |
| 228 | Ga0207640_10931349 | 3300025981 | Bacteria | 761 |
| 229 | Ga0207658_10118367 | 3300025986 | Bacteria | 2107 |
| 230 | Ga0207658_10124621 | 3300025986 | Bacteria | 2060 |
| 231 | Ga0207658_10651867 | 3300025986 | Bacteria | 949 |
| 232 | Ga0207703_10001781 | 3300026035 | Bacteria | 19226 |
| 233 | Ga0207639_10265957 | 3300026041 | Bacteria | 1502 |
| 234 | Ga0207678_10000740 | 3300026067 | Bacteria | 29953 |
| 235 | Ga0207678_10013949 | 3300026067 | Bacteria | 7063 |
| 236 | Ga0207678_10014499 | 3300026067 | Bacteria | 6930 |
| 237 | Ga0207678_10056232 | 3300026067 | Bacteria | 3387 |
| 238 | Ga0207678_10188974 | 3300026067 | Bacteria | 1760 |
| 239 | Ga0207678_10595530 | 3300026067 | Bacteria | 969 |
| 240 | Ga0207702_10022914 | 3300026078 | Bacteria | 5181 |
| 241 | Ga0207702_10052756 | 3300026078 | Bacteria | 3442 |
| 242 | Ga0207702_10063312 | 3300026078 | Bacteria | 3162 |
| 243 | Ga0207702_10552650 | 3300026078 | Bacteria | 1126 |
| 244 | Ga0207641_10019400 | 3300026088 | Bacteria | 5581 |
| 245 | Ga0207676_10687280 | 3300026095 | Bacteria | 990 |
| 246 | Ga0207674_10109149 | 3300026116 | Bacteria | 2743 |
| 247 | Ga0207674_10160076 | 3300026116 | Bacteria | 2206 |
| 248 | Ga0207674_10237991 | 3300026116 | Bacteria | 1768 |
| 249 | Ga0207674_10438284 | 3300026116 | Bacteria | 1263 |
| 250 | Ga0207698_10017594 | 3300026142 | Bacteria | 4855 |
| 251 | Ga0207698_10027096 | 3300026142 | Bacteria | 4064 |
| 252 | Ga0207698_10049925 | 3300026142 | Bacteria | 3188 |
| 253 | Ga0207698_10152176 | 3300026142 | Bacteria | 2010 |
| 254 | Ga0209974_10004908 | 3300027876 | Bacteria | 4731 |
| 255 | Ga0209974_10058526 | 3300027876 | Bacteria | 1303 |
| 256 | Ga0268266_10000061 | 3300028379 | Bacteria | 255207 |
| 257 | Ga0268266_10047306 | 3300028379 | Bacteria | 3685 |
| 258 | Ga0268266_10502576 | 3300028379 | Bacteria | 1158 |
| 259 | Ga0268266_10664009 | 3300028379 | Bacteria | 1004 |
| 260 | Ga0268264_10107797 | 3300028381 | Bacteria | 2434 |
| 261 | Ga0265325_10166712 | 3300031241 | Bacteria | 1033 |
| 262 | Ga0265339_10283867 | 3300031249 | Bacteria | 793 |
| 263 | Ga0307509_10022123 | 3300031507 | Bacteria | 7177 |
| 264 | Ga0307408_100023382 | 3300031548 | Bacteria | 4209 |
| 265 | Ga0307408_100047469 | 3300031548 | Bacteria | 3076 |
| 266 | Ga0307408_100203229 | 3300031548 | Bacteria | 1605 |
| 267 | Ga0307408_100246058 | 3300031548 | Bacteria | 1472 |
| 268 | Ga0307408_100253148 | 3300031548 | Bacteria | 1454 |
| 269 | Ga0307408_100531482 | 3300031548 | Bacteria | 1035 |
| 270 | Ga0316576_10139354 | 3300031727 | Bacteria | 1826 |
| 271 | Ga0307405_10002876 | 3300031731 | Bacteria | 7742 |
| 272 | Ga0307405_10020772 | 3300031731 | Bacteria | 3676 |
| 273 | Ga0307405_10024801 | 3300031731 | Bacteria | 3433 |
| 274 | Ga0307405_10026460 | 3300031731 | Bacteria | 3346 |
| 275 | Ga0307405_10038511 | 3300031731 | Bacteria | 2883 |
| 276 | Ga0307405_10135107 | 3300031731 | Bacteria | 1711 |
| 277 | Ga0307405_10582705 | 3300031731 | Bacteria | 910 |
| 278 | Ga0307405_10913628 | 3300031731 | Bacteria | 743 |
| 279 | Ga0307413_10000144 | 3300031824 | Bacteria | 19106 |
| 280 | Ga0307413_10010609 | 3300031824 | Bacteria | 4482 |
| 281 | Ga0307413_10033408 | 3300031824 | Bacteria | 2929 |
| 282 | Ga0307413_10055139 | 3300031824 | Bacteria | 2416 |
| 283 | Ga0307413_10140686 | 3300031824 | Bacteria | 1667 |
| 284 | Ga0307413_10184471 | 3300031824 | Bacteria | 1491 |
| 285 | Ga0307413_10341803 | 3300031824 | Bacteria | 1151 |
| 286 | Ga0307413_10407692 | 3300031824 | Bacteria | 1067 |
| 287 | Ga0307413_10408038 | 3300031824 | Bacteria | 1066 |
| 288 | Ga0307413_10972085 | 3300031824 | Bacteria | 726 |
| 289 | Ga0307410_10000229 | 3300031852 | Bacteria | 21150 |
| 290 | Ga0307410_10009555 | 3300031852 | Bacteria | 5446 |
| 291 | Ga0307410_10014749 | 3300031852 | Bacteria | 4611 |
| 292 | Ga0307410_10073440 | 3300031852 | Bacteria | 2378 |
| 293 | Ga0307410_10074495 | 3300031852 | Bacteria | 2364 |
| 294 | Ga0307410_10137309 | 3300031852 | Bacteria | 1804 |
| 295 | Ga0307410_10173605 | 3300031852 | Bacteria | 1626 |
| 296 | Ga0307410_10352381 | 3300031852 | Bacteria | 1177 |
| 297 | Ga0307410_11020024 | 3300031852 | Bacteria | 714 |
| 298 | Ga0307406_10009310 | 3300031901 | Bacteria | 5504 |
| 299 | Ga0307406_10047226 | 3300031901 | Bacteria | 2713 |
| 300 | Ga0307406_10078339 | 3300031901 | Bacteria | 2189 |
| 301 | Ga0307406_10216754 | 3300031901 | Bacteria | 1420 |
| 302 | Ga0307406_10432805 | 3300031901 | Bacteria | 1051 |
| 303 | Ga0307406_10770431 | 3300031901 | Bacteria | 809 |
| 304 | Ga0307407_10003042 | 3300031903 | Bacteria | 6751 |
| 305 | Ga0307407_10009558 | 3300031903 | Bacteria | 4524 |
| 306 | Ga0307407_10100640 | 3300031903 | Bacteria | 1793 |
| 307 | Ga0307407_10113305 | 3300031903 | Bacteria | 1706 |
| 308 | Ga0307407_10121059 | 3300031903 | Bacteria | 1659 |
| 309 | Ga0307407_10186153 | 3300031903 | Bacteria | 1380 |
| 310 | Ga0307412_10007341 | 3300031911 | Bacteria | 6250 |
| 311 | Ga0307412_10015387 | 3300031911 | Bacteria | 4535 |
| 312 | Ga0307412_10029057 | 3300031911 | Bacteria | 3466 |
| 313 | Ga0307412_10054270 | 3300031911 | Bacteria | 2659 |
| 314 | Ga0307412_10073092 | 3300031911 | Bacteria | 2345 |
| 315 | Ga0307412_10091325 | 3300031911 | Bacteria | 2131 |
| 316 | Ga0307412_10099271 | 3300031911 | Bacteria | 2055 |
| 317 | Ga0307412_10146008 | 3300031911 | Bacteria | 1739 |
| 318 | Ga0307412_10836067 | 3300031911 | Bacteria | 802 |
| 319 | Ga0307412_10892251 | 3300031911 | Bacteria | 778 |
| 320 | Ga0307409_100000049 | 3300031995 | Bacteria | 42215 |
| 321 | Ga0307409_100010794 | 3300031995 | Bacteria | 5708 |
| 322 | Ga0307409_100023898 | 3300031995 | Bacteria | 4247 |
| 323 | Ga0307409_100024938 | 3300031995 | Bacteria | 4183 |
| 324 | Ga0307409_100064481 | 3300031995 | Bacteria | 2878 |
| 325 | Ga0307409_100132192 | 3300031995 | Bacteria | 2135 |
| 326 | Ga0307409_100152813 | 3300031995 | Bacteria | 2007 |
| 327 | Ga0307409_100154897 | 3300031995 | Bacteria | 1995 |
| 328 | Ga0307409_100176192 | 3300031995 | Bacteria | 1888 |
| 329 | Ga0307409_100579331 | 3300031995 | Bacteria | 1106 |
| 330 | Ga0307409_100861559 | 3300031995 | Bacteria | 917 |
| 331 | Ga0307409_101019903 | 3300031995 | Bacteria | 846 |
| 332 | Ga0307416_100011585 | 3300032002 | Bacteria | 5891 |
| 333 | Ga0307416_100014720 | 3300032002 | Bacteria | 5374 |
| 334 | Ga0307416_100137748 | 3300032002 | Bacteria | 2212 |
| 335 | Ga0307416_100270459 | 3300032002 | Bacteria | 1668 |
| 336 | Ga0307416_100806633 | 3300032002 | Bacteria | 1035 |
| 337 | Ga0307416_101043884 | 3300032002 | Bacteria | 921 |
| 338 | Ga0307414_10000735 | 3300032004 | Bacteria | 16778 |
| 339 | Ga0307414_10021051 | 3300032004 | Bacteria | 4081 |
| 340 | Ga0307414_10023406 | 3300032004 | Bacteria | 3917 |
| 341 | Ga0307414_10034656 | 3300032004 | Bacteria | 3350 |
| 342 | Ga0307414_10045191 | 3300032004 | Bacteria | 3014 |
| 343 | Ga0307414_10149878 | 3300032004 | Bacteria | 1838 |
| 344 | Ga0307414_10293495 | 3300032004 | Bacteria | 1372 |
| 345 | Ga0307411_10000702 | 3300032005 | Bacteria | 12290 |
| 346 | Ga0307411_10014921 | 3300032005 | Bacteria | 4341 |
| 347 | Ga0307411_10040262 | 3300032005 | Bacteria | 2963 |
| 348 | Ga0307411_10053530 | 3300032005 | Bacteria | 2645 |
| 349 | Ga0307411_10059763 | 3300032005 | Bacteria | 2528 |
| 350 | Ga0307411_10128706 | 3300032005 | Bacteria | 1846 |
| 351 | Ga0307411_10278246 | 3300032005 | Bacteria | 1331 |
| 352 | Ga0307411_10331850 | 3300032005 | Bacteria | 1233 |
| 353 | Ga0307411_10494714 | 3300032005 | Bacteria | 1032 |
| 354 | Ga0307411_10528616 | 3300032005 | Bacteria | 1002 |
| 355 | Ga0307415_100007655 | 3300032126 | Bacteria | 5926 |
| 356 | Ga0307415_100034422 | 3300032126 | Bacteria | 3298 |
| 357 | Ga0307415_100037701 | 3300032126 | Bacteria | 3179 |
| 358 | Ga0307415_100044609 | 3300032126 | Bacteria | 2965 |
| 359 | Ga0307415_100882078 | 3300032126 | Bacteria | 823 |
| 360 | Ga0373948_0052294 | 3300034817 | Unclassified | 880 |
| 361 | Ga0373947_0201025 | 3300035725 | Bacteria | 1304 |
| 362 | Ga0373925_0452155 | 3300037068 | Bacteria | 1052 |
| 363 | Ga0395899_0005357 | 3300037312 | Bacteria | 9967 |
| 364 | Ga0395899_0012269 | 3300037312 | Bacteria | 6563 |
| 365 | Ga0395899_0018651 | 3300037312 | Bacteria | 5271 |
| 366 | Ga0395899_0026996 | 3300037312 | Bacteria | 4331 |
| 367 | Ga0395899_0047284 | 3300037312 | Bacteria | 3204 |
| 368 | Ga0395899_0052302 | 3300037312 | Bacteria | 3028 |
| 369 | Ga0395899_0052687 | 3300037312 | Bacteria | 3015 |
| 370 | Ga0395899_0114793 | 3300037312 | Bacteria | 1933 |
| 371 | Ga0395900_0000447 | 3300037418 | Bacteria | 59069 |
| 372 | Ga0395900_0008912 | 3300037418 | Bacteria | 10293 |
| 373 | Ga0395900_0036937 | 3300037418 | Bacteria | 5035 |
| 374 | Ga0395900_0051071 | 3300037418 | Bacteria | 4259 |
| 375 | Ga0395900_0168699 | 3300037418 | Bacteria | 2229 |
| 376 | Ga0395900_0211034 | 3300037418 | Bacteria | 1960 |
| 377 | Ga0395900_0284498 | 3300037418 | Bacteria | 1644 |
| 378 | Ga0395900_0431114 | 3300037418 | Bacteria | 1277 |
| 379 | Ga0395900_0519761 | 3300037418 | Bacteria | 1138 |
| 380 | Ga0395900_0589052 | 3300037418 | Bacteria | 1053 |
| 381 | Ga0395900_0815249 | 3300037418 | Bacteria | 860 |
| 382 | Ga0395898_0002889 | 3300037466 | Bacteria | 19582 |
| 383 | Ga0395898_0005900 | 3300037466 | Bacteria | 13169 |
| 384 | Ga0395898_0010805 | 3300037466 | Bacteria | 9538 |
| 385 | Ga0395898_0018867 | 3300037466 | Bacteria | 7027 |
| 386 | Ga0395898_0040488 | 3300037466 | Bacteria | 4607 |
| 387 | Ga0395898_0086695 | 3300037466 | Bacteria | 3017 |
| 388 | Ga0395898_0244801 | 3300037466 | Bacteria | 1710 |
| 389 | Ga0395898_0942699 | 3300037466 | Bacteria | 800 |
| 390 | Ga0395905_0000104 | 3300037471 | Bacteria | 141965 |
| 391 | Ga0395905_0053493 | 3300037471 | Bacteria | 3778 |
| 392 | Ga0395905_0070723 | 3300037471 | Bacteria | 3270 |
| 393 | Ga0395905_0180539 | 3300037471 | Bacteria | 1981 |
| 394 | Ga0395905_0219723 | 3300037471 | Bacteria | 1778 |
| 395 | Ga0395905_0230377 | 3300037471 | Bacteria | 1732 |
| 396 | Ga0395905_0682445 | 3300037471 | Bacteria | 929 |
| 397 | Ga0395901_0000324 | 3300038443 | Bacteria | 59134 |
| 398 | Ga0395901_0028167 | 3300038443 | Bacteria | 5778 |
| 399 | Ga0395901_0033908 | 3300038443 | Bacteria | 5271 |
| 400 | Ga0395901_0100974 | 3300038443 | Bacteria | 3027 |
| 401 | Ga0395901_0107127 | 3300038443 | Bacteria | 2933 |
| 402 | Ga0395901_0130050 | 3300038443 | Bacteria | 2645 |
| 403 | Ga0395901_0276186 | 3300038443 | Bacteria | 1747 |
| 404 | Ga0395901_0284625 | 3300038443 | Bacteria | 1717 |
| 405 | Ga0395901_0469167 | 3300038443 | Bacteria | 1285 |
| 406 | Ga0395901_0660439 | 3300038443 | Bacteria | 1047 |
| 407 | Ga0395901_0681680 | 3300038443 | Bacteria | 1027 |
| 408 | Ga0436365_0862833 | 3300039437 | Bacteria | 88455 |
| 409 | Ga0436365_1276851 | 3300039437 | Bacteria | 2107 |
| 410 | Ga0436363_0877393 | 3300039450 | Bacteria | 772 |
| 411 | Ga0436363_1313966 | 3300039450 | Bacteria | 1112 |
| 412 | Ga0436362_0949954 | 3300039453 | Bacteria | 89092 |
| 413 | Ga0436362_1016233 | 3300039453 | Bacteria | 760 |
| 414 | Ga0451802_0480640 | 3300041460 | Bacteria | 2188 |
| 415 | Ga0451806_796222 | 3300041462 | Bacteria | 1232 |
| 416 | Ga0451853_0965935 | 3300041512 | Bacteria | 1334 |
| 417 | Ga0439443_020008 | 3300042003 | Bacteria | 1048 |
| 418 | Ga0439452_042753 | 3300042010 | Bacteria | 1061 |
| 419 | Ga0439452_077487 | 3300042010 | Bacteria | 727 |
| 420 | Ga0450912_000227 | 3300042116 | Bacteria | 2406 |
| 421 | Ga0450890_021680 | 3300042127 | Bacteria | 875 |
| 422 | Ga0451577_0000068 | 3300042876 | Bacteria | 241923 |
| 423 | Ga0466969_0072817 | 3300044656 | Bacteria | 1649 |
| 424 | Ga0466969_0081006 | 3300044656 | Bacteria | 1550 |
| 425 | Ga0466972_0064805 | 3300044658 | Bacteria | 1748 |
| 426 | Ga0466972_0117367 | 3300044658 | Bacteria | 1256 |
| 427 | Ga0466965_0059215 | 3300044683 | Bacteria | 1911 |
| 428 | Ga0466965_0162284 | 3300044683 | Bacteria | 1172 |
| 429 | Ga0466965_0410688 | 3300044683 | Bacteria | 749 |
| 430 | Ga0466966_0000282 | 3300044684 | Bacteria | 33331 |
| 431 | Ga0466966_0003557 | 3300044684 | Bacteria | 10278 |
| 432 | Ga0466966_0188081 | 3300044684 | Bacteria | 1252 |
| 433 | Ga0466961_0007560 | 3300044693 | Bacteria | 6917 |
| 434 | Ga0466961_0027126 | 3300044693 | Bacteria | 3682 |
| 435 | Ga0466961_0045922 | 3300044693 | Bacteria | 2794 |
| 436 | Ga0466961_0226168 | 3300044693 | Bacteria | 1152 |
| 437 | Ga0466961_0465643 | 3300044693 | Bacteria | 764 |
| 438 | Ga0466963_0004048 | 3300044694 | Bacteria | 8483 |
| 439 | Ga0466963_0009815 | 3300044694 | Bacteria | 5778 |
| 440 | Ga0466963_0034334 | 3300044694 | Bacteria | 3299 |
| 441 | Ga0466964_0005827 | 3300044706 | Bacteria | 4585 |
| 442 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 443 | Ga0466971_0017635 | 3300044719 | Bacteria | 3160 |
| 444 | Ga0466971_0333093 | 3300044719 | Bacteria | 732 |
| 445 | Ga0466970_0042569 | 3300044765 | Bacteria | 2415 |
| 446 | Ga0466957_0009505 | 3300044842 | Bacteria | 5551 |
| 447 | Ga0466957_0137558 | 3300044842 | Archaea | 1571 |
| 448 | Ga0466957_0156758 | 3300044842 | Bacteria | 1476 |
| 449 | Ga0466957_0397047 | 3300044842 | Bacteria | 943 |
| 450 | Ga0466957_0414293 | 3300044842 | Bacteria | 923 |
| 451 | Ga0466960_0043862 | 3300044901 | Bacteria | 2130 |
| 452 | Ga0466959_0004747 | 3300045049 | Bacteria | 9155 |
| 453 | Ga0466959_0229100 | 3300045049 | Bacteria | 1286 |
| 454 | Ga0466959_0259819 | 3300045049 | Bacteria | 1195 |
| 455 | Ga0466959_0531699 | 3300045049 | Bacteria | 794 |
| 456 | Ga0451576_0003891 | 3300045051 | Bacteria | 19977 |
| 457 | Ga0466958_0000394 | 3300045836 | Bacteria | 17873 |
| 458 | Ga0466958_0067133 | 3300045836 | Bacteria | 2190 |
| 459 | Ga0466967_0252055 | 3300045976 | Bacteria | 1686 |
| 460 | Ga0466967_1087574 | 3300045976 | Unclassified | 797 |
| 461 | Ga0495627_015820 | 3300046453 | Bacteria | 2598 |
| 462 | Ga0495627_044654 | 3300046453 | Bacteria | 1352 |
| 463 | Ga0495627_104078 | 3300046453 | Bacteria | 808 |
| 464 | Ga0495590_0000004 | 3300046457 | Bacteria | 402091 |
| 465 | Ga0495638_0000366 | 3300046460 | Bacteria | 55970 |
| 466 | Ga0495650_0000169 | 3300046471 | Bacteria | 145238 |
| 467 | Ga0495650_0009581 | 3300046471 | Bacteria | 5494 |
| 468 | Ga0495580_0229445 | 3300046472 | Bacteria | 1275 |
| 469 | Ga0495605_0024767 | 3300046474 | Bacteria | 3136 |
| 470 | Ga0495639_0013763 | 3300046475 | Bacteria | 3498 |
| 471 | Ga0495584_0010554 | 3300046491 | Bacteria | 4744 |
| 472 | Ga0495585_0007599 | 3300046492 | Bacteria | 6621 |
| 473 | Ga0495585_0067026 | 3300046492 | Bacteria | 1964 |
| 474 | Ga0495596_0000149 | 3300046500 | Bacteria | 48579 |
| 475 | Ga0495596_0042260 | 3300046500 | Bacteria | 1796 |
| 476 | Ga0495607_0001291 | 3300046501 | Bacteria | 22407 |
| 477 | Ga0495607_0035309 | 3300046501 | Bacteria | 3025 |
| 478 | Ga0495583_0000431 | 3300046506 | Bacteria | 63149 |
| 479 | Ga0495583_0000508 | 3300046506 | Bacteria | 55961 |
| 480 | Ga0495606_0000713 | 3300046507 | Bacteria | 51369 |
| 481 | Ga0495606_0002943 | 3300046507 | Bacteria | 18804 |
| 482 | Ga0495606_0007026 | 3300046507 | Bacteria | 10207 |
| 483 | Ga0495606_0018274 | 3300046507 | Bacteria | 5264 |
| 484 | Ga0495610_0003102 | 3300046512 | Bacteria | 13240 |
| 485 | Ga0495610_0021105 | 3300046512 | Bacteria | 3590 |
| 486 | Ga0495610_0145563 | 3300046512 | Bacteria | 1015 |
| 487 | Ga0495616_0056758 | 3300046513 | Bacteria | 1932 |
| 488 | Ga0495631_0053468 | 3300046518 | Bacteria | 1762 |
| 489 | Ga0495632_0002076 | 3300046519 | Bacteria | 15693 |
| 490 | Ga0495632_0198445 | 3300046519 | Bacteria | 915 |
| 491 | Ga0495643_0000425 | 3300046522 | Bacteria | 54854 |
| 492 | Ga0495644_0158835 | 3300046523 | Bacteria | 866 |
| 493 | Ga0495648_0000045 | 3300046524 | Bacteria | 172587 |
| 494 | Ga0495642_0005275 | 3300046528 | Bacteria | 4966 |
| 495 | Ga0495642_0041598 | 3300046528 | Bacteria | 1869 |
| 496 | Ga0495642_0046273 | 3300046528 | Bacteria | 1780 |
| 497 | Ga0495609_0012718 | 3300046538 | Bacteria | 3988 |
| 498 | Ga0495609_0059979 | 3300046538 | Bacteria | 1682 |
| 499 | Ga0495597_0002143 | 3300046542 | Bacteria | 13043 |
| 500 | Ga0495597_0002409 | 3300046542 | Bacteria | 11906 |
| 501 | Ga0495597_0072048 | 3300046542 | Bacteria | 1487 |
| 502 | Ga0495597_0083722 | 3300046542 | Bacteria | 1361 |
| 503 | Ga0495622_0000003 | 3300046557 | Bacteria | 268681 |
| 504 | Ga0495622_0001233 | 3300046557 | Bacteria | 13132 |
| 505 | Ga0495633_0000113 | 3300046558 | Bacteria | 109307 |
| 506 | Ga0495633_0000356 | 3300046558 | Bacteria | 49639 |
| 507 | Ga0495633_0005368 | 3300046558 | Bacteria | 7860 |
| 508 | Ga0495633_0019395 | 3300046558 | Bacteria | 3440 |
| 509 | Ga0495633_0031382 | 3300046558 | Bacteria | 2576 |
| 510 | Ga0495668_0000369 | 3300046616 | Bacteria | 59509 |
| 511 | Ga0495668_0001920 | 3300046616 | Bacteria | 18482 |
| 512 | Ga0495668_0042967 | 3300046616 | Bacteria | 2514 |
| 513 | Ga0495611_0017036 | 3300046648 | Bacteria | 3106 |
| 514 | Ga0495625_0004323 | 3300046660 | Bacteria | 13489 |
| 515 | Ga0495625_0042922 | 3300046660 | Bacteria | 3283 |
| 516 | Ga0495661_0191240 | 3300046665 | Bacteria | 1077 |
| 517 | Ga0495661_0344232 | 3300046665 | Bacteria | 735 |
| 518 | Ga0495669_0007706 | 3300046684 | Bacteria | 4519 |
| 519 | Ga0495669_0011202 | 3300046684 | Bacteria | 3804 |
| 520 | Ga0495669_0094217 | 3300046684 | Bacteria | 1386 |
| 521 | Ga0495670_0020640 | 3300046691 | Bacteria | 3249 |
| 522 | Ga0495671_0025873 | 3300046692 | Bacteria | 3047 |
| 523 | Ga0495649_0177970 | 3300046694 | Bacteria | 1110 |
| 524 | Ga0495589_0054285 | 3300046794 | Bacteria | 1976 |
| 525 | Ga0495660_0002893 | 3300046810 | Bacteria | 10779 |
| 526 | Ga0495660_0004832 | 3300046810 | Bacteria | 8130 |
| 527 | Ga0495683_0033438 | 3300047323 | Bacteria | 2616 |
| 528 | Ga0495687_003314 | 3300047443 | Bacteria | 11811 |
| 529 | Ga0495687_008410 | 3300047443 | Bacteria | 5909 |
| 530 | Ga0495677_0009316 | 3300047445 | Bacteria | 3628 |
| 531 | Ga0495677_0063320 | 3300047445 | Bacteria | 1373 |
| 532 | Ga0495679_001444 | 3300047446 | Bacteria | 13471 |
| 533 | Ga0495681_0004629 | 3300047470 | Bacteria | 9332 |
| 534 | Ga0495681_0014546 | 3300047470 | Bacteria | 4502 |
| 535 | Ga0495615_0030665 | 3300048090 | Bacteria | 1285 |
| 536 | Ga0495626_0006858 | 3300048091 | Bacteria | 6426 |
| 537 | Ga0495626_0031132 | 3300048091 | Bacteria | 2569 |
| 538 | Ga0496101_0085317 | 3300048904 | Bacteria | 2340 |
| 539 | Ga0496101_0230788 | 3300048904 | Bacteria | 1438 |
| 540 | Ga0496102_0185148 | 3300048905 | Bacteria | 1962 |
| 541 | Ga0496102_0284087 | 3300048905 | Bacteria | 1560 |
| 542 | Ga0496104_0011189 | 3300048907 | Bacteria | 8028 |
| 543 | Ga0496104_0020209 | 3300048907 | Bacteria | 6101 |
| 544 | Ga0496106_0000685 | 3300048909 | Bacteria | 24284 |
| 545 | Ga0496107_0003034 | 3300048910 | Bacteria | 11130 |
| 546 | Ga0496108_0217229 | 3300048911 | Bacteria | 1660 |
| 547 | Ga0496108_0921023 | 3300048911 | Bacteria | 749 |
| 548 | Ga0496109_0462263 | 3300048912 | Bacteria | 1198 |
| 549 | Ga0496109_0544385 | 3300048912 | Bacteria | 1095 |
| 550 | Ga0496110_0443558 | 3300048913 | Bacteria | 1183 |
| 551 | Ga0496110_0581876 | 3300048913 | Bacteria | 1016 |
| 552 | Ga0496111_0070902 | 3300048914 | Unclassified | 2536 |
| 553 | Ga0496111_0355263 | 3300048914 | Bacteria | 1085 |
| 554 | Ga0496111_0700494 | 3300048914 | Bacteria | 737 |
| 555 | Ga0496112_0004292 | 3300048915 | Bacteria | 12040 |
| 556 | Ga0496112_0018585 | 3300048915 | Bacteria | 6549 |
| 557 | Ga0496112_0414468 | 3300048915 | Bacteria | 1286 |
| 558 | Ga0496113_0001740 | 3300048916 | Bacteria | 12330 |
| 559 | Ga0496114_0045527 | 3300048917 | Bacteria | 3645 |
| 560 | Ga0496114_0626346 | 3300048917 | Bacteria | 948 |
| 561 | Ga0496115_0000691 | 3300048918 | Bacteria | 25050 |
| 562 | Ga0496115_0602607 | 3300048918 | Bacteria | 873 |
| 563 | Ga0496116_0239798 | 3300048919 | Bacteria | 912 |
| 564 | Ga0496117_0061452 | 3300048920 | Bacteria | 2582 |
| 565 | Ga0496121_0000520 | 3300048924 | Bacteria | 73411 |
| 566 | Ga0496124_0093521 | 3300048927 | Bacteria | 2447 |
| 567 | Ga0496126_0022079 | 3300048929 | Bacteria | 6200 |
| 568 | Ga0495678_017193 | 3300049459 | Bacteria | 3284 |
| 569 | Ga0495678_099218 | 3300049459 | Bacteria | 1012 |
| 570 | Ga0501290_003097 | 3300049513 | Bacteria | 2110 |
| 571 | Ga0501292_000035 | 3300049515 | Bacteria | 33554 |
| 572 | Ga0501294_000145 | 3300049517 | Bacteria | 8361 |
| 573 | Ga0501300_000782 | 3300049523 | Bacteria | 4817 |
| 574 | Ga0501300_001219 | 3300049523 | Bacteria | 3909 |
| 575 | Ga0501067_0084117 | 3300049583 | Bacteria | 1765 |
| 576 | Ga0501069_0442926 | 3300049585 | Bacteria | 772 |
| 577 | Ga0501202_021011 | 3300049652 | Bacteria | 1301 |
| 578 | Ga0501222_001052 | 3300049662 | Bacteria | 3915 |
| 579 | Ga0501223_000384 | 3300049663 | Bacteria | 10906 |
| 580 | Ga0501224_000065 | 3300049664 | Bacteria | 11865 |
| 581 | Ga0501227_002342 | 3300049665 | Bacteria | 4196 |
| 582 | Ga0501233_000527 | 3300049668 | Bacteria | 6145 |
| 583 | Ga0501235_007630 | 3300049669 | Bacteria | 2357 |
| 584 | Ga0501257_000008 | 3300049686 | Bacteria | 54624 |
| 585 | Ga0501259_000065 | 3300049688 | Bacteria | 14592 |
| 586 | Ga0501261_000039 | 3300049690 | Bacteria | 25955 |
| 587 | Ga0501221_012099 | 3300049704 | Bacteria | 1565 |
| 588 | Ga0501225_0000627 | 3300049705 | Bacteria | 11003 |
| 589 | Ga0501264_002229 | 3300049761 | Bacteria | 1830 |
| 590 | Ga0501279_000033 | 3300049775 | Bacteria | 33688 |
| 591 | Ga0501280_000826 | 3300049776 | Bacteria | 6705 |
| 592 | Ga0501281_00024 | 3300049777 | Bacteria | 18869 |
| 593 | Ga0501282_000686 | 3300049778 | Bacteria | 3884 |
| 594 | Ga0501283_000175 | 3300049779 | Bacteria | 8357 |
| 595 | Ga0500578_0335973 | 3300053086 | Bacteria | 887 |
| 596 | Ga0500641_0002371 | 3300053096 | Bacteria | 6672 |
| 597 | Ga0500594_0009845 | 3300053118 | Bacteria | 2207 |
| 598 | Ga0500595_000916 | 3300053119 | Bacteria | 16804 |
| 599 | Ga0500658_0016262 | 3300053134 | Bacteria | 2770 |
| 600 | Ga0500568_0000245 | 3300053139 | Bacteria | 46212 |
| 601 | Ga0500586_000367 | 3300053145 | Bacteria | 8966 |
| 602 | Ga0590071_062151 | 3300059421 | Unclassified | 914 |
| 603 | Ga0466962_0010328 | 3300061719 | Bacteria | 4484 |
| 604 | Ga0466962_0156633 | 3300061719 | Bacteria | 1106 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031507 | Ga0307509_10022123 | Ga0307509_100221236 | 175 |
| 2 | 3300005336 | Ga0070680_100019131 | Ga0070680_1000191313 | 177 |
| 3 | 3300005337 | Ga0070682_100575233 | Ga0070682_1005752331 | 177 |
| 4 | 3300005455 | Ga0070663_100081426 | Ga0070663_1000814263 | 177 |
| 5 | 3300005458 | Ga0070681_10010375 | Ga0070681_1001037511 | 177 |
| 6 | 3300005539 | Ga0068853_100190509 | Ga0068853_1001905092 | 177 |
| 7 | 3300005564 | Ga0070664_100009697 | Ga0070664_1000096973 | 177 |
| 8 | 3300005578 | Ga0068854_100609855 | Ga0068854_1006098552 | 177 |
| 9 | 3300005614 | Ga0068856_100541755 | Ga0068856_1005417552 | 177 |
| 10 | 3300005616 | Ga0068852_100094527 | Ga0068852_1000945272 | 177 |
| 11 | 3300013100 | Ga0157373_10119088 | Ga0157373_101190882 | 177 |
| 12 | 3300025909 | Ga0207705_10007630 | Ga0207705_100076309 | 177 |
| 13 | 3300025912 | Ga0207707_10033033 | Ga0207707_100330332 | 177 |
| 14 | 3300025917 | Ga0207660_10064336 | Ga0207660_100643362 | 177 |
| 15 | 3300025919 | Ga0207657_10006383 | Ga0207657_100063837 | 177 |
| 16 | 3300025921 | Ga0207652_10014570 | Ga0207652_100145702 | 177 |
| 17 | 3300025945 | Ga0207679_10019935 | Ga0207679_100199352 | 177 |
| 18 | 3300044683 | Ga0466965_0410688 | Ga0466965_0410688_166_729 | 187 |
| 19 | 3300025923 | Ga0207681_10340994 | Ga0207681_103409942 | 190 |
| 20 | 3300005327 | Ga0070658_10006059 | Ga0070658_100060598 | 194 |
| 21 | 3300005345 | Ga0070692_10203099 | Ga0070692_102030992 | 194 |
| 22 | 3300013104 | Ga0157370_10153077 | Ga0157370_101530772 | 194 |
| 23 | 3300037418 | Ga0395900_0008912 | Ga0395900_0008912_6755_7387 | 195 |
| 24 | 3300037471 | Ga0395905_0000104 | Ga0395905_0000104_5329_5961 | 195 |
| 25 | 3300039437 | Ga0436365_1276851 | Ga0436365_1276851_15_602 | 195 |
| 26 | 3300044683 | Ga0466965_0162284 | Ga0466965_0162284_462_1097 | 196 |
| 27 | 3300048918 | Ga0496115_0602607 | Ga0496115_0602607_238_855 | 197 |
| 28 | 3300005329 | Ga0070683_100144414 | Ga0070683_1001444143 | 198 |
| 29 | 3300005331 | Ga0070670_100403694 | Ga0070670_1004036942 | 198 |
| 30 | 3300005333 | Ga0070677_10323012 | Ga0070677_103230122 | 198 |
| 31 | 3300005344 | Ga0070661_100828975 | Ga0070661_1008289751 | 198 |
| 32 | 3300005353 | Ga0070669_100418620 | Ga0070669_1004186202 | 198 |
| 33 | 3300005366 | Ga0070659_100105485 | Ga0070659_1001054851 | 198 |
| 34 | 3300005455 | Ga0070663_100029938 | Ga0070663_1000299382 | 198 |
| 35 | 3300005457 | Ga0070662_100082516 | Ga0070662_1000825162 | 198 |
| 36 | 3300005458 | Ga0070681_10121944 | Ga0070681_101219442 | 198 |
| 37 | 3300005530 | Ga0070679_100062631 | Ga0070679_1000626312 | 198 |
| 38 | 3300005535 | Ga0070684_100320958 | Ga0070684_1003209582 | 198 |
| 39 | 3300005617 | Ga0068859_100005794 | Ga0068859_10000579412 | 198 |
| 40 | 3300005842 | Ga0068858_100001349 | Ga0068858_10000134912 | 198 |
| 41 | 3300005844 | Ga0068862_100212388 | Ga0068862_1002123882 | 198 |
| 42 | 3300006931 | Ga0097620_100005794 | Ga0097620_10000579412 | 198 |
| 43 | 3300009094 | Ga0111539_10352557 | Ga0111539_103525572 | 198 |
| 44 | 3300013100 | Ga0157373_10026122 | Ga0157373_100261224 | 198 |
| 45 | 3300025893 | Ga0207682_10133001 | Ga0207682_101330012 | 198 |
| 46 | 3300025923 | Ga0207681_10219583 | Ga0207681_102195832 | 198 |
| 47 | 3300025925 | Ga0207650_10333360 | Ga0207650_103333602 | 198 |
| 48 | 3300025932 | Ga0207690_10035199 | Ga0207690_100351993 | 198 |
| 49 | 3300025933 | Ga0207706_10000475 | Ga0207706_1000047535 | 198 |
| 50 | 3300025933 | Ga0207706_10356918 | Ga0207706_103569182 | 198 |
| 51 | 3300025941 | Ga0207711_10051635 | Ga0207711_100516353 | 198 |
| 52 | 3300025944 | Ga0207661_10116126 | Ga0207661_101161262 | 198 |
| 53 | 3300025986 | Ga0207658_10124621 | Ga0207658_101246213 | 198 |
| 54 | 3300026035 | Ga0207703_10001781 | Ga0207703_100017814 | 198 |
| 55 | 3300026067 | Ga0207678_10000740 | Ga0207678_1000074021 | 198 |
| 56 | 3300031548 | Ga0307408_100023382 | Ga0307408_1000233823 | 198 |
| 57 | 3300031548 | Ga0307408_100531482 | Ga0307408_1005314822 | 198 |
| 58 | 3300031731 | Ga0307405_10002876 | Ga0307405_100028765 | 198 |
| 59 | 3300031731 | Ga0307405_10582705 | Ga0307405_105827052 | 198 |
| 60 | 3300031824 | Ga0307413_10055139 | Ga0307413_100551392 | 198 |
| 61 | 3300031901 | Ga0307406_10078339 | Ga0307406_100783392 | 198 |
| 62 | 3300031901 | Ga0307406_10770431 | Ga0307406_107704312 | 198 |
| 63 | 3300031911 | Ga0307412_10015387 | Ga0307412_100153873 | 198 |
| 64 | 3300031995 | Ga0307409_101019903 | Ga0307409_1010199032 | 198 |
| 65 | 3300032002 | Ga0307416_100806633 | Ga0307416_1008066332 | 198 |
| 66 | 3300032126 | Ga0307415_100037701 | Ga0307415_1000377013 | 198 |
| 67 | 3300035725 | Ga0373947_0201025 | Ga0373947_0201025_242_868 | 198 |
| 68 | 3300037068 | Ga0373925_0452155 | Ga0373925_0452155_330_956 | 198 |
| 69 | 3300037312 | Ga0395899_0114793 | Ga0395899_0114793_934_1560 | 198 |
| 70 | 3300037418 | Ga0395900_0036937 | Ga0395900_0036937_3476_4102 | 198 |
| 71 | 3300037466 | Ga0395898_0010805 | Ga0395898_0010805_6058_6684 | 198 |
| 72 | 3300037471 | Ga0395905_0053493 | Ga0395905_0053493_1918_2544 | 198 |
| 73 | 3300038443 | Ga0395901_0028167 | Ga0395901_0028167_934_1560 | 198 |
| 74 | 3300042010 | Ga0439452_077487 | Ga0439452_077487_69_692 | 198 |
| 75 | 3300048912 | Ga0496109_0544385 | Ga0496109_0544385_269_907 | 198 |
| 76 | 3300048913 | Ga0496110_0443558 | Ga0496110_0443558_291_929 | 198 |
| 77 | 3300048917 | Ga0496114_0045527 | Ga0496114_0045527_838_1476 | 198 |
| 78 | 3300048919 | Ga0496116_0239798 | Ga0496116_0239798_224_850 | 198 |
| 79 | 3300048927 | Ga0496124_0093521 | Ga0496124_0093521_767_1405 | 198 |
| 80 | 3300048929 | Ga0496126_0022079 | Ga0496126_0022079_1928_2566 | 198 |
| 81 | 3300053096 | Ga0500641_0002371 | Ga0500641_0002371_853_1479 | 198 |
| 82 | 3300053119 | Ga0500595_000916 | Ga0500595_000916_3697_4323 | 198 |
| 83 | 3300005327 | Ga0070658_10006506 | Ga0070658_100065068 | 199 |
| 84 | 3300005327 | Ga0070658_10012808 | Ga0070658_100128085 | 199 |
| 85 | 3300005327 | Ga0070658_10297615 | Ga0070658_102976152 | 199 |
| 86 | 3300005328 | Ga0070676_10131453 | Ga0070676_101314532 | 199 |
| 87 | 3300005331 | Ga0070670_100025931 | Ga0070670_1000259313 | 199 |
| 88 | 3300005331 | Ga0070670_100055618 | Ga0070670_1000556182 | 199 |
| 89 | 3300005333 | Ga0070677_10024733 | Ga0070677_100247331 | 199 |
| 90 | 3300005336 | Ga0070680_100001008 | Ga0070680_10000100815 | 199 |
| 91 | 3300005336 | Ga0070680_100219621 | Ga0070680_1002196211 | 199 |
| 92 | 3300005337 | Ga0070682_100063720 | Ga0070682_1000637202 | 199 |
| 93 | 3300005339 | Ga0070660_100002984 | Ga0070660_1000029847 | 199 |
| 94 | 3300005339 | Ga0070660_100004103 | Ga0070660_1000041034 | 199 |
| 95 | 3300005339 | Ga0070660_100119596 | Ga0070660_1001195963 | 199 |
| 96 | 3300005339 | Ga0070660_100625317 | Ga0070660_1006253172 | 199 |
| 97 | 3300005344 | Ga0070661_100000055 | Ga0070661_10000005543 | 199 |
| 98 | 3300005345 | Ga0070692_10105586 | Ga0070692_101055862 | 199 |
| 99 | 3300005347 | Ga0070668_100141220 | Ga0070668_1001412202 | 199 |
| 100 | 3300005347 | Ga0070668_100692406 | Ga0070668_1006924062 | 199 |
| 101 | 3300005353 | Ga0070669_100359985 | Ga0070669_1003599852 | 199 |
| 102 | 3300005354 | Ga0070675_100035280 | Ga0070675_1000352802 | 199 |
| 103 | 3300005354 | Ga0070675_100096026 | Ga0070675_1000960262 | 199 |
| 104 | 3300005355 | Ga0070671_100082537 | Ga0070671_1000825371 | 199 |
| 105 | 3300005364 | Ga0070673_100172043 | Ga0070673_1001720431 | 199 |
| 106 | 3300005435 | Ga0070714_100042960 | Ga0070714_1000429602 | 199 |
| 107 | 3300005455 | Ga0070663_100560873 | Ga0070663_1005608731 | 199 |
| 108 | 3300005456 | Ga0070678_100243741 | Ga0070678_1002437412 | 199 |
| 109 | 3300005530 | Ga0070679_100000027 | Ga0070679_10000002747 | 199 |
| 110 | 3300005530 | Ga0070679_100400093 | Ga0070679_1004000932 | 199 |
| 111 | 3300005543 | Ga0070672_100038689 | Ga0070672_1000386894 | 199 |
| 112 | 3300005547 | Ga0070693_100552621 | Ga0070693_1005526212 | 199 |
| 113 | 3300005548 | Ga0070665_100014746 | Ga0070665_1000147464 | 199 |
| 114 | 3300005563 | Ga0068855_100004220 | Ga0068855_10000422013 | 199 |
| 115 | 3300005563 | Ga0068855_100093581 | Ga0068855_1000935812 | 199 |
| 116 | 3300005563 | Ga0068855_100443236 | Ga0068855_1004432361 | 199 |
| 117 | 3300005564 | Ga0070664_100170628 | Ga0070664_1001706282 | 199 |
| 118 | 3300005616 | Ga0068852_100017135 | Ga0068852_1000171356 | 199 |
| 119 | 3300005840 | Ga0068870_10287341 | Ga0068870_102873412 | 199 |
| 120 | 3300005841 | Ga0068863_100014935 | Ga0068863_1000149358 | 199 |
| 121 | 3300009177 | Ga0105248_10001489 | Ga0105248_1000148921 | 199 |
| 122 | 3300009177 | Ga0105248_10100588 | Ga0105248_101005883 | 199 |
| 123 | 3300009551 | Ga0105238_10086527 | Ga0105238_100865272 | 199 |
| 124 | 3300013100 | Ga0157373_10076934 | Ga0157373_100769343 | 199 |
| 125 | 3300013100 | Ga0157373_10446998 | Ga0157373_104469981 | 199 |
| 126 | 3300013102 | Ga0157371_10034504 | Ga0157371_100345042 | 199 |
| 127 | 3300013104 | Ga0157370_10306174 | Ga0157370_103061742 | 199 |
| 128 | 3300013308 | Ga0157375_10491152 | Ga0157375_104911522 | 199 |
| 129 | 3300014325 | Ga0163163_10585406 | Ga0163163_105854062 | 199 |
| 130 | 3300017792 | Ga0163161_10316353 | Ga0163161_103163532 | 199 |
| 131 | 3300020081 | Ga0206354_10325713 | Ga0206354_103257133 | 199 |
| 132 | 3300020081 | Ga0206354_11360577 | Ga0206354_113605773 | 199 |
| 133 | 3300020082 | Ga0206353_10818709 | Ga0206353_108187094 | 199 |
| 134 | 3300020082 | Ga0206353_11812148 | Ga0206353_118121482 | 199 |
| 135 | 3300021358 | Ga0213873_10000006 | Ga0213873_10000006160 | 199 |
| 136 | 3300021384 | Ga0213876_10000004 | Ga0213876_10000004666 | 199 |
| 137 | 3300025893 | Ga0207682_10002744 | Ga0207682_100027447 | 199 |
| 138 | 3300025907 | Ga0207645_10121318 | Ga0207645_101213182 | 199 |
| 139 | 3300025909 | Ga0207705_10007767 | Ga0207705_100077674 | 199 |
| 140 | 3300025909 | Ga0207705_10042461 | Ga0207705_100424613 | 199 |
| 141 | 3300025909 | Ga0207705_10090152 | Ga0207705_100901522 | 199 |
| 142 | 3300025909 | Ga0207705_10234722 | Ga0207705_102347222 | 199 |
| 143 | 3300025909 | Ga0207705_10473438 | Ga0207705_104734382 | 199 |
| 144 | 3300025909 | Ga0207705_10475997 | Ga0207705_104759972 | 199 |
| 145 | 3300025917 | Ga0207660_10001023 | Ga0207660_1000102310 | 199 |
| 146 | 3300025917 | Ga0207660_10219710 | Ga0207660_102197101 | 199 |
| 147 | 3300025919 | Ga0207657_10000267 | Ga0207657_1000026710 | 199 |
| 148 | 3300025919 | Ga0207657_10002664 | Ga0207657_100026644 | 199 |
| 149 | 3300025919 | Ga0207657_10007939 | Ga0207657_1000793911 | 199 |
| 150 | 3300025919 | Ga0207657_10048214 | Ga0207657_100482144 | 199 |
| 151 | 3300025919 | Ga0207657_10340458 | Ga0207657_103404582 | 199 |
| 152 | 3300025920 | Ga0207649_10000103 | Ga0207649_1000010344 | 199 |
| 153 | 3300025920 | Ga0207649_10238036 | Ga0207649_102380362 | 199 |
| 154 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001839 | 199 |
| 155 | 3300025921 | Ga0207652_10356718 | Ga0207652_103567182 | 199 |
| 156 | 3300025925 | Ga0207650_10080246 | Ga0207650_100802463 | 199 |
| 157 | 3300025925 | Ga0207650_10096149 | Ga0207650_100961492 | 199 |
| 158 | 3300025929 | Ga0207664_10061161 | Ga0207664_100611612 | 199 |
| 159 | 3300025931 | Ga0207644_10000954 | Ga0207644_1000095414 | 199 |
| 160 | 3300025931 | Ga0207644_10049061 | Ga0207644_100490612 | 199 |
| 161 | 3300025940 | Ga0207691_10106398 | Ga0207691_101063983 | 199 |
| 162 | 3300025940 | Ga0207691_10245787 | Ga0207691_102457872 | 199 |
| 163 | 3300025941 | Ga0207711_10030857 | Ga0207711_100308574 | 199 |
| 164 | 3300025941 | Ga0207711_10179168 | Ga0207711_101791682 | 199 |
| 165 | 3300025949 | Ga0207667_10007813 | Ga0207667_100078136 | 199 |
| 166 | 3300025949 | Ga0207667_10031385 | Ga0207667_100313852 | 199 |
| 167 | 3300025960 | Ga0207651_10407276 | Ga0207651_104072762 | 199 |
| 168 | 3300025972 | Ga0207668_10167883 | Ga0207668_101678832 | 199 |
| 169 | 3300025972 | Ga0207668_10567673 | Ga0207668_105676732 | 199 |
| 170 | 3300025981 | Ga0207640_10931349 | Ga0207640_109313491 | 199 |
| 171 | 3300025986 | Ga0207658_10651867 | Ga0207658_106518672 | 199 |
| 172 | 3300026067 | Ga0207678_10056232 | Ga0207678_100562322 | 199 |
| 173 | 3300026067 | Ga0207678_10188974 | Ga0207678_101889742 | 199 |
| 174 | 3300026078 | Ga0207702_10552650 | Ga0207702_105526502 | 199 |
| 175 | 3300026116 | Ga0207674_10438284 | Ga0207674_104382842 | 199 |
| 176 | 3300026142 | Ga0207698_10017594 | Ga0207698_100175942 | 199 |
| 177 | 3300028379 | Ga0268266_10047306 | Ga0268266_100473062 | 199 |
| 178 | 3300031548 | Ga0307408_100047469 | Ga0307408_1000474693 | 199 |
| 179 | 3300031731 | Ga0307405_10913628 | Ga0307405_109136282 | 199 |
| 180 | 3300031824 | Ga0307413_10140686 | Ga0307413_101406862 | 199 |
| 181 | 3300031852 | Ga0307410_10074495 | Ga0307410_100744952 | 199 |
| 182 | 3300031852 | Ga0307410_10173605 | Ga0307410_101736052 | 199 |
| 183 | 3300031852 | Ga0307410_10352381 | Ga0307410_103523812 | 199 |
| 184 | 3300031901 | Ga0307406_10216754 | Ga0307406_102167542 | 199 |
| 185 | 3300031901 | Ga0307406_10432805 | Ga0307406_104328052 | 199 |
| 186 | 3300031903 | Ga0307407_10186153 | Ga0307407_101861532 | 199 |
| 187 | 3300031911 | Ga0307412_10836067 | Ga0307412_108360671 | 199 |
| 188 | 3300031995 | Ga0307409_100010794 | Ga0307409_1000107946 | 199 |
| 189 | 3300031995 | Ga0307409_100152813 | Ga0307409_1001528133 | 199 |
| 190 | 3300031995 | Ga0307409_100579331 | Ga0307409_1005793312 | 199 |
| 191 | 3300031995 | Ga0307409_100861559 | Ga0307409_1008615592 | 199 |
| 192 | 3300032002 | Ga0307416_100011585 | Ga0307416_1000115853 | 199 |
| 193 | 3300032004 | Ga0307414_10034656 | Ga0307414_100346563 | 199 |
| 194 | 3300032004 | Ga0307414_10293495 | Ga0307414_102934952 | 199 |
| 195 | 3300032005 | Ga0307411_10053530 | Ga0307411_100535302 | 199 |
| 196 | 3300032005 | Ga0307411_10128706 | Ga0307411_101287062 | 199 |
| 197 | 3300032005 | Ga0307411_10278246 | Ga0307411_102782462 | 199 |
| 198 | 3300037312 | Ga0395899_0005357 | Ga0395899_0005357_1840_2469 | 199 |
| 199 | 3300037312 | Ga0395899_0047284 | Ga0395899_0047284_847_1476 | 199 |
| 200 | 3300037312 | Ga0395899_0052302 | Ga0395899_0052302_1102_1731 | 199 |
| 201 | 3300037312 | Ga0395899_0052687 | Ga0395899_0052687_12_641 | 199 |
| 202 | 3300037418 | Ga0395900_0000447 | Ga0395900_0000447_51607_52236 | 199 |
| 203 | 3300037418 | Ga0395900_0051071 | Ga0395900_0051071_1527_2156 | 199 |
| 204 | 3300037418 | Ga0395900_0168699 | Ga0395900_0168699_516_1145 | 199 |
| 205 | 3300037418 | Ga0395900_0284498 | Ga0395900_0284498_768_1397 | 199 |
| 206 | 3300037418 | Ga0395900_0815249 | Ga0395900_0815249_138_767 | 199 |
| 207 | 3300037466 | Ga0395898_0005900 | Ga0395898_0005900_8450_9079 | 199 |
| 208 | 3300037466 | Ga0395898_0086695 | Ga0395898_0086695_615_1244 | 199 |
| 209 | 3300037466 | Ga0395898_0244801 | Ga0395898_0244801_430_1059 | 199 |
| 210 | 3300037466 | Ga0395898_0942699 | Ga0395898_0942699_34_663 | 199 |
| 211 | 3300037471 | Ga0395905_0070723 | Ga0395905_0070723_1152_1781 | 199 |
| 212 | 3300037471 | Ga0395905_0180539 | Ga0395905_0180539_1037_1666 | 199 |
| 213 | 3300037471 | Ga0395905_0219723 | Ga0395905_0219723_510_1139 | 199 |
| 214 | 3300037471 | Ga0395905_0230377 | Ga0395905_0230377_170_799 | 199 |
| 215 | 3300037471 | Ga0395905_0682445 | Ga0395905_0682445_29_658 | 199 |
| 216 | 3300038443 | Ga0395901_0000324 | Ga0395901_0000324_51639_52268 | 199 |
| 217 | 3300038443 | Ga0395901_0100974 | Ga0395901_0100974_1903_2532 | 199 |
| 218 | 3300038443 | Ga0395901_0107127 | Ga0395901_0107127_2117_2746 | 199 |
| 219 | 3300038443 | Ga0395901_0130050 | Ga0395901_0130050_993_1622 | 199 |
| 220 | 3300038443 | Ga0395901_0284625 | Ga0395901_0284625_500_1129 | 199 |
| 221 | 3300038443 | Ga0395901_0469167 | Ga0395901_0469167_548_1177 | 199 |
| 222 | 3300038443 | Ga0395901_0660439 | Ga0395901_0660439_281_910 | 199 |
| 223 | 3300038443 | Ga0395901_0681680 | Ga0395901_0681680_65_694 | 199 |
| 224 | 3300039437 | Ga0436365_0862833 | Ga0436365_0862833_67140_67769 | 199 |
| 225 | 3300039450 | Ga0436363_0877393 | Ga0436363_0877393_91_720 | 199 |
| 226 | 3300039450 | Ga0436363_1313966 | Ga0436363_1313966_365_994 | 199 |
| 227 | 3300039453 | Ga0436362_0949954 | Ga0436362_0949954_36095_36724 | 199 |
| 228 | 3300042127 | Ga0450890_021680 | Ga0450890_021680_79_708 | 199 |
| 229 | 3300044658 | Ga0466972_0064805 | Ga0466972_0064805_754_1383 | 199 |
| 230 | 3300044684 | Ga0466966_0188081 | Ga0466966_0188081_604_1233 | 199 |
| 231 | 3300044693 | Ga0466961_0007560 | Ga0466961_0007560_1938_2567 | 199 |
| 232 | 3300044693 | Ga0466961_0226168 | Ga0466961_0226168_10_663 | 199 |
| 233 | 3300044842 | Ga0466957_0137558 | Ga0466957_0137558_622_1251 | 199 |
| 234 | 3300045049 | Ga0466959_0531699 | Ga0466959_0531699_50_679 | 199 |
| 235 | 3300045976 | Ga0466967_1087574 | Ga0466967_1087574_57_686 | 199 |
| 236 | 3300048911 | Ga0496108_0217229 | Ga0496108_0217229_487_1116 | 199 |
| 237 | 3300048912 | Ga0496109_0462263 | Ga0496109_0462263_243_872 | 199 |
| 238 | 3300048914 | Ga0496111_0355263 | Ga0496111_0355263_116_745 | 199 |
| 239 | 3300048914 | Ga0496111_0700494 | Ga0496111_0700494_62_691 | 199 |
| 240 | 3300048915 | Ga0496112_0004292 | Ga0496112_0004292_11108_11737 | 199 |
| 241 | 3300048915 | Ga0496112_0018585 | Ga0496112_0018585_4764_5393 | 199 |
| 242 | 3300049583 | Ga0501067_0084117 | Ga0501067_0084117_776_1405 | 199 |
| 243 | 3300049585 | Ga0501069_0442926 | Ga0501069_0442926_78_752 | 199 |
| 244 | 3300053118 | Ga0500594_0009845 | Ga0500594_0009845_1486_2115 | 199 |
| 245 | 3300059421 | Ga0590071_062151 | Ga0590071_062151_127_756 | 199 |
| 246 | 3300005329 | Ga0070683_100379534 | Ga0070683_1003795342 | 200 |
| 247 | 3300005339 | Ga0070660_100121490 | Ga0070660_1001214902 | 200 |
| 248 | 3300005339 | Ga0070660_100208906 | Ga0070660_1002089062 | 200 |
| 249 | 3300005344 | Ga0070661_100051101 | Ga0070661_1000511013 | 200 |
| 250 | 3300005355 | Ga0070671_100160172 | Ga0070671_1001601721 | 200 |
| 251 | 3300005435 | Ga0070714_100270690 | Ga0070714_1002706901 | 200 |
| 252 | 3300005455 | Ga0070663_100228393 | Ga0070663_1002283932 | 200 |
| 253 | 3300005563 | Ga0068855_100009899 | Ga0068855_1000098996 | 200 |
| 254 | 3300005564 | Ga0070664_100028729 | Ga0070664_1000287296 | 200 |
| 255 | 3300005577 | Ga0068857_100186676 | Ga0068857_1001866763 | 200 |
| 256 | 3300005614 | Ga0068856_100014100 | Ga0068856_1000141006 | 200 |
| 257 | 3300005614 | Ga0068856_100204867 | Ga0068856_1002048672 | 200 |
| 258 | 3300005614 | Ga0068856_100518261 | Ga0068856_1005182612 | 200 |
| 259 | 3300005614 | Ga0068856_100636101 | Ga0068856_1006361012 | 200 |
| 260 | 3300005616 | Ga0068852_100005882 | Ga0068852_1000058827 | 200 |
| 261 | 3300005616 | Ga0068852_100937669 | Ga0068852_1009376692 | 200 |
| 262 | 3300009093 | Ga0105240_10022230 | Ga0105240_100222306 | 200 |
| 263 | 3300009093 | Ga0105240_10078780 | Ga0105240_100787805 | 200 |
| 264 | 3300009093 | Ga0105240_10670175 | Ga0105240_106701752 | 200 |
| 265 | 3300009177 | Ga0105248_10448372 | Ga0105248_104483722 | 200 |
| 266 | 3300009551 | Ga0105238_10344433 | Ga0105238_103444332 | 200 |
| 267 | 3300010375 | Ga0105239_10025225 | Ga0105239_100252258 | 200 |
| 268 | 3300013100 | Ga0157373_10031719 | Ga0157373_100317192 | 200 |
| 269 | 3300013102 | Ga0157371_10034327 | Ga0157371_100343273 | 200 |
| 270 | 3300013102 | Ga0157371_10098003 | Ga0157371_100980032 | 200 |
| 271 | 3300013102 | Ga0157371_10135738 | Ga0157371_101357381 | 200 |
| 272 | 3300013102 | Ga0157371_10226498 | Ga0157371_102264982 | 200 |
| 273 | 3300013104 | Ga0157370_10073881 | Ga0157370_100738812 | 200 |
| 274 | 3300013104 | Ga0157370_10117344 | Ga0157370_101173442 | 200 |
| 275 | 3300013104 | Ga0157370_10217418 | Ga0157370_102174182 | 200 |
| 276 | 3300013105 | Ga0157369_10018913 | Ga0157369_100189136 | 200 |
| 277 | 3300013105 | Ga0157369_10404817 | Ga0157369_104048172 | 200 |
| 278 | 3300013105 | Ga0157369_10521749 | Ga0157369_105217491 | 200 |
| 279 | 3300013105 | Ga0157369_10521750 | Ga0157369_105217501 | 200 |
| 280 | 3300013105 | Ga0157369_10736385 | Ga0157369_107363851 | 200 |
| 281 | 3300013296 | Ga0157374_10005525 | Ga0157374_100055259 | 200 |
| 282 | 3300013296 | Ga0157374_10140292 | Ga0157374_101402923 | 200 |
| 283 | 3300013307 | Ga0157372_10383950 | Ga0157372_103839502 | 200 |
| 284 | 3300025904 | Ga0207647_10082289 | Ga0207647_100822892 | 200 |
| 285 | 3300025909 | Ga0207705_10000945 | Ga0207705_1000094518 | 200 |
| 286 | 3300025909 | Ga0207705_10039385 | Ga0207705_100393852 | 200 |
| 287 | 3300025909 | Ga0207705_10161699 | Ga0207705_101616992 | 200 |
| 288 | 3300025909 | Ga0207705_10483991 | Ga0207705_104839911 | 200 |
| 289 | 3300025913 | Ga0207695_10001533 | Ga0207695_100015338 | 200 |
| 290 | 3300025919 | Ga0207657_10043824 | Ga0207657_100438244 | 200 |
| 291 | 3300025920 | Ga0207649_10000538 | Ga0207649_1000053818 | 200 |
| 292 | 3300025920 | Ga0207649_10067246 | Ga0207649_100672463 | 200 |
| 293 | 3300025932 | Ga0207690_10007847 | Ga0207690_100078473 | 200 |
| 294 | 3300025932 | Ga0207690_10573795 | Ga0207690_105737952 | 200 |
| 295 | 3300025945 | Ga0207679_10335679 | Ga0207679_103356792 | 200 |
| 296 | 3300025949 | Ga0207667_10022805 | Ga0207667_100228054 | 200 |
| 297 | 3300025981 | Ga0207640_10000469 | Ga0207640_1000046919 | 200 |
| 298 | 3300025981 | Ga0207640_10027615 | Ga0207640_100276152 | 200 |
| 299 | 3300026067 | Ga0207678_10013949 | Ga0207678_100139493 | 200 |
| 300 | 3300026067 | Ga0207678_10014499 | Ga0207678_100144994 | 200 |
| 301 | 3300026067 | Ga0207678_10595530 | Ga0207678_105955301 | 200 |
| 302 | 3300026078 | Ga0207702_10022914 | Ga0207702_100229146 | 200 |
| 303 | 3300026078 | Ga0207702_10052756 | Ga0207702_100527562 | 200 |
| 304 | 3300026078 | Ga0207702_10063312 | Ga0207702_100633123 | 200 |
| 305 | 3300026116 | Ga0207674_10109149 | Ga0207674_101091493 | 200 |
| 306 | 3300026116 | Ga0207674_10160076 | Ga0207674_101600763 | 200 |
| 307 | 3300026142 | Ga0207698_10027096 | Ga0207698_100270963 | 200 |
| 308 | 3300028379 | Ga0268266_10664009 | Ga0268266_106640092 | 200 |
| 309 | 3300031241 | Ga0265325_10166712 | Ga0265325_101667122 | 200 |
| 310 | 3300031249 | Ga0265339_10283867 | Ga0265339_102838671 | 200 |
| 311 | 3300031548 | Ga0307408_100203229 | Ga0307408_1002032292 | 200 |
| 312 | 3300031727 | Ga0316576_10139354 | Ga0316576_101393542 | 200 |
| 313 | 3300031731 | Ga0307405_10020772 | Ga0307405_100207724 | 200 |
| 314 | 3300031731 | Ga0307405_10024801 | Ga0307405_100248012 | 200 |
| 315 | 3300031731 | Ga0307405_10038511 | Ga0307405_100385113 | 200 |
| 316 | 3300031731 | Ga0307405_10135107 | Ga0307405_101351072 | 200 |
| 317 | 3300031824 | Ga0307413_10000144 | Ga0307413_100001449 | 200 |
| 318 | 3300031824 | Ga0307413_10010609 | Ga0307413_100106095 | 200 |
| 319 | 3300031824 | Ga0307413_10033408 | Ga0307413_100334083 | 200 |
| 320 | 3300031824 | Ga0307413_10341803 | Ga0307413_103418032 | 200 |
| 321 | 3300031824 | Ga0307413_10408038 | Ga0307413_104080381 | 200 |
| 322 | 3300031852 | Ga0307410_10000229 | Ga0307410_1000022921 | 200 |
| 323 | 3300031852 | Ga0307410_10009555 | Ga0307410_100095555 | 200 |
| 324 | 3300031852 | Ga0307410_10014749 | Ga0307410_100147493 | 200 |
| 325 | 3300031852 | Ga0307410_10073440 | Ga0307410_100734404 | 200 |
| 326 | 3300031852 | Ga0307410_11020024 | Ga0307410_110200241 | 200 |
| 327 | 3300031901 | Ga0307406_10009310 | Ga0307406_100093104 | 200 |
| 328 | 3300031901 | Ga0307406_10047226 | Ga0307406_100472262 | 200 |
| 329 | 3300031903 | Ga0307407_10003042 | Ga0307407_100030429 | 200 |
| 330 | 3300031903 | Ga0307407_10009558 | Ga0307407_100095581 | 200 |
| 331 | 3300031903 | Ga0307407_10113305 | Ga0307407_101133052 | 200 |
| 332 | 3300031903 | Ga0307407_10121059 | Ga0307407_101210592 | 200 |
| 333 | 3300031911 | Ga0307412_10007341 | Ga0307412_100073414 | 200 |
| 334 | 3300031911 | Ga0307412_10029057 | Ga0307412_100290572 | 200 |
| 335 | 3300031911 | Ga0307412_10146008 | Ga0307412_101460082 | 200 |
| 336 | 3300031911 | Ga0307412_10892251 | Ga0307412_108922511 | 200 |
| 337 | 3300031995 | Ga0307409_100000049 | Ga0307409_10000004926 | 200 |
| 338 | 3300031995 | Ga0307409_100023898 | Ga0307409_1000238983 | 200 |
| 339 | 3300031995 | Ga0307409_100024938 | Ga0307409_1000249383 | 200 |
| 340 | 3300031995 | Ga0307409_100064481 | Ga0307409_1000644813 | 200 |
| 341 | 3300031995 | Ga0307409_100176192 | Ga0307409_1001761922 | 200 |
| 342 | 3300032002 | Ga0307416_100014720 | Ga0307416_1000147204 | 200 |
| 343 | 3300032002 | Ga0307416_100137748 | Ga0307416_1001377482 | 200 |
| 344 | 3300032002 | Ga0307416_100270459 | Ga0307416_1002704592 | 200 |
| 345 | 3300032002 | Ga0307416_101043884 | Ga0307416_1010438842 | 200 |
| 346 | 3300032004 | Ga0307414_10000735 | Ga0307414_100007357 | 200 |
| 347 | 3300032004 | Ga0307414_10021051 | Ga0307414_100210514 | 200 |
| 348 | 3300032004 | Ga0307414_10045191 | Ga0307414_100451914 | 200 |
| 349 | 3300032004 | Ga0307414_10149878 | Ga0307414_101498782 | 200 |
| 350 | 3300032005 | Ga0307411_10000702 | Ga0307411_100007029 | 200 |
| 351 | 3300032005 | Ga0307411_10014921 | Ga0307411_100149215 | 200 |
| 352 | 3300032005 | Ga0307411_10040262 | Ga0307411_100402622 | 200 |
| 353 | 3300032005 | Ga0307411_10059763 | Ga0307411_100597633 | 200 |
| 354 | 3300032005 | Ga0307411_10331850 | Ga0307411_103318502 | 200 |
| 355 | 3300032005 | Ga0307411_10494714 | Ga0307411_104947142 | 200 |
| 356 | 3300032005 | Ga0307411_10528616 | Ga0307411_105286162 | 200 |
| 357 | 3300032126 | Ga0307415_100007655 | Ga0307415_1000076554 | 200 |
| 358 | 3300032126 | Ga0307415_100034422 | Ga0307415_1000344222 | 200 |
| 359 | 3300032126 | Ga0307415_100044609 | Ga0307415_1000446092 | 200 |
| 360 | 3300032126 | Ga0307415_100882078 | Ga0307415_1008820782 | 200 |
| 361 | 3300037312 | Ga0395899_0012269 | Ga0395899_0012269_5540_6172 | 200 |
| 362 | 3300037312 | Ga0395899_0018651 | Ga0395899_0018651_1006_1638 | 200 |
| 363 | 3300037312 | Ga0395899_0026996 | Ga0395899_0026996_1372_2004 | 200 |
| 364 | 3300037418 | Ga0395900_0211034 | Ga0395900_0211034_323_955 | 200 |
| 365 | 3300037418 | Ga0395900_0431114 | Ga0395900_0431114_261_893 | 200 |
| 366 | 3300037418 | Ga0395900_0519761 | Ga0395900_0519761_184_816 | 200 |
| 367 | 3300037418 | Ga0395900_0589052 | Ga0395900_0589052_146_778 | 200 |
| 368 | 3300037466 | Ga0395898_0002889 | Ga0395898_0002889_7223_7855 | 200 |
| 369 | 3300037466 | Ga0395898_0018867 | Ga0395898_0018867_2906_3538 | 200 |
| 370 | 3300037466 | Ga0395898_0040488 | Ga0395898_0040488_2626_3258 | 200 |
| 371 | 3300038443 | Ga0395901_0033908 | Ga0395901_0033908_3634_4266 | 200 |
| 372 | 3300038443 | Ga0395901_0276186 | Ga0395901_0276186_834_1466 | 200 |
| 373 | 3300042010 | Ga0439452_042753 | Ga0439452_042753_107_739 | 200 |
| 374 | 3300042116 | Ga0450912_000227 | Ga0450912_000227_936_1568 | 200 |
| 375 | 3300044656 | Ga0466969_0072817 | Ga0466969_0072817_328_960 | 200 |
| 376 | 3300044656 | Ga0466969_0081006 | Ga0466969_0081006_310_942 | 200 |
| 377 | 3300044684 | Ga0466966_0000282 | Ga0466966_0000282_21795_22427 | 200 |
| 378 | 3300044684 | Ga0466966_0003557 | Ga0466966_0003557_2448_3080 | 200 |
| 379 | 3300044693 | Ga0466961_0045922 | Ga0466961_0045922_1606_2238 | 200 |
| 380 | 3300044693 | Ga0466961_0465643 | Ga0466961_0465643_57_689 | 200 |
| 381 | 3300044694 | Ga0466963_0004048 | Ga0466963_0004048_7713_8345 | 200 |
| 382 | 3300044694 | Ga0466963_0009815 | Ga0466963_0009815_3501_4133 | 200 |
| 383 | 3300044719 | Ga0466971_0017635 | Ga0466971_0017635_2250_2882 | 200 |
| 384 | 3300044719 | Ga0466971_0333093 | Ga0466971_0333093_22_654 | 200 |
| 385 | 3300044765 | Ga0466970_0042569 | Ga0466970_0042569_682_1314 | 200 |
| 386 | 3300044842 | Ga0466957_0009505 | Ga0466957_0009505_2863_3495 | 200 |
| 387 | 3300044842 | Ga0466957_0397047 | Ga0466957_0397047_79_711 | 200 |
| 388 | 3300044842 | Ga0466957_0414293 | Ga0466957_0414293_160_792 | 200 |
| 389 | 3300045049 | Ga0466959_0229100 | Ga0466959_0229100_65_697 | 200 |
| 390 | 3300045049 | Ga0466959_0259819 | Ga0466959_0259819_499_1131 | 200 |
| 391 | 3300045836 | Ga0466958_0000394 | Ga0466958_0000394_4972_5604 | 200 |
| 392 | 3300046512 | Ga0495610_0021105 | Ga0495610_0021105_2524_3156 | 200 |
| 393 | 3300046684 | Ga0495669_0011202 | Ga0495669_0011202_1828_2460 | 200 |
| 394 | 3300048904 | Ga0496101_0085317 | Ga0496101_0085317_1301_1933 | 200 |
| 395 | 3300048913 | Ga0496110_0581876 | Ga0496110_0581876_112_744 | 200 |
| 396 | 3300048914 | Ga0496111_0070902 | Ga0496111_0070902_1535_2167 | 200 |
| 397 | 3300048915 | Ga0496112_0414468 | Ga0496112_0414468_564_1196 | 200 |
| 398 | 3300048918 | Ga0496115_0000691 | Ga0496115_0000691_2911_3543 | 200 |
| 399 | 3300061719 | Ga0466962_0156633 | Ga0466962_0156633_458_1090 | 200 |
| 400 | 3300005544 | Ga0070686_100002270 | Ga0070686_1000022704 | 201 |
| 401 | 3300006358 | Ga0068871_100606190 | Ga0068871_1006061902 | 201 |
| 402 | 3300021358 | Ga0213873_10092942 | Ga0213873_100929422 | 201 |
| 403 | 3300028379 | Ga0268266_10000061 | Ga0268266_10000061109 | 201 |
| 404 | 3300028379 | Ga0268266_10502576 | Ga0268266_105025762 | 201 |
| 405 | 3300031548 | Ga0307408_100246058 | Ga0307408_1002460582 | 201 |
| 406 | 3300031824 | Ga0307413_10407692 | Ga0307413_104076922 | 201 |
| 407 | 3300031852 | Ga0307410_10137309 | Ga0307410_101373092 | 201 |
| 408 | 3300031903 | Ga0307407_10100640 | Ga0307407_101006402 | 201 |
| 409 | 3300031995 | Ga0307409_100154897 | Ga0307409_1001548973 | 201 |
| 410 | 3300039453 | Ga0436362_1016233 | Ga0436362_1016233_48_683 | 201 |
| 411 | 3300046542 | Ga0495597_0083722 | Ga0495597_0083722_608_1246 | 201 |
| 412 | 3300048917 | Ga0496114_0626346 | Ga0496114_0626346_10_660 | 201 |
| 413 | 3300049513 | Ga0501290_003097 | Ga0501290_003097_306_941 | 201 |
| 414 | 3300049515 | Ga0501292_000035 | Ga0501292_000035_19985_20620 | 201 |
| 415 | 3300049517 | Ga0501294_000145 | Ga0501294_000145_5378_6013 | 201 |
| 416 | 3300049523 | Ga0501300_000782 | Ga0501300_000782_3623_4258 | 201 |
| 417 | 3300049652 | Ga0501202_021011 | Ga0501202_021011_306_941 | 201 |
| 418 | 3300049662 | Ga0501222_001052 | Ga0501222_001052_1331_1966 | 201 |
| 419 | 3300049663 | Ga0501223_000384 | Ga0501223_000384_411_1046 | 201 |
| 420 | 3300049664 | Ga0501224_000065 | Ga0501224_000065_1773_2408 | 201 |
| 421 | 3300049665 | Ga0501227_002342 | Ga0501227_002342_1450_2085 | 201 |
| 422 | 3300049668 | Ga0501233_000527 | Ga0501233_000527_2913_3548 | 201 |
| 423 | 3300049669 | Ga0501235_007630 | Ga0501235_007630_553_1188 | 201 |
| 424 | 3300049688 | Ga0501259_000065 | Ga0501259_000065_1728_2363 | 201 |
| 425 | 3300049690 | Ga0501261_000039 | Ga0501261_000039_13010_13645 | 201 |
| 426 | 3300049704 | Ga0501221_012099 | Ga0501221_012099_86_721 | 201 |
| 427 | 3300049705 | Ga0501225_0000627 | Ga0501225_0000627_3964_4599 | 201 |
| 428 | 3300049761 | Ga0501264_002229 | Ga0501264_002229_556_1191 | 201 |
| 429 | 3300049775 | Ga0501279_000033 | Ga0501279_000033_13045_13680 | 201 |
| 430 | 3300049776 | Ga0501280_000826 | Ga0501280_000826_1808_2443 | 201 |
| 431 | 3300049777 | Ga0501281_00024 | Ga0501281_00024_4375_5010 | 201 |
| 432 | 3300049778 | Ga0501282_000686 | Ga0501282_000686_585_1220 | 201 |
| 433 | 3300049779 | Ga0501283_000175 | Ga0501283_000175_1441_2076 | 201 |
| 434 | 3300053086 | Ga0500578_0335973 | Ga0500578_0335973_116_754 | 201 |
| 435 | 3300053139 | Ga0500568_0000245 | Ga0500568_0000245_27783_28418 | 201 |
| 436 | 3300005353 | Ga0070669_100000547 | Ga0070669_1000005476 | 202 |
| 437 | 3300005367 | Ga0070667_100187605 | Ga0070667_1001876051 | 202 |
| 438 | 3300005548 | Ga0070665_100046017 | Ga0070665_1000460172 | 202 |
| 439 | 3300005841 | Ga0068863_100026341 | Ga0068863_1000263413 | 202 |
| 440 | 3300025923 | Ga0207681_10000528 | Ga0207681_1000052819 | 202 |
| 441 | 3300025931 | Ga0207644_10000005 | Ga0207644_10000005215 | 202 |
| 442 | 3300025986 | Ga0207658_10118367 | Ga0207658_101183672 | 202 |
| 443 | 3300026088 | Ga0207641_10019400 | Ga0207641_100194003 | 202 |
| 444 | 3300026095 | Ga0207676_10687280 | Ga0207676_106872801 | 202 |
| 445 | 3300028381 | Ga0268264_10107797 | Ga0268264_101077972 | 202 |
| 446 | 3300031548 | Ga0307408_100253148 | Ga0307408_1002531481 | 202 |
| 447 | 3300031824 | Ga0307413_10972085 | Ga0307413_109720851 | 202 |
| 448 | 3300041460 | Ga0451802_0480640 | Ga0451802_0480640_483_1121 | 202 |
| 449 | 3300041462 | Ga0451806_796222 | Ga0451806_796222_443_1081 | 202 |
| 450 | 3300044683 | Ga0466965_0059215 | Ga0466965_0059215_721_1365 | 202 |
| 451 | 3300044693 | Ga0466961_0027126 | Ga0466961_0027126_1907_2551 | 202 |
| 452 | 3300044694 | Ga0466963_0034334 | Ga0466963_0034334_894_1538 | 202 |
| 453 | 3300044706 | Ga0466964_0005827 | Ga0466964_0005827_2505_3149 | 202 |
| 454 | 3300045049 | Ga0466959_0004747 | Ga0466959_0004747_2161_2805 | 202 |
| 455 | 3300045836 | Ga0466958_0067133 | Ga0466958_0067133_1066_1710 | 202 |
| 456 | 3300045976 | Ga0466967_0252055 | Ga0466967_0252055_660_1304 | 202 |
| 457 | 3300048904 | Ga0496101_0230788 | Ga0496101_0230788_707_1366 | 202 |
| 458 | 3300048905 | Ga0496102_0185148 | Ga0496102_0185148_692_1351 | 202 |
| 459 | 3300048907 | Ga0496104_0020209 | Ga0496104_0020209_2374_3033 | 202 |
| 460 | 3300048909 | Ga0496106_0000685 | Ga0496106_0000685_15743_16402 | 202 |
| 461 | 3300048910 | Ga0496107_0003034 | Ga0496107_0003034_4006_4665 | 202 |
| 462 | 3300048911 | Ga0496108_0921023 | Ga0496108_0921023_15_674 | 202 |
| 463 | 3300048916 | Ga0496113_0001740 | Ga0496113_0001740_2903_3562 | 202 |
| 464 | 3300049523 | Ga0501300_001219 | Ga0501300_001219_21_671 | 202 |
| 465 | 3300049686 | Ga0501257_000008 | Ga0501257_000008_12929_13567 | 202 |
| 466 | 3300061719 | Ga0466962_0010328 | Ga0466962_0010328_983_1627 | 202 |
| 467 | iso_pu_bacteria | 2842711865 | 2842716720 | 202 |
| 468 | iso_pu_bacteria | 2882806704 | 2882808845 | 202 |
| 469 | 3300005329 | Ga0070683_100227076 | Ga0070683_1002270762 | 203 |
| 470 | 3300005354 | Ga0070675_100051833 | Ga0070675_1000518333 | 203 |
| 471 | 3300005355 | Ga0070671_100062944 | Ga0070671_1000629443 | 203 |
| 472 | 3300005365 | Ga0070688_100143690 | Ga0070688_1001436902 | 203 |
| 473 | 3300005438 | Ga0070701_10226211 | Ga0070701_102262112 | 203 |
| 474 | 3300005535 | Ga0070684_100371451 | Ga0070684_1003714512 | 203 |
| 475 | 3300005539 | Ga0068853_100165213 | Ga0068853_1001652131 | 203 |
| 476 | 3300005539 | Ga0068853_100234020 | Ga0068853_1002340202 | 203 |
| 477 | 3300005549 | Ga0070704_100202539 | Ga0070704_1002025392 | 203 |
| 478 | 3300005549 | Ga0070704_100908527 | Ga0070704_1009085271 | 203 |
| 479 | 3300005577 | Ga0068857_100799562 | Ga0068857_1007995622 | 203 |
| 480 | 3300005578 | Ga0068854_100346178 | Ga0068854_1003461782 | 203 |
| 481 | 3300005616 | Ga0068852_100902246 | Ga0068852_1009022462 | 203 |
| 482 | 3300005618 | Ga0068864_100027734 | Ga0068864_1000277343 | 203 |
| 483 | 3300005840 | Ga0068870_10394034 | Ga0068870_103940341 | 203 |
| 484 | 3300005841 | Ga0068863_100030247 | Ga0068863_1000302474 | 203 |
| 485 | 3300009098 | Ga0105245_10054041 | Ga0105245_100540412 | 203 |
| 486 | 3300009553 | Ga0105249_10327508 | Ga0105249_103275082 | 203 |
| 487 | 3300013105 | Ga0157369_10294755 | Ga0157369_102947552 | 203 |
| 488 | 3300014325 | Ga0163163_10048029 | Ga0163163_100480293 | 203 |
| 489 | 3300014969 | Ga0157376_10360555 | Ga0157376_103605551 | 203 |
| 490 | 3300020070 | Ga0206356_11302048 | Ga0206356_113020482 | 203 |
| 491 | 3300025908 | Ga0207643_10245058 | Ga0207643_102450582 | 203 |
| 492 | 3300025924 | Ga0207694_10941260 | Ga0207694_109412601 | 203 |
| 493 | 3300025944 | Ga0207661_10114491 | Ga0207661_101144912 | 203 |
| 494 | 3300025981 | Ga0207640_10190138 | Ga0207640_101901382 | 203 |
| 495 | 3300025981 | Ga0207640_10310214 | Ga0207640_103102142 | 203 |
| 496 | 3300026041 | Ga0207639_10265957 | Ga0207639_102659572 | 203 |
| 497 | 3300026116 | Ga0207674_10237991 | Ga0207674_102379912 | 203 |
| 498 | 3300026142 | Ga0207698_10152176 | Ga0207698_101521762 | 203 |
| 499 | 3300027876 | Ga0209974_10058526 | Ga0209974_100585262 | 203 |
| 500 | 3300031731 | Ga0307405_10026460 | Ga0307405_100264602 | 203 |
| 501 | 3300031824 | Ga0307413_10184471 | Ga0307413_101844712 | 203 |
| 502 | 3300031911 | Ga0307412_10054270 | Ga0307412_100542702 | 203 |
| 503 | 3300031911 | Ga0307412_10073092 | Ga0307412_100730923 | 203 |
| 504 | 3300031911 | Ga0307412_10091325 | Ga0307412_100913252 | 203 |
| 505 | 3300031911 | Ga0307412_10099271 | Ga0307412_100992713 | 203 |
| 506 | 3300031995 | Ga0307409_100132192 | Ga0307409_1001321923 | 203 |
| 507 | 3300032004 | Ga0307414_10023406 | Ga0307414_100234063 | 203 |
| 508 | 3300034817 | Ga0373948_0052294 | Ga0373948_0052294_106_747 | 203 |
| 509 | 3300042003 | Ga0439443_020008 | Ga0439443_020008_305_952 | 203 |
| 510 | 3300044842 | Ga0466957_0156758 | Ga0466957_0156758_334_963 | 203 |
| 511 | 3300044901 | Ga0466960_0043862 | Ga0466960_0043862_905_1540 | 203 |
| 512 | 3300046472 | Ga0495580_0229445 | Ga0495580_0229445_378_1004 | 203 |
| 513 | 3300048905 | Ga0496102_0284087 | Ga0496102_0284087_14_658 | 203 |
| 514 | 3300048907 | Ga0496104_0011189 | Ga0496104_0011189_1248_1892 | 203 |
| 515 | 3300048920 | Ga0496117_0061452 | Ga0496117_0061452_1098_1742 | 203 |
| 516 | 3300048924 | Ga0496121_0000520 | Ga0496121_0000520_14181_14825 | 203 |
| 517 | 3300053134 | Ga0500658_0016262 | Ga0500658_0016262_1108_1752 | 203 |
| 518 | 3300005616 | Ga0068852_100146319 | Ga0068852_1001463192 | 204 |
| 519 | 3300025933 | Ga0207706_10003614 | Ga0207706_1000361415 | 204 |
| 520 | 3300026142 | Ga0207698_10049925 | Ga0207698_100499253 | 204 |
| 521 | 3300044658 | Ga0466972_0117367 | Ga0466972_0117367_321_959 | 205 |
| 522 | 3300046507 | Ga0495606_0000713 | Ga0495606_0000713_46462_47079 | 205 |
| 523 | 3300048091 | Ga0495626_0006858 | Ga0495626_0006858_2968_3585 | 205 |
| 524 | 3300003771 | Ga0055526_1000020 | Ga0055526_100002040 | 206 |
| 525 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006170 | 206 |
| 526 | 3300042876 | Ga0451577_0000068 | Ga0451577_0000068_113715_114353 | 206 |
| 527 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_23666_24304 | 206 |
| 528 | 3300045051 | Ga0451576_0003891 | Ga0451576_0003891_1167_1805 | 206 |
| 529 | 3300046453 | Ga0495627_015820 | Ga0495627_015820_1132_1752 | 206 |
| 530 | 3300046453 | Ga0495627_044654 | Ga0495627_044654_635_1255 | 206 |
| 531 | 3300046453 | Ga0495627_104078 | Ga0495627_104078_164_784 | 206 |
| 532 | 3300046457 | Ga0495590_0000004 | Ga0495590_0000004_319635_320255 | 206 |
| 533 | 3300046460 | Ga0495638_0000366 | Ga0495638_0000366_3696_4316 | 206 |
| 534 | 3300046471 | Ga0495650_0009581 | Ga0495650_0009581_1232_1852 | 206 |
| 535 | 3300046474 | Ga0495605_0024767 | Ga0495605_0024767_492_1112 | 206 |
| 536 | 3300046475 | Ga0495639_0013763 | Ga0495639_0013763_1149_1769 | 206 |
| 537 | 3300046491 | Ga0495584_0010554 | Ga0495584_0010554_3235_3855 | 206 |
| 538 | 3300046492 | Ga0495585_0007599 | Ga0495585_0007599_3646_4266 | 206 |
| 539 | 3300046492 | Ga0495585_0067026 | Ga0495585_0067026_42_662 | 206 |
| 540 | 3300046500 | Ga0495596_0042260 | Ga0495596_0042260_389_1009 | 206 |
| 541 | 3300046501 | Ga0495607_0001291 | Ga0495607_0001291_12196_12816 | 206 |
| 542 | 3300046501 | Ga0495607_0035309 | Ga0495607_0035309_2312_2932 | 206 |
| 543 | 3300046506 | Ga0495583_0000431 | Ga0495583_0000431_49452_50072 | 206 |
| 544 | 3300046506 | Ga0495583_0000508 | Ga0495583_0000508_51665_52285 | 206 |
| 545 | 3300046507 | Ga0495606_0002943 | Ga0495606_0002943_9746_10366 | 206 |
| 546 | 3300046507 | Ga0495606_0007026 | Ga0495606_0007026_3379_3999 | 206 |
| 547 | 3300046512 | Ga0495610_0003102 | Ga0495610_0003102_7939_8559 | 206 |
| 548 | 3300046512 | Ga0495610_0145563 | Ga0495610_0145563_370_990 | 206 |
| 549 | 3300046513 | Ga0495616_0056758 | Ga0495616_0056758_364_984 | 206 |
| 550 | 3300046518 | Ga0495631_0053468 | Ga0495631_0053468_679_1299 | 206 |
| 551 | 3300046519 | Ga0495632_0002076 | Ga0495632_0002076_7694_8314 | 206 |
| 552 | 3300046522 | Ga0495643_0000425 | Ga0495643_0000425_50642_51262 | 206 |
| 553 | 3300046523 | Ga0495644_0158835 | Ga0495644_0158835_94_714 | 206 |
| 554 | 3300046524 | Ga0495648_0000045 | Ga0495648_0000045_3696_4316 | 206 |
| 555 | 3300046528 | Ga0495642_0005275 | Ga0495642_0005275_651_1271 | 206 |
| 556 | 3300046528 | Ga0495642_0041598 | Ga0495642_0041598_350_970 | 206 |
| 557 | 3300046528 | Ga0495642_0046273 | Ga0495642_0046273_750_1370 | 206 |
| 558 | 3300046538 | Ga0495609_0012718 | Ga0495609_0012718_1643_2263 | 206 |
| 559 | 3300046538 | Ga0495609_0059979 | Ga0495609_0059979_946_1566 | 206 |
| 560 | 3300046542 | Ga0495597_0002143 | Ga0495597_0002143_3590_4210 | 206 |
| 561 | 3300046542 | Ga0495597_0002409 | Ga0495597_0002409_7682_8302 | 206 |
| 562 | 3300046542 | Ga0495597_0072048 | Ga0495597_0072048_745_1365 | 206 |
| 563 | 3300046557 | Ga0495622_0000003 | Ga0495622_0000003_19741_20388 | 206 |
| 564 | 3300046557 | Ga0495622_0001233 | Ga0495622_0001233_8829_9449 | 206 |
| 565 | 3300046558 | Ga0495633_0000113 | Ga0495633_0000113_104270_104890 | 206 |
| 566 | 3300046558 | Ga0495633_0000356 | Ga0495633_0000356_3695_4315 | 206 |
| 567 | 3300046558 | Ga0495633_0005368 | Ga0495633_0005368_3625_4245 | 206 |
| 568 | 3300046558 | Ga0495633_0019395 | Ga0495633_0019395_1291_1911 | 206 |
| 569 | 3300046558 | Ga0495633_0031382 | Ga0495633_0031382_461_1081 | 206 |
| 570 | 3300046616 | Ga0495668_0000369 | Ga0495668_0000369_8347_8967 | 206 |
| 571 | 3300046616 | Ga0495668_0001920 | Ga0495668_0001920_13113_13733 | 206 |
| 572 | 3300046616 | Ga0495668_0042967 | Ga0495668_0042967_1187_1807 | 206 |
| 573 | 3300046648 | Ga0495611_0017036 | Ga0495611_0017036_42_662 | 206 |
| 574 | 3300046660 | Ga0495625_0004323 | Ga0495625_0004323_9175_9795 | 206 |
| 575 | 3300046660 | Ga0495625_0042922 | Ga0495625_0042922_1815_2435 | 206 |
| 576 | 3300046665 | Ga0495661_0191240 | Ga0495661_0191240_364_984 | 206 |
| 577 | 3300046665 | Ga0495661_0344232 | Ga0495661_0344232_31_651 | 206 |
| 578 | 3300046684 | Ga0495669_0007706 | Ga0495669_0007706_387_1007 | 206 |
| 579 | 3300046684 | Ga0495669_0094217 | Ga0495669_0094217_32_652 | 206 |
| 580 | 3300046691 | Ga0495670_0020640 | Ga0495670_0020640_1931_2551 | 206 |
| 581 | 3300046692 | Ga0495671_0025873 | Ga0495671_0025873_452_1072 | 206 |
| 582 | 3300046694 | Ga0495649_0177970 | Ga0495649_0177970_373_993 | 206 |
| 583 | 3300046794 | Ga0495589_0054285 | Ga0495589_0054285_138_758 | 206 |
| 584 | 3300046810 | Ga0495660_0002893 | Ga0495660_0002893_625_1245 | 206 |
| 585 | 3300046810 | Ga0495660_0004832 | Ga0495660_0004832_7337_7957 | 206 |
| 586 | 3300047323 | Ga0495683_0033438 | Ga0495683_0033438_1918_2538 | 206 |
| 587 | 3300047443 | Ga0495687_003314 | Ga0495687_003314_4071_4691 | 206 |
| 588 | 3300047443 | Ga0495687_008410 | Ga0495687_008410_4076_4696 | 206 |
| 589 | 3300047445 | Ga0495677_0009316 | Ga0495677_0009316_2062_2682 | 206 |
| 590 | 3300047445 | Ga0495677_0063320 | Ga0495677_0063320_638_1258 | 206 |
| 591 | 3300047446 | Ga0495679_001444 | Ga0495679_001444_6771_7391 | 206 |
| 592 | 3300047470 | Ga0495681_0004629 | Ga0495681_0004629_7636_8256 | 206 |
| 593 | 3300047470 | Ga0495681_0014546 | Ga0495681_0014546_3774_4394 | 206 |
| 594 | 3300048090 | Ga0495615_0030665 | Ga0495615_0030665_240_860 | 206 |
| 595 | 3300048091 | Ga0495626_0031132 | Ga0495626_0031132_1708_2328 | 206 |
| 596 | 3300049459 | Ga0495678_017193 | Ga0495678_017193_225_845 | 206 |
| 597 | 3300049459 | Ga0495678_099218 | Ga0495678_099218_185_805 | 206 |
| 598 | 3300053145 | Ga0500586_000367 | Ga0500586_000367_7194_7814 | 206 |
| 599 | 3300002738 | JGI25154J39366_1002553 | JGI25154J39366_10025534 | 207 |
| 600 | 3300025246 | Ga0209646_1000028 | Ga0209646_100002831 | 207 |
| 601 | 3300027876 | Ga0209974_10004908 | Ga0209974_100049084 | 207 |
| 602 | 3300041512 | Ga0451853_0965935 | Ga0451853_0965935_245_871 | 207 |
| 603 | 3300046471 | Ga0495650_0000169 | Ga0495650_0000169_110130_110762 | 207 |
| 604 | 3300046500 | Ga0495596_0000149 | Ga0495596_0000149_16905_17528 | 207 |
| 605 | 3300046507 | Ga0495606_0018274 | Ga0495606_0018274_4567_5199 | 207 |
| 606 | 3300046519 | Ga0495632_0198445 | Ga0495632_0198445_214_846 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qcc-assembly1.cif.gz_A | structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains | 0.9767 | 7 | 206 |
| 2v81-assembly1.cif.gz_A | native kdpgal structure | 0.9762 | 7 | 207 |
| 2v81-assembly1.cif.gz_A | native kdpgal structure | 0.9484 | 7 | 207 |
| 4qcc-assembly1.cif.gz_A | structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains | 0.9398 | 7 | 206 |
| 8di1-assembly1.cif.gz_A | bfo2294: tannerella forsythia 2-keto-3-deoxy-6-phosphogluconate aldolase (kdpg) and 4-hydroxy-2-oxoglutarate aldolase (khg) | 0.923 | 9 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2v81A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.976 | 7 | 207 | 3.20.20.70 |
| 2v81A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9525 | 7 | 207 | 3.20.20.70 |
| 1vlwB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9203 | 10 | 205 | 3.20.20.70 |
| af_A0A1D6HW21_144_318_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9121 | 32 | 200 | 3.20.20.70 |
| af_K7LFS0_36_255_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9008 | 10 | 200 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520DGF5-F1-model_v4 | deleted | 0.9899 | 61 | 205 |
|
| AF-A0A512APH9-F1-model_v4 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase | 0.9888 | 8 | 204 |
GO:0016829
|
| AF-A0A6L8L701-F1-model_v4 | deleted | 0.9872 | 1 | 207 |
|
| AF-A0A841LAR4-F1-model_v4 | 2-dehydro-3-deoxyphosphogalactonate aldolase (EC 4.1.2.21) | 0.9862 | 8 | 202 |
GO:0016829
|
| AF-A0A1A9HIH2-F1-model_v4 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase | 0.9857 | 8 | 204 |
GO:0016829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar