F468487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 605 | 365 | 570 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300028786|Ga0307517_10074650|Ga0307517_100746502 |
| Length | 178 |
| Sequence | MEPAPRRQPHSEDGRGENRDGNRGEYRLEGDDSMYRLPSGLLAPVVTRAGEEHTDAAGSGGAVRISGVSIQHTPATRLWYGKVSNEPGYRSVTHHHGEAETGGYVLSGRARIYFGEKFEDYLDMEEGDWVFVPPFMPHVECNLSRTSPLVWMTTRTPENIVVNLPDVDDAELRDWLNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 3 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 4 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 5 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 6 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 7 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 8 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 9 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 10 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 11 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 12 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 13 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 14 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 15 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 16 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 17 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 18 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 19 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 20 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 21 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 22 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 23 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 24 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 25 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 26 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 27 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 28 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 29 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 89 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 131 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 132 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 133 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 134 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 135 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 136 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 139 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 140 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 141 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 154 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 155 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 173 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 174 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 175 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 176 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 177 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 178 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 179 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 180 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 181 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 182 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 183 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 197 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 198 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 333 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 334 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 335 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 338 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 339 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 340 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 342 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 344 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 345 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 346 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 349 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 350 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 353 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 354 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 355 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 357 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 358 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 360 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 361 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 362 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 363 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 364 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 365 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.74 |
| Metatranscriptomes | 2.81 |
| Isolates | 5.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.33 |
| Bulb | 0 |
| Endosphere | 8.6 |
| Nodule | 0 |
| Rhizoplane | 5.12 |
| Rhizosphere | 75.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000298 | 3300002773 | Bacteria | 32097 |
| 2 | JGI25150J39212_1029224 | 3300002774 | Bacteria | 775 |
| 3 | JGI25151J46595_10046195 | 3300003187 | Bacteria | 1527 |
| 4 | Ga0070683_100174604 | 3300005329 | Bacteria | 2040 |
| 5 | Ga0070683_100242135 | 3300005329 | Bacteria | 1716 |
| 6 | Ga0070683_100580054 | 3300005329 | Bacteria | 1073 |
| 7 | Ga0068869_100308701 | 3300005334 | Bacteria | 1280 |
| 8 | Ga0070682_100461973 | 3300005337 | Bacteria | 975 |
| 9 | Ga0070660_100037991 | 3300005339 | Bacteria | 3652 |
| 10 | Ga0070691_10130119 | 3300005341 | Bacteria | 1275 |
| 11 | Ga0070692_10141289 | 3300005345 | Bacteria | 1363 |
| 12 | Ga0070668_100323191 | 3300005347 | Bacteria | 1299 |
| 13 | Ga0070659_100596673 | 3300005366 | Bacteria | 949 |
| 14 | Ga0070659_100735480 | 3300005366 | Bacteria | 855 |
| 15 | Ga0070667_100343302 | 3300005367 | Bacteria | 1351 |
| 16 | Ga0070667_100855337 | 3300005367 | Bacteria | 845 |
| 17 | Ga0070714_100076873 | 3300005435 | Bacteria | 2899 |
| 18 | Ga0070714_101000304 | 3300005435 | Bacteria | 814 |
| 19 | Ga0070714_101150871 | 3300005435 | Bacteria | 757 |
| 20 | Ga0070713_100074966 | 3300005436 | Bacteria | 2868 |
| 21 | Ga0070713_100159142 | 3300005436 | Bacteria | 2015 |
| 22 | Ga0070713_100161154 | 3300005436 | Bacteria | 2003 |
| 23 | Ga0070711_100023630 | 3300005439 | Bacteria | 4001 |
| 24 | Ga0070705_100266913 | 3300005440 | Bacteria | 1210 |
| 25 | Ga0070663_100426276 | 3300005455 | Bacteria | 1089 |
| 26 | Ga0070678_100194885 | 3300005456 | Bacteria | 1668 |
| 27 | Ga0070681_10274417 | 3300005458 | Bacteria | 1597 |
| 28 | Ga0070685_11008424 | 3300005466 | Bacteria | 625 |
| 29 | Ga0070679_100087791 | 3300005530 | Bacteria | 3097 |
| 30 | Ga0070679_100302946 | 3300005530 | Bacteria | 1549 |
| 31 | Ga0070684_100057683 | 3300005535 | Bacteria | 3391 |
| 32 | Ga0068853_100027362 | 3300005539 | Bacteria | 4791 |
| 33 | Ga0068853_101106018 | 3300005539 | Bacteria | 764 |
| 34 | Ga0070672_100146234 | 3300005543 | Bacteria | 1953 |
| 35 | Ga0070665_100004557 | 3300005548 | Bacteria | 14522 |
| 36 | Ga0070665_100185865 | 3300005548 | Bacteria | 2079 |
| 37 | Ga0068857_100296446 | 3300005577 | Bacteria | 1490 |
| 38 | Ga0068857_101022637 | 3300005577 | Bacteria | 796 |
| 39 | Ga0068856_100652551 | 3300005614 | Bacteria | 1073 |
| 40 | Ga0068856_100784321 | 3300005614 | Bacteria | 973 |
| 41 | Ga0068852_100199521 | 3300005616 | Bacteria | 1893 |
| 42 | Ga0068864_100813784 | 3300005618 | Bacteria | 919 |
| 43 | Ga0068863_100009897 | 3300005841 | Bacteria | 9284 |
| 44 | Ga0068863_100957606 | 3300005841 | Bacteria | 858 |
| 45 | Ga0068858_100034983 | 3300005842 | Bacteria | 4659 |
| 46 | Ga0068858_100934096 | 3300005842 | Bacteria | 849 |
| 47 | Ga0068860_100014727 | 3300005843 | Bacteria | 7648 |
| 48 | Ga0068860_100059694 | 3300005843 | Bacteria | 3626 |
| 49 | Ga0068862_100041865 | 3300005844 | Bacteria | 3899 |
| 50 | Ga0075365_10031285 | 3300006038 | Bacteria | 3413 |
| 51 | Ga0075365_10109934 | 3300006038 | Bacteria | 1894 |
| 52 | Ga0075363_100626938 | 3300006048 | Bacteria | 646 |
| 53 | Ga0075364_10467837 | 3300006051 | Bacteria | 862 |
| 54 | Ga0070712_101366458 | 3300006175 | Bacteria | 618 |
| 55 | Ga0075362_10239170 | 3300006177 | Bacteria | 891 |
| 56 | Ga0075367_10667759 | 3300006178 | Bacteria | 661 |
| 57 | Ga0075370_10251202 | 3300006353 | Bacteria | 1048 |
| 58 | Ga0105244_10010864 | 3300009036 | Bacteria | 5496 |
| 59 | Ga0105244_10081604 | 3300009036 | Bacteria | 1600 |
| 60 | Ga0105247_10631990 | 3300009101 | Bacteria | 798 |
| 61 | Ga0105243_10022723 | 3300009148 | Bacteria | 4769 |
| 62 | Ga0105243_10051988 | 3300009148 | Bacteria | 3243 |
| 63 | Ga0105243_10587321 | 3300009148 | Bacteria | 1070 |
| 64 | Ga0105246_10007977 | 3300011119 | Bacteria | 6498 |
| 65 | Ga0105246_10008282 | 3300011119 | Bacteria | 6386 |
| 66 | Ga0157370_10038015 | 3300013104 | Bacteria | 4659 |
| 67 | Ga0157369_10095681 | 3300013105 | Bacteria | 3168 |
| 68 | Ga0157369_10974848 | 3300013105 | Bacteria | 868 |
| 69 | Ga0157378_10372226 | 3300013297 | Bacteria | 1401 |
| 70 | Ga0163162_10001793 | 3300013306 | Bacteria | 20150 |
| 71 | Ga0157372_10837259 | 3300013307 | Bacteria | 1068 |
| 72 | Ga0157375_10003423 | 3300013308 | Bacteria | 13755 |
| 73 | Ga0157375_10096747 | 3300013308 | Bacteria | 3025 |
| 74 | Ga0157375_10343357 | 3300013308 | Bacteria | 1658 |
| 75 | Ga0163163_10721910 | 3300014325 | Bacteria | 1060 |
| 76 | Ga0182008_10246706 | 3300014497 | Bacteria | 920 |
| 77 | Ga0157379_10287071 | 3300014968 | Bacteria | 1498 |
| 78 | Ga0157376_11502449 | 3300014969 | Bacteria | 707 |
| 79 | Ga0206356_11465510 | 3300020070 | Bacteria | 1997 |
| 80 | Ga0206349_1507694 | 3300020075 | Bacteria | 827 |
| 81 | Ga0206351_10576349 | 3300020077 | Bacteria | 744 |
| 82 | Ga0206351_10691340 | 3300020077 | Bacteria | 779 |
| 83 | Ga0206350_10127885 | 3300020080 | Bacteria | 840 |
| 84 | Ga0206350_10383883 | 3300020080 | Bacteria | 1948 |
| 85 | Ga0206354_10930448 | 3300020081 | Bacteria | 1175 |
| 86 | Ga0206353_10810260 | 3300020082 | Bacteria | 1952 |
| 87 | Ga0206353_11094702 | 3300020082 | Bacteria | 1411 |
| 88 | Ga0206353_11389892 | 3300020082 | Bacteria | 3802 |
| 89 | Ga0213875_10157203 | 3300021388 | Bacteria | 1066 |
| 90 | Ga0224712_10047789 | 3300022467 | Bacteria | 1648 |
| 91 | Ga0224712_10176069 | 3300022467 | Bacteria | 962 |
| 92 | Ga0224712_10421740 | 3300022467 | Bacteria | 638 |
| 93 | Ga0224712_10543283 | 3300022467 | Bacteria | 564 |
| 94 | Ga0224712_10581953 | 3300022467 | Bacteria | 546 |
| 95 | Ga0207425_1016965 | 3300025245 | Bacteria | 1609 |
| 96 | Ga0209129_1000064 | 3300025258 | Bacteria | 236026 |
| 97 | Ga0209025_1001863 | 3300025294 | Bacteria | 24711 |
| 98 | Ga0209051_1008018 | 3300025303 | Bacteria | 5661 |
| 99 | Ga0207697_10007253 | 3300025315 | Bacteria | 4952 |
| 100 | Ga0207697_10236818 | 3300025315 | Bacteria | 806 |
| 101 | Ga0207655_1006782 | 3300025728 | Bacteria | 7532 |
| 102 | Ga0207655_1027211 | 3300025728 | Bacteria | 2729 |
| 103 | Ga0207682_10196894 | 3300025893 | Bacteria | 925 |
| 104 | Ga0207705_10189253 | 3300025909 | Bacteria | 1555 |
| 105 | Ga0207707_10003354 | 3300025912 | Bacteria | 14219 |
| 106 | Ga0207693_10416856 | 3300025915 | Bacteria | 1050 |
| 107 | Ga0207663_10223726 | 3300025916 | Bacteria | 1371 |
| 108 | Ga0207660_10146096 | 3300025917 | Bacteria | 1812 |
| 109 | Ga0207662_11005040 | 3300025918 | Bacteria | 592 |
| 110 | Ga0207657_10014957 | 3300025919 | Bacteria | 7540 |
| 111 | Ga0207694_10701115 | 3300025924 | Bacteria | 854 |
| 112 | Ga0207650_10250447 | 3300025925 | Bacteria | 1434 |
| 113 | Ga0207650_11055201 | 3300025925 | Bacteria | 691 |
| 114 | Ga0207700_10301398 | 3300025928 | Bacteria | 1384 |
| 115 | Ga0207700_10440054 | 3300025928 | Bacteria | 1147 |
| 116 | Ga0207700_10918844 | 3300025928 | Bacteria | 783 |
| 117 | Ga0207664_10009672 | 3300025929 | Bacteria | 6777 |
| 118 | Ga0207664_10513526 | 3300025929 | Bacteria | 1074 |
| 119 | Ga0207644_10442454 | 3300025931 | Bacteria | 1067 |
| 120 | Ga0207709_10012576 | 3300025935 | Bacteria | 4663 |
| 121 | Ga0207709_10017656 | 3300025935 | Bacteria | 3985 |
| 122 | Ga0207709_10282833 | 3300025935 | Bacteria | 1226 |
| 123 | Ga0207709_10421256 | 3300025935 | Bacteria | 1026 |
| 124 | Ga0207665_10390811 | 3300025939 | Bacteria | 1057 |
| 125 | Ga0207691_10738593 | 3300025940 | Bacteria | 829 |
| 126 | Ga0207689_10223220 | 3300025942 | Bacteria | 1557 |
| 127 | Ga0207689_10275526 | 3300025942 | Bacteria | 1393 |
| 128 | Ga0207661_10059663 | 3300025944 | Bacteria | 3075 |
| 129 | Ga0207661_10107146 | 3300025944 | Bacteria | 2357 |
| 130 | Ga0207661_10117885 | 3300025944 | Bacteria | 2256 |
| 131 | Ga0207668_10296193 | 3300025972 | Bacteria | 1333 |
| 132 | Ga0207658_10723733 | 3300025986 | Bacteria | 900 |
| 133 | Ga0207677_11021489 | 3300026023 | Bacteria | 751 |
| 134 | Ga0207703_10149443 | 3300026035 | Bacteria | 2035 |
| 135 | Ga0207703_10222658 | 3300026035 | Bacteria | 1688 |
| 136 | Ga0207639_10052921 | 3300026041 | Bacteria | 3095 |
| 137 | Ga0207678_10028639 | 3300026067 | Bacteria | 4860 |
| 138 | Ga0207708_10258750 | 3300026075 | Bacteria | 1404 |
| 139 | Ga0207641_10011017 | 3300026088 | Bacteria | 7416 |
| 140 | Ga0207641_10882114 | 3300026088 | Bacteria | 888 |
| 141 | Ga0207676_10440793 | 3300026095 | Bacteria | 1226 |
| 142 | Ga0207674_10121337 | 3300026116 | Bacteria | 2581 |
| 143 | Ga0207674_10137627 | 3300026116 | Bacteria | 2403 |
| 144 | Ga0207674_10515595 | 3300026116 | Bacteria | 1155 |
| 145 | Ga0207675_100669535 | 3300026118 | Bacteria | 1045 |
| 146 | Ga0207683_10282289 | 3300026121 | Bacteria | 1517 |
| 147 | Ga0207683_10728980 | 3300026121 | Bacteria | 919 |
| 148 | Ga0207698_10963328 | 3300026142 | Bacteria | 863 |
| 149 | Ga0207428_10088141 | 3300027907 | Bacteria | 2414 |
| 150 | Ga0268266_10028984 | 3300028379 | Bacteria | 4704 |
| 151 | Ga0268266_11332569 | 3300028379 | Bacteria | 693 |
| 152 | Ga0268264_10008739 | 3300028381 | Bacteria | 8410 |
| 153 | Ga0268264_10023396 | 3300028381 | Bacteria | 5042 |
| 154 | Ga0307517_10001880 | 3300028786 | Bacteria | 34363 |
| 155 | Ga0307517_10044397 | 3300028786 | Bacteria | 4702 |
| 156 | Ga0307517_10074650 | 3300028786 | Bacteria | 2987 |
| 157 | Ga0307515_10000025 | 3300028794 | Bacteria | 390205 |
| 158 | Ga0307515_10051743 | 3300028794 | Bacteria | 6113 |
| 159 | Ga0307515_10440936 | 3300028794 | Bacteria | 919 |
| 160 | Ga0307511_10018885 | 3300030521 | Bacteria | 6573 |
| 161 | Ga0307511_10056542 | 3300030521 | Bacteria | 3066 |
| 162 | Ga0307512_10001507 | 3300030522 | Bacteria | 32791 |
| 163 | Ga0307512_10043743 | 3300030522 | Bacteria | 3690 |
| 164 | Ga0314311_1250029 | 3300030733 | Bacteria | 2039 |
| 165 | Ga0307513_10001759 | 3300031456 | Bacteria | 30872 |
| 166 | Ga0307513_10031957 | 3300031456 | Bacteria | 5948 |
| 167 | Ga0307513_10377710 | 3300031456 | Bacteria | 1157 |
| 168 | Ga0307513_10412592 | 3300031456 | Bacteria | 1082 |
| 169 | Ga0307509_10008111 | 3300031507 | Bacteria | 13478 |
| 170 | Ga0307509_10028028 | 3300031507 | Bacteria | 6263 |
| 171 | Ga0307509_10094899 | 3300031507 | Bacteria | 3040 |
| 172 | Ga0307509_10134928 | 3300031507 | Bacteria | 2415 |
| 173 | Ga0307509_10475373 | 3300031507 | Bacteria | 939 |
| 174 | Ga0307408_100049738 | 3300031548 | Bacteria | 3012 |
| 175 | Ga0307408_100149859 | 3300031548 | Bacteria | 1840 |
| 176 | Ga0307408_100550253 | 3300031548 | Bacteria | 1018 |
| 177 | Ga0307508_10001011 | 3300031616 | Bacteria | 32731 |
| 178 | Ga0307508_10015571 | 3300031616 | Bacteria | 6928 |
| 179 | Ga0307508_10023926 | 3300031616 | Bacteria | 5544 |
| 180 | Ga0307508_10219990 | 3300031616 | Bacteria | 1499 |
| 181 | Ga0307508_10281724 | 3300031616 | Bacteria | 1255 |
| 182 | Ga0307508_10294367 | 3300031616 | Bacteria | 1216 |
| 183 | Ga0307514_10033517 | 3300031649 | Bacteria | 4098 |
| 184 | Ga0307514_10168116 | 3300031649 | Bacteria | 1437 |
| 185 | Ga0307516_10127664 | 3300031730 | Bacteria | 2326 |
| 186 | Ga0307516_10555602 | 3300031730 | Bacteria | 802 |
| 187 | Ga0307405_10117468 | 3300031731 | Bacteria | 1813 |
| 188 | Ga0307405_10120417 | 3300031731 | Bacteria | 1795 |
| 189 | Ga0307405_10474426 | 3300031731 | Bacteria | 997 |
| 190 | Ga0307413_10007847 | 3300031824 | Bacteria | 4993 |
| 191 | Ga0307413_10011632 | 3300031824 | Bacteria | 4339 |
| 192 | Ga0307413_10104925 | 3300031824 | Bacteria | 1877 |
| 193 | Ga0307413_10490735 | 3300031824 | Bacteria | 984 |
| 194 | Ga0307413_10517325 | 3300031824 | Bacteria | 962 |
| 195 | Ga0307518_10131071 | 3300031838 | Bacteria | 1762 |
| 196 | Ga0307518_10501790 | 3300031838 | Bacteria | 624 |
| 197 | Ga0307410_10062549 | 3300031852 | Bacteria | 2551 |
| 198 | Ga0307410_10153056 | 3300031852 | Bacteria | 1719 |
| 199 | Ga0307410_10236863 | 3300031852 | Bacteria | 1412 |
| 200 | Ga0307410_10362263 | 3300031852 | Bacteria | 1161 |
| 201 | Ga0307410_10418203 | 3300031852 | Bacteria | 1087 |
| 202 | Ga0307410_11379190 | 3300031852 | Bacteria | 618 |
| 203 | Ga0307406_10096832 | 3300031901 | Bacteria | 2000 |
| 204 | Ga0307406_10107911 | 3300031901 | Bacteria | 1910 |
| 205 | Ga0307406_10175115 | 3300031901 | Bacteria | 1557 |
| 206 | Ga0307407_10029246 | 3300031903 | Bacteria | 2957 |
| 207 | Ga0307407_10088405 | 3300031903 | Bacteria | 1893 |
| 208 | Ga0307407_10188967 | 3300031903 | Bacteria | 1371 |
| 209 | Ga0307407_10347239 | 3300031903 | Bacteria | 1050 |
| 210 | Ga0307412_10036474 | 3300031911 | Bacteria | 3150 |
| 211 | Ga0307412_10052656 | 3300031911 | Bacteria | 2696 |
| 212 | Ga0307412_10247102 | 3300031911 | Bacteria | 1383 |
| 213 | Ga0307412_11766147 | 3300031911 | Bacteria | 568 |
| 214 | Ga0307409_100405748 | 3300031995 | Bacteria | 1303 |
| 215 | Ga0307409_100432462 | 3300031995 | Bacteria | 1266 |
| 216 | Ga0307409_100505859 | 3300031995 | Bacteria | 1177 |
| 217 | Ga0307409_100696679 | 3300031995 | Bacteria | 1015 |
| 218 | Ga0307409_100899749 | 3300031995 | Bacteria | 899 |
| 219 | Ga0307416_100000832 | 3300032002 | Bacteria | 16241 |
| 220 | Ga0307416_100006456 | 3300032002 | Bacteria | 7343 |
| 221 | Ga0307416_100033029 | 3300032002 | Bacteria | 3918 |
| 222 | Ga0307416_100114994 | 3300032002 | Bacteria | 2381 |
| 223 | Ga0307416_100569760 | 3300032002 | Bacteria | 1208 |
| 224 | Ga0307416_100777901 | 3300032002 | Bacteria | 1052 |
| 225 | Ga0307416_102819869 | 3300032002 | Bacteria | 581 |
| 226 | Ga0307414_10642025 | 3300032004 | Bacteria | 956 |
| 227 | Ga0307414_10715165 | 3300032004 | Bacteria | 908 |
| 228 | Ga0307411_10481816 | 3300032005 | Bacteria | 1045 |
| 229 | Ga0307411_11641733 | 3300032005 | Bacteria | 594 |
| 230 | Ga0307415_100060643 | 3300032126 | Bacteria | 2615 |
| 231 | Ga0307507_10000084 | 3300033179 | Bacteria | 145642 |
| 232 | Ga0307507_10010281 | 3300033179 | Bacteria | 12145 |
| 233 | Ga0307507_10079522 | 3300033179 | Bacteria | 2897 |
| 234 | Ga0307510_10003046 | 3300033180 | Bacteria | 19352 |
| 235 | Ga0307510_10131082 | 3300033180 | Bacteria | 2180 |
| 236 | Ga0373944_0207041 | 3300035089 | Bacteria | 712 |
| 237 | Ga0373946_0639991 | 3300035171 | Bacteria | 553 |
| 238 | Ga0373935_0002713 | 3300035692 | Bacteria | 10187 |
| 239 | Ga0373935_0094401 | 3300035692 | Bacteria | 1963 |
| 240 | Ga0373927_0367561 | 3300035695 | Bacteria | 948 |
| 241 | Ga0373947_0231310 | 3300035725 | Bacteria | 1218 |
| 242 | Ga0373937_0328745 | 3300036401 | Bacteria | 1447 |
| 243 | Ga0372808_007824 | 3300036459 | Bacteria | 1470 |
| 244 | Ga0372808_033818 | 3300036459 | Bacteria | 733 |
| 245 | Ga0373925_0000020 | 3300037068 | Bacteria | 170299 |
| 246 | Ga0373925_1181425 | 3300037068 | Bacteria | 629 |
| 247 | Ga0395899_0002326 | 3300037312 | Bacteria | 15475 |
| 248 | Ga0395900_0231683 | 3300037418 | Bacteria | 1857 |
| 249 | Ga0395898_0009860 | 3300037466 | Bacteria | 10011 |
| 250 | Ga0395898_0039482 | 3300037466 | Bacteria | 4672 |
| 251 | Ga0395898_0099398 | 3300037466 | Bacteria | 2794 |
| 252 | Ga0395898_0449634 | 3300037466 | Bacteria | 1227 |
| 253 | Ga0395898_0529183 | 3300037466 | Bacteria | 1120 |
| 254 | Ga0395905_0049729 | 3300037471 | Bacteria | 3929 |
| 255 | Ga0436364_1132424 | 3300037853 | Bacteria | 1258 |
| 256 | Ga0395901_0036661 | 3300038443 | Bacteria | 5069 |
| 257 | Ga0395901_0089453 | 3300038443 | Bacteria | 3222 |
| 258 | Ga0395901_0098258 | 3300038443 | Bacteria | 3069 |
| 259 | Ga0395901_0105512 | 3300038443 | Bacteria | 2957 |
| 260 | Ga0395901_0467140 | 3300038443 | Bacteria | 1288 |
| 261 | Ga0451791_1894528 | 3300041451 | Bacteria | 854 |
| 262 | Ga0451802_0443385 | 3300041460 | Bacteria | 663 |
| 263 | Ga0451807_1599420 | 3300041486 | Bacteria | 673 |
| 264 | Ga0451835_0666825 | 3300041492 | Bacteria | 1543 |
| 265 | Ga0451837_1735119 | 3300041494 | Bacteria | 1769 |
| 266 | Ga0451839_1472345 | 3300041496 | Bacteria | 1047 |
| 267 | Ga0451841_0364791 | 3300041498 | Bacteria | 929 |
| 268 | Ga0451845_0797742 | 3300041501 | Bacteria | 881 |
| 269 | Ga0451847_0520032 | 3300041503 | Bacteria | 709 |
| 270 | Ga0451853_2470593 | 3300041512 | Bacteria | 3458 |
| 271 | Ga0451853_3963956 | 3300041512 | Bacteria | 1589 |
| 272 | Ga0439433_0169911 | 3300041999 | Bacteria | 567 |
| 273 | Ga0450894_003861 | 3300042131 | Bacteria | 1961 |
| 274 | Ga0450898_004651 | 3300042134 | Bacteria | 2039 |
| 275 | Ga0450899_000631 | 3300042135 | Bacteria | 4017 |
| 276 | Ga0450906_002466 | 3300042145 | Bacteria | 4046 |
| 277 | Ga0466969_0000705 | 3300044656 | Bacteria | 18097 |
| 278 | Ga0466972_0052361 | 3300044658 | Bacteria | 1967 |
| 279 | Ga0466972_0144323 | 3300044658 | Bacteria | 1120 |
| 280 | Ga0466965_0003253 | 3300044683 | Bacteria | 7106 |
| 281 | Ga0466965_0385078 | 3300044683 | Bacteria | 773 |
| 282 | Ga0466966_0041873 | 3300044684 | Bacteria | 2942 |
| 283 | Ga0466966_0053708 | 3300044684 | Bacteria | 2555 |
| 284 | Ga0466961_0003833 | 3300044693 | Bacteria | 9407 |
| 285 | Ga0466961_0045642 | 3300044693 | Bacteria | 2803 |
| 286 | Ga0466963_0008224 | 3300044694 | Bacteria | 6252 |
| 287 | Ga0466963_0535922 | 3300044694 | Bacteria | 827 |
| 288 | Ga0466964_0286976 | 3300044706 | Bacteria | 825 |
| 289 | Ga0466971_0002406 | 3300044719 | Bacteria | 7896 |
| 290 | Ga0466971_0012310 | 3300044719 | Bacteria | 3747 |
| 291 | Ga0466968_0075918 | 3300044735 | Bacteria | 1470 |
| 292 | Ga0466970_0254431 | 3300044765 | Bacteria | 985 |
| 293 | Ga0466960_0067546 | 3300044901 | Bacteria | 1771 |
| 294 | Ga0466960_0123442 | 3300044901 | Bacteria | 1359 |
| 295 | Ga0466959_0004161 | 3300045049 | Bacteria | 9637 |
| 296 | Ga0466959_0097056 | 3300045049 | Bacteria | 2112 |
| 297 | Ga0466959_0620223 | 3300045049 | Bacteria | 727 |
| 298 | Ga0466958_0236527 | 3300045836 | Bacteria | 1167 |
| 299 | Ga0466967_0046461 | 3300045976 | Bacteria | 3780 |
| 300 | Ga0495617_005542 | 3300046452 | Bacteria | 4470 |
| 301 | Ga0495592_0021090 | 3300046454 | Bacteria | 4954 |
| 302 | Ga0495592_0041342 | 3300046454 | Bacteria | 3455 |
| 303 | Ga0495603_0004604 | 3300046455 | Bacteria | 8230 |
| 304 | Ga0495603_0044785 | 3300046455 | Bacteria | 2640 |
| 305 | Ga0495629_0003536 | 3300046459 | Bacteria | 11808 |
| 306 | Ga0495629_0014302 | 3300046459 | Bacteria | 5710 |
| 307 | Ga0495629_0053055 | 3300046459 | Bacteria | 2837 |
| 308 | Ga0495629_0195378 | 3300046459 | Bacteria | 1399 |
| 309 | Ga0495638_0131209 | 3300046460 | Bacteria | 1471 |
| 310 | Ga0495638_0266274 | 3300046460 | Bacteria | 937 |
| 311 | Ga0495651_0000674 | 3300046462 | Bacteria | 26519 |
| 312 | Ga0495651_0009009 | 3300046462 | Bacteria | 7662 |
| 313 | Ga0495653_0065156 | 3300046463 | Bacteria | 2743 |
| 314 | Ga0495580_0969978 | 3300046472 | Bacteria | 543 |
| 315 | Ga0495582_0035749 | 3300046473 | Bacteria | 2732 |
| 316 | Ga0495605_0013236 | 3300046474 | Bacteria | 4554 |
| 317 | Ga0495639_0479176 | 3300046475 | Bacteria | 634 |
| 318 | Ga0495662_0004188 | 3300046476 | Bacteria | 7267 |
| 319 | Ga0495664_0003414 | 3300046477 | Bacteria | 8631 |
| 320 | Ga0495664_0143593 | 3300046477 | Bacteria | 1447 |
| 321 | Ga0495584_0307007 | 3300046491 | Bacteria | 806 |
| 322 | Ga0495585_0038237 | 3300046492 | Bacteria | 2701 |
| 323 | Ga0495594_0064243 | 3300046499 | Bacteria | 2034 |
| 324 | Ga0495594_0113872 | 3300046499 | Bacteria | 1526 |
| 325 | Ga0495594_0282581 | 3300046499 | Bacteria | 945 |
| 326 | Ga0495596_0008135 | 3300046500 | Bacteria | 4683 |
| 327 | Ga0495607_0029983 | 3300046501 | Bacteria | 3344 |
| 328 | Ga0495583_0148526 | 3300046506 | Bacteria | 972 |
| 329 | Ga0495606_0019954 | 3300046507 | Bacteria | 4961 |
| 330 | Ga0495608_0289874 | 3300046511 | Bacteria | 1015 |
| 331 | Ga0495610_0015879 | 3300046512 | Bacteria | 4356 |
| 332 | Ga0495616_0030674 | 3300046513 | Bacteria | 2822 |
| 333 | Ga0495618_0039130 | 3300046514 | Bacteria | 2981 |
| 334 | Ga0495620_0047630 | 3300046515 | Bacteria | 1843 |
| 335 | Ga0495628_0027386 | 3300046516 | Bacteria | 4639 |
| 336 | Ga0495628_0045346 | 3300046516 | Bacteria | 3496 |
| 337 | Ga0495628_0066066 | 3300046516 | Bacteria | 2827 |
| 338 | Ga0495630_0269327 | 3300046517 | Bacteria | 1301 |
| 339 | Ga0495631_0004942 | 3300046518 | Bacteria | 7025 |
| 340 | Ga0495632_0052963 | 3300046519 | Bacteria | 1994 |
| 341 | Ga0495632_0239544 | 3300046519 | Bacteria | 816 |
| 342 | Ga0495637_0040125 | 3300046520 | Bacteria | 2017 |
| 343 | Ga0495637_0076345 | 3300046520 | Bacteria | 1343 |
| 344 | Ga0495643_0002386 | 3300046522 | Bacteria | 14999 |
| 345 | Ga0495643_0182413 | 3300046522 | Bacteria | 1019 |
| 346 | Ga0495666_0006190 | 3300046526 | Bacteria | 6022 |
| 347 | Ga0495652_0014703 | 3300046529 | Bacteria | 7018 |
| 348 | Ga0495652_0509251 | 3300046529 | Bacteria | 833 |
| 349 | Ga0495654_0025934 | 3300046530 | Bacteria | 3018 |
| 350 | Ga0495654_0203538 | 3300046530 | Bacteria | 846 |
| 351 | Ga0495640_0085571 | 3300046533 | Bacteria | 2089 |
| 352 | Ga0495640_0220603 | 3300046533 | Bacteria | 1196 |
| 353 | Ga0495586_0035865 | 3300046535 | Bacteria | 2664 |
| 354 | Ga0495586_0159896 | 3300046535 | Bacteria | 1270 |
| 355 | Ga0495586_0475278 | 3300046535 | Bacteria | 721 |
| 356 | Ga0495587_0004886 | 3300046536 | Bacteria | 8788 |
| 357 | Ga0495587_0498333 | 3300046536 | Bacteria | 673 |
| 358 | Ga0495597_0017671 | 3300046542 | Bacteria | 3351 |
| 359 | Ga0495645_0035305 | 3300046543 | Bacteria | 3645 |
| 360 | Ga0495622_0002284 | 3300046557 | Bacteria | 9319 |
| 361 | Ga0495622_0331474 | 3300046557 | Bacteria | 660 |
| 362 | Ga0495633_0030830 | 3300046558 | Bacteria | 2603 |
| 363 | Ga0495633_0050793 | 3300046558 | Bacteria | 1954 |
| 364 | Ga0495633_0053018 | 3300046558 | Bacteria | 1909 |
| 365 | Ga0495656_0006202 | 3300046615 | Bacteria | 4183 |
| 366 | Ga0495656_0520726 | 3300046615 | Bacteria | 632 |
| 367 | Ga0495656_0579823 | 3300046615 | Bacteria | 599 |
| 368 | Ga0495668_0052802 | 3300046616 | Bacteria | 2248 |
| 369 | Ga0495634_0002275 | 3300046642 | Bacteria | 16081 |
| 370 | Ga0495634_0022620 | 3300046642 | Bacteria | 4428 |
| 371 | Ga0495634_0028711 | 3300046642 | Bacteria | 3859 |
| 372 | Ga0495634_0516719 | 3300046642 | Bacteria | 699 |
| 373 | Ga0495611_0023684 | 3300046648 | Bacteria | 2666 |
| 374 | Ga0495625_0015228 | 3300046660 | Bacteria | 6100 |
| 375 | Ga0495625_0146512 | 3300046660 | Bacteria | 1589 |
| 376 | Ga0495635_0002001 | 3300046663 | Bacteria | 13853 |
| 377 | Ga0495635_0005416 | 3300046663 | Bacteria | 8874 |
| 378 | Ga0495635_0198720 | 3300046663 | Bacteria | 1360 |
| 379 | Ga0495659_0425464 | 3300046664 | Bacteria | 575 |
| 380 | Ga0495661_0049053 | 3300046665 | Bacteria | 2562 |
| 381 | Ga0495661_0222679 | 3300046665 | Bacteria | 977 |
| 382 | Ga0495588_0483829 | 3300046674 | Bacteria | 649 |
| 383 | Ga0495657_0005197 | 3300046675 | Bacteria | 10309 |
| 384 | Ga0495599_0086238 | 3300046678 | Bacteria | 1961 |
| 385 | Ga0495623_0036279 | 3300046679 | Bacteria | 3159 |
| 386 | Ga0495646_0001460 | 3300046680 | Bacteria | 14050 |
| 387 | Ga0495647_0115978 | 3300046681 | Bacteria | 1122 |
| 388 | Ga0495658_0141924 | 3300046683 | Bacteria | 1469 |
| 389 | Ga0495658_0488742 | 3300046683 | Bacteria | 787 |
| 390 | Ga0495613_0000475 | 3300046689 | Bacteria | 34309 |
| 391 | Ga0495613_0175061 | 3300046689 | Bacteria | 1521 |
| 392 | Ga0495613_0205860 | 3300046689 | Bacteria | 1385 |
| 393 | Ga0495624_0009902 | 3300046690 | Bacteria | 6588 |
| 394 | Ga0495624_0209120 | 3300046690 | Bacteria | 1184 |
| 395 | Ga0495670_0002884 | 3300046691 | Bacteria | 8471 |
| 396 | Ga0495670_0047588 | 3300046691 | Bacteria | 2144 |
| 397 | Ga0495670_0102431 | 3300046691 | Bacteria | 1475 |
| 398 | Ga0495670_0207423 | 3300046691 | Bacteria | 1039 |
| 399 | Ga0495671_0039411 | 3300046692 | Bacteria | 2385 |
| 400 | Ga0495671_0280754 | 3300046692 | Bacteria | 802 |
| 401 | Ga0495649_0072714 | 3300046694 | Bacteria | 1843 |
| 402 | Ga0495589_0018175 | 3300046794 | Bacteria | 3607 |
| 403 | Ga0495589_0109410 | 3300046794 | Bacteria | 1334 |
| 404 | Ga0495600_0015613 | 3300046809 | Bacteria | 4807 |
| 405 | Ga0495600_0016644 | 3300046809 | Bacteria | 4671 |
| 406 | Ga0495600_0087587 | 3300046809 | Bacteria | 2031 |
| 407 | Ga0495660_0022038 | 3300046810 | Bacteria | 3641 |
| 408 | Ga0495581_0004899 | 3300047315 | Bacteria | 7743 |
| 409 | Ga0495581_0018083 | 3300047315 | Bacteria | 4094 |
| 410 | Ga0495581_0207111 | 3300047315 | Bacteria | 1147 |
| 411 | Ga0495604_0000213 | 3300047317 | Bacteria | 53409 |
| 412 | Ga0495636_0011022 | 3300047318 | Bacteria | 3577 |
| 413 | Ga0495636_0026045 | 3300047318 | Bacteria | 2377 |
| 414 | Ga0495636_0118999 | 3300047318 | Bacteria | 1167 |
| 415 | Ga0495676_0009406 | 3300047321 | Bacteria | 8902 |
| 416 | Ga0495676_0022814 | 3300047321 | Bacteria | 5439 |
| 417 | Ga0495676_0088834 | 3300047321 | Bacteria | 2316 |
| 418 | Ga0495683_0143025 | 3300047323 | Bacteria | 1119 |
| 419 | Ga0495687_000466 | 3300047443 | Bacteria | 48926 |
| 420 | Ga0495687_015559 | 3300047443 | Bacteria | 3862 |
| 421 | Ga0495687_157226 | 3300047443 | Bacteria | 769 |
| 422 | Ga0495687_202024 | 3300047443 | Bacteria | 630 |
| 423 | Ga0495675_0131756 | 3300047444 | Bacteria | 1553 |
| 424 | Ga0495675_0350327 | 3300047444 | Bacteria | 868 |
| 425 | Ga0495677_0072206 | 3300047445 | Bacteria | 1287 |
| 426 | Ga0495677_0093759 | 3300047445 | Bacteria | 1133 |
| 427 | Ga0495679_028981 | 3300047446 | Bacteria | 1810 |
| 428 | Ga0495685_025644 | 3300047447 | Bacteria | 2027 |
| 429 | Ga0495685_028398 | 3300047447 | Bacteria | 1924 |
| 430 | Ga0495681_0009898 | 3300047470 | Bacteria | 5823 |
| 431 | Ga0495681_0033993 | 3300047470 | Bacteria | 2545 |
| 432 | Ga0495686_0047417 | 3300047472 | Bacteria | 2713 |
| 433 | Ga0495686_0161562 | 3300047472 | Bacteria | 1308 |
| 434 | Ga0495593_0004809 | 3300047673 | Bacteria | 8009 |
| 435 | Ga0495593_0194898 | 3300047673 | Bacteria | 1019 |
| 436 | Ga0495602_0023315 | 3300048088 | Bacteria | 6032 |
| 437 | Ga0495602_0120454 | 3300048088 | Bacteria | 2112 |
| 438 | Ga0495614_0005924 | 3300048089 | Bacteria | 5506 |
| 439 | Ga0495614_0005960 | 3300048089 | Bacteria | 5490 |
| 440 | Ga0495614_0046047 | 3300048089 | Bacteria | 1870 |
| 441 | Ga0495626_0014942 | 3300048091 | Bacteria | 3984 |
| 442 | Ga0496100_0002031 | 3300048903 | Bacteria | 10135 |
| 443 | Ga0496100_0058765 | 3300048903 | Bacteria | 2525 |
| 444 | Ga0496100_0170779 | 3300048903 | Bacteria | 1566 |
| 445 | Ga0496101_0104490 | 3300048904 | Bacteria | 2124 |
| 446 | Ga0496102_0004390 | 3300048905 | Bacteria | 11912 |
| 447 | Ga0496102_0129463 | 3300048905 | Bacteria | 2361 |
| 448 | Ga0496102_0185384 | 3300048905 | Bacteria | 1961 |
| 449 | Ga0496102_0571971 | 3300048905 | Bacteria | 1053 |
| 450 | Ga0496102_0914537 | 3300048905 | Bacteria | 799 |
| 451 | Ga0496103_0001760 | 3300048906 | Bacteria | 14119 |
| 452 | Ga0496103_0198784 | 3300048906 | Bacteria | 1289 |
| 453 | Ga0496103_0713400 | 3300048906 | Bacteria | 635 |
| 454 | Ga0496106_0004423 | 3300048909 | Bacteria | 10413 |
| 455 | Ga0496106_0341890 | 3300048909 | Bacteria | 1202 |
| 456 | Ga0496107_0009192 | 3300048910 | Bacteria | 6850 |
| 457 | Ga0496108_0193543 | 3300048911 | Bacteria | 1763 |
| 458 | Ga0496109_0031421 | 3300048912 | Bacteria | 4765 |
| 459 | Ga0496109_0086057 | 3300048912 | Bacteria | 2903 |
| 460 | Ga0496110_0006989 | 3300048913 | Bacteria | 8979 |
| 461 | Ga0496110_1353111 | 3300048913 | Bacteria | 621 |
| 462 | Ga0496111_0005653 | 3300048914 | Bacteria | 8050 |
| 463 | Ga0496112_0282422 | 3300048915 | Bacteria | 1607 |
| 464 | Ga0496113_0067276 | 3300048916 | Bacteria | 2716 |
| 465 | Ga0496113_0508446 | 3300048916 | Bacteria | 967 |
| 466 | Ga0496114_0012638 | 3300048917 | Bacteria | 6763 |
| 467 | Ga0496114_0031681 | 3300048917 | Bacteria | 4349 |
| 468 | Ga0496114_0977211 | 3300048917 | Bacteria | 729 |
| 469 | Ga0496119_0416767 | 3300048922 | Bacteria | 638 |
| 470 | Ga0496124_0411641 | 3300048927 | Bacteria | 935 |
| 471 | Ga0496126_0476839 | 3300048929 | Bacteria | 1000 |
| 472 | Ga0496126_0705294 | 3300048929 | Bacteria | 784 |
| 473 | Ga0495678_020964 | 3300049459 | Bacteria | 2885 |
| 474 | Ga0501031_0008220 | 3300049568 | Bacteria | 6788 |
| 475 | Ga0501032_0002053 | 3300049569 | Bacteria | 15906 |
| 476 | Ga0501032_0027150 | 3300049569 | Bacteria | 3936 |
| 477 | Ga0501034_0000010 | 3300049571 | Bacteria | 312213 |
| 478 | Ga0501034_0019694 | 3300049571 | Bacteria | 6898 |
| 479 | Ga0501034_0462180 | 3300049571 | Bacteria | 1186 |
| 480 | Ga0501036_0006800 | 3300049572 | Bacteria | 9290 |
| 481 | Ga0501036_0036621 | 3300049572 | Bacteria | 4152 |
| 482 | Ga0501037_0010193 | 3300049573 | Bacteria | 6893 |
| 483 | Ga0501037_0050621 | 3300049573 | Bacteria | 3040 |
| 484 | Ga0501037_0410758 | 3300049573 | Bacteria | 927 |
| 485 | Ga0501038_0002293 | 3300049574 | Bacteria | 17788 |
| 486 | Ga0501038_0036709 | 3300049574 | Bacteria | 4300 |
| 487 | Ga0501038_0091085 | 3300049574 | Bacteria | 2555 |
| 488 | Ga0501038_0755995 | 3300049574 | Bacteria | 725 |
| 489 | Ga0501040_0138496 | 3300049576 | Bacteria | 1713 |
| 490 | Ga0501042_0020483 | 3300049578 | Bacteria | 4603 |
| 491 | Ga0501042_0111474 | 3300049578 | Bacteria | 1970 |
| 492 | Ga0501043_0078090 | 3300049579 | Bacteria | 2601 |
| 493 | Ga0501043_0184844 | 3300049579 | Bacteria | 1623 |
| 494 | Ga0501043_0225172 | 3300049579 | Bacteria | 1450 |
| 495 | Ga0501046_0011580 | 3300049580 | Bacteria | 7541 |
| 496 | Ga0501047_0011939 | 3300049581 | Bacteria | 8221 |
| 497 | Ga0501047_0178099 | 3300049581 | Bacteria | 1993 |
| 498 | Ga0501067_0236371 | 3300049583 | Bacteria | 1017 |
| 499 | Ga0501068_0352415 | 3300049584 | Bacteria | 946 |
| 500 | Ga0501069_0116060 | 3300049585 | Bacteria | 1527 |
| 501 | Ga0501069_0263329 | 3300049585 | Bacteria | 1007 |
| 502 | Ga0501070_0384506 | 3300049586 | Bacteria | 1137 |
| 503 | Ga0501070_0944254 | 3300049586 | Bacteria | 671 |
| 504 | Ga0501071_0031881 | 3300049587 | Bacteria | 3739 |
| 505 | Ga0501072_0017795 | 3300049588 | Bacteria | 5465 |
| 506 | Ga0501073_0045723 | 3300049589 | Bacteria | 3083 |
| 507 | Ga0501074_0026846 | 3300049590 | Bacteria | 4174 |
| 508 | Ga0501074_0030892 | 3300049590 | Bacteria | 3881 |
| 509 | Ga0501074_0358682 | 3300049590 | Bacteria | 1034 |
| 510 | Ga0501075_0015168 | 3300049591 | Bacteria | 5527 |
| 511 | Ga0501076_0002407 | 3300049592 | Bacteria | 12816 |
| 512 | Ga0501077_0006102 | 3300049593 | Bacteria | 7358 |
| 513 | Ga0501079_0046602 | 3300049741 | Bacteria | 3345 |
| 514 | Ga0501080_0749092 | 3300049742 | Bacteria | 859 |
| 515 | Ga0501081_0256122 | 3300049743 | Bacteria | 1278 |
| 516 | Ga0501035_0060884 | 3300049822 | Bacteria | 3361 |
| 517 | Ga0501044_0001745 | 3300049823 | Bacteria | 25377 |
| 518 | Ga0501044_0133003 | 3300049823 | Bacteria | 2480 |
| 519 | Ga0501044_0240443 | 3300049823 | Bacteria | 1754 |
| 520 | Ga0501045_0138440 | 3300049824 | Bacteria | 1810 |
| 521 | Ga0501045_0358754 | 3300049824 | Bacteria | 1085 |
| 522 | nmdc:mga03n38_368094_c1 | 3300050490 | Bacteria | 785 |
| 523 | nmdc:mga00v17_569770_c1 | 3300050491 | Bacteria | 731 |
| 524 | nmdc:mga0yw44_13973_c2 | 3300050492 | Bacteria | 3739 |
| 525 | nmdc:mga0yw44_31518_c1 | 3300050492 | Bacteria | 3084 |
| 526 | nmdc:mga0yw44_422688_c1 | 3300050492 | Bacteria | 902 |
| 527 | nmdc:mga06z11_340815_c1 | 3300050494 | Bacteria | 896 |
| 528 | nmdc:mga09592_1192697_c1 | 3300050508 | Bacteria | 629 |
| 529 | Ga0495601_0003378 | 3300053077 | Bacteria | 9141 |
| 530 | Ga0495601_0008679 | 3300053077 | Bacteria | 5996 |
| 531 | Ga0495601_0134829 | 3300053077 | Bacteria | 1609 |
| 532 | Ga0495612_0152715 | 3300053078 | Bacteria | 1005 |
| 533 | Ga0495612_0161106 | 3300053078 | Bacteria | 979 |
| 534 | Ga0500635_0320143 | 3300053080 | Bacteria | 613 |
| 535 | Ga0495619_0106467 | 3300053085 | Bacteria | 1912 |
| 536 | Ga0495619_0357437 | 3300053085 | Bacteria | 1010 |
| 537 | Ga0495619_0671765 | 3300053085 | Bacteria | 705 |
| 538 | Ga0500643_000496 | 3300053087 | Bacteria | 28282 |
| 539 | Ga0500583_0056167 | 3300053092 | Bacteria | 1844 |
| 540 | Ga0500640_004214 | 3300053095 | Bacteria | 5187 |
| 541 | Ga0500650_0216956 | 3300053098 | Bacteria | 867 |
| 542 | Ga0500654_110879 | 3300053099 | Bacteria | 1124 |
| 543 | Ga0500660_049324 | 3300053100 | Bacteria | 2093 |
| 544 | Ga0500660_218065 | 3300053100 | Bacteria | 632 |
| 545 | Ga0500553_049642 | 3300053101 | Bacteria | 2017 |
| 546 | Ga0500560_079176 | 3300053107 | Bacteria | 1090 |
| 547 | Ga0500572_068892 | 3300053111 | Bacteria | 1089 |
| 548 | Ga0500580_098264 | 3300053113 | Bacteria | 1156 |
| 549 | Ga0500594_0101110 | 3300053118 | Bacteria | 887 |
| 550 | Ga0500614_008180 | 3300053123 | Bacteria | 2215 |
| 551 | Ga0500614_047749 | 3300053123 | Bacteria | 1113 |
| 552 | Ga0500628_022473 | 3300053129 | Bacteria | 1290 |
| 553 | Ga0500652_007570 | 3300053131 | Bacteria | 3563 |
| 554 | Ga0500652_172101 | 3300053131 | Bacteria | 891 |
| 555 | Ga0500658_0045652 | 3300053134 | Bacteria | 1771 |
| 556 | Ga0500559_0012293 | 3300053136 | Bacteria | 3642 |
| 557 | Ga0500561_0001430 | 3300053137 | Bacteria | 3872 |
| 558 | Ga0500579_185584 | 3300053143 | Bacteria | 807 |
| 559 | Ga0500600_0006942 | 3300053149 | Bacteria | 6783 |
| 560 | Ga0500616_0239618 | 3300053153 | Bacteria | 780 |
| 561 | Ga0500624_035669 | 3300053157 | Bacteria | 875 |
| 562 | Ga0500633_0023775 | 3300053160 | Bacteria | 1895 |
| 563 | Ga0500634_0145799 | 3300053161 | Bacteria | 1113 |
| 564 | Ga0500636_0126421 | 3300053177 | Bacteria | 1429 |
| 565 | Ga0500656_009012 | 3300053732 | Bacteria | 1067 |
| 566 | Ga0500587_008183 | 3300053739 | Bacteria | 1348 |
| 567 | Ga0501082_0290718 | 3300060353 | Bacteria | 1423 |
| 568 | Ga0466962_0000456 | 3300061719 | Bacteria | 17753 |
| 569 | Ga0466962_0004821 | 3300061719 | Bacteria | 6492 |
| 570 | Ga0530510_0089856 | 3300061734 | Bacteria | 2240 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2808606439 | 2809194394 | 143 |
| 2 | iso_pu_bacteria | 2811994878 | 2812349153 | 143 |
| 3 | 3300041451 | Ga0451791_1894528 | Ga0451791_1894528_286_729 | 144 |
| 4 | 3300031456 | Ga0307513_10412592 | Ga0307513_104125921 | 145 |
| 5 | 3300036459 | Ga0372808_007824 | Ga0372808_007824_997_1437 | 145 |
| 6 | 3300041486 | Ga0451807_1599420 | Ga0451807_1599420_88_528 | 145 |
| 7 | 3300041512 | Ga0451853_2470593 | Ga0451853_2470593_1261_1701 | 145 |
| 8 | 3300041999 | Ga0439433_0169911 | Ga0439433_0169911_15_455 | 145 |
| 9 | 3300042131 | Ga0450894_003861 | Ga0450894_003861_804_1244 | 145 |
| 10 | 3300042134 | Ga0450898_004651 | Ga0450898_004651_900_1340 | 145 |
| 11 | 3300042135 | Ga0450899_000631 | Ga0450899_000631_1707_2147 | 145 |
| 12 | 3300042145 | Ga0450906_002466 | Ga0450906_002466_1634_2074 | 145 |
| 13 | 3300046660 | Ga0495625_0146512 | Ga0495625_0146512_18_455 | 145 |
| 14 | 3300047443 | Ga0495687_202024 | Ga0495687_202024_34_471 | 145 |
| 15 | 3300053099 | Ga0500654_110879 | Ga0500654_110879_669_1109 | 145 |
| 16 | 3300031456 | Ga0307513_10001759 | Ga0307513_1000175912 | 146 |
| 17 | 3300041496 | Ga0451839_1472345 | Ga0451839_1472345_345_785 | 146 |
| 18 | 3300031824 | Ga0307413_10490735 | Ga0307413_104907352 | 147 |
| 19 | 3300031852 | Ga0307410_10418203 | Ga0307410_104182032 | 147 |
| 20 | 3300031995 | Ga0307409_100432462 | Ga0307409_1004324622 | 147 |
| 21 | 3300032004 | Ga0307414_10642025 | Ga0307414_106420252 | 147 |
| 22 | 3300005367 | Ga0070667_100343302 | Ga0070667_1003433022 | 151 |
| 23 | 3300005548 | Ga0070665_100004557 | Ga0070665_1000045572 | 151 |
| 24 | 3300005841 | Ga0068863_100009897 | Ga0068863_1000098977 | 151 |
| 25 | 3300005843 | Ga0068860_100059694 | Ga0068860_1000596941 | 151 |
| 26 | 3300025986 | Ga0207658_10723733 | Ga0207658_107237332 | 151 |
| 27 | 3300026088 | Ga0207641_10011017 | Ga0207641_100110173 | 151 |
| 28 | 3300028379 | Ga0268266_10028984 | Ga0268266_100289843 | 151 |
| 29 | 3300028381 | Ga0268264_10023396 | Ga0268264_100233963 | 151 |
| 30 | 3300035089 | Ga0373944_0207041 | Ga0373944_0207041_14_472 | 152 |
| 31 | 3300035171 | Ga0373946_0639991 | Ga0373946_0639991_15_473 | 152 |
| 32 | 3300035692 | Ga0373935_0094401 | Ga0373935_0094401_1281_1739 | 152 |
| 33 | 3300035695 | Ga0373927_0367561 | Ga0373927_0367561_178_636 | 152 |
| 34 | 3300035725 | Ga0373947_0231310 | Ga0373947_0231310_12_470 | 152 |
| 35 | 3300046455 | Ga0495603_0044785 | Ga0495603_0044785_1958_2416 | 152 |
| 36 | 3300046475 | Ga0495639_0479176 | Ga0495639_0479176_115_573 | 152 |
| 37 | 3300046492 | Ga0495585_0038237 | Ga0495585_0038237_1837_2295 | 152 |
| 38 | 3300046533 | Ga0495640_0085571 | Ga0495640_0085571_1535_1993 | 152 |
| 39 | 3300046557 | Ga0495622_0331474 | Ga0495622_0331474_155_613 | 152 |
| 40 | 3300046615 | Ga0495656_0579823 | Ga0495656_0579823_108_566 | 152 |
| 41 | 3300046642 | Ga0495634_0028711 | Ga0495634_0028711_3269_3727 | 152 |
| 42 | 3300046681 | Ga0495647_0115978 | Ga0495647_0115978_274_732 | 152 |
| 43 | 3300046683 | Ga0495658_0488742 | Ga0495658_0488742_231_689 | 152 |
| 44 | 3300046691 | Ga0495670_0047588 | Ga0495670_0047588_282_740 | 152 |
| 45 | 3300047321 | Ga0495676_0088834 | Ga0495676_0088834_391_858 | 152 |
| 46 | 3300053077 | Ga0495601_0134829 | Ga0495601_0134829_19_486 | 152 |
| 47 | 3300053085 | Ga0495619_0671765 | Ga0495619_0671765_47_505 | 152 |
| 48 | 3300032002 | Ga0307416_100777901 | Ga0307416_1007779012 | 153 |
| 49 | 3300041498 | Ga0451841_0364791 | Ga0451841_0364791_205_672 | 153 |
| 50 | 3300046454 | Ga0495592_0041342 | Ga0495592_0041342_624_1109 | 155 |
| 51 | 3300046462 | Ga0495651_0000674 | Ga0495651_0000674_11461_11946 | 155 |
| 52 | 3300046477 | Ga0495664_0143593 | Ga0495664_0143593_100_585 | 155 |
| 53 | 3300046511 | Ga0495608_0289874 | Ga0495608_0289874_346_831 | 155 |
| 54 | 3300046529 | Ga0495652_0014703 | Ga0495652_0014703_4135_4620 | 155 |
| 55 | 3300046536 | Ga0495587_0498333 | Ga0495587_0498333_169_654 | 155 |
| 56 | 3300046679 | Ga0495623_0036279 | Ga0495623_0036279_1403_1888 | 155 |
| 57 | 3300048088 | Ga0495602_0120454 | Ga0495602_0120454_460_945 | 155 |
| 58 | 3300053085 | Ga0495619_0106467 | Ga0495619_0106467_514_999 | 155 |
| 59 | iso_pu_bacteria | 2537561592 | 2537900626 | 156 |
| 60 | iso_pu_bacteria | 2643221567 | 2643851548 | 156 |
| 61 | iso_pu_bacteria | 2643221624 | 2644137862 | 156 |
| 62 | iso_pu_bacteria | 2751185782 | 2753263029 | 156 |
| 63 | iso_pu_bacteria | 2791355406 | 2793981647 | 156 |
| 64 | iso_pu_bacteria | 2808606365 | 2808872646 | 156 |
| 65 | iso_pu_bacteria | 2844849076 | 2844850332 | 156 |
| 66 | iso_pu_bacteria | 2857740372 | 2857744080 | 156 |
| 67 | iso_pu_bacteria | 2904497146 | 2904498890 | 156 |
| 68 | iso_pu_bacteria | 2904776348 | 2904780163 | 156 |
| 69 | iso_pu_bacteria | 2910809715 | 2910809911 | 156 |
| 70 | iso_pu_bacteria | 2919034639 | 2919036783 | 156 |
| 71 | iso_pu_bacteria | 2919059106 | 2919061148 | 156 |
| 72 | iso_pu_bacteria | 2919446982 | 2919448957 | 156 |
| 73 | iso_pu_bacteria | 2919538618 | 2919541553 | 156 |
| 74 | iso_pu_bacteria | 2932426870 | 2932429657 | 156 |
| 75 | iso_pu_bacteria | 2933418574 | 2933420374 | 156 |
| 76 | iso_pu_bacteria | 2939647034 | 2939649801 | 156 |
| 77 | iso_pu_bacteria | 2939674588 | 2939677832 | 156 |
| 78 | iso_pu_bacteria | 2945941187 | 2945943488 | 156 |
| 79 | iso_pu_bacteria | 2953998280 | 2954000578 | 156 |
| 80 | iso_pu_bacteria | 2984576629 | 2984579389 | 156 |
| 81 | iso_pu_bacteria | 2990256926 | 2990256999 | 156 |
| 82 | iso_pu_bacteria | 8047893842 | 8047900905 | 156 |
| 83 | iso_pu_bacteria | 8048127548 | 8048134340 | 156 |
| 84 | iso_pu_bacteria | 8048356638 | 8048357997 | 156 |
| 85 | iso_pu_bacteria | 8048369669 | 8048377847 | 156 |
| 86 | iso_pu_bacteria | 8048379754 | 8048386945 | 156 |
| 87 | 3300005329 | Ga0070683_100174604 | Ga0070683_1001746042 | 158 |
| 88 | 3300005530 | Ga0070679_100302946 | Ga0070679_1003029462 | 158 |
| 89 | 3300005577 | Ga0068857_100296446 | Ga0068857_1002964462 | 158 |
| 90 | 3300020081 | Ga0206354_10930448 | Ga0206354_109304483 | 158 |
| 91 | 3300020082 | Ga0206353_10810260 | Ga0206353_108102604 | 158 |
| 92 | 3300020082 | Ga0206353_11389892 | Ga0206353_113898925 | 158 |
| 93 | 3300022467 | Ga0224712_10543283 | Ga0224712_105432831 | 158 |
| 94 | 3300022467 | Ga0224712_10581953 | Ga0224712_105819531 | 158 |
| 95 | 3300025944 | Ga0207661_10107146 | Ga0207661_101071463 | 158 |
| 96 | 3300026116 | Ga0207674_10137627 | Ga0207674_101376273 | 158 |
| 97 | 3300026116 | Ga0207674_10515595 | Ga0207674_105155952 | 158 |
| 98 | 3300046535 | Ga0495586_0475278 | Ga0495586_0475278_172_648 | 158 |
| 99 | 3300048903 | Ga0496100_0058765 | Ga0496100_0058765_260_736 | 158 |
| 100 | 3300048903 | Ga0496100_0170779 | Ga0496100_0170779_75_551 | 158 |
| 101 | 3300048904 | Ga0496101_0104490 | Ga0496101_0104490_1139_1615 | 158 |
| 102 | 3300048905 | Ga0496102_0004390 | Ga0496102_0004390_4931_5407 | 158 |
| 103 | 3300048905 | Ga0496102_0129463 | Ga0496102_0129463_1220_1696 | 158 |
| 104 | 3300048906 | Ga0496103_0198784 | Ga0496103_0198784_675_1151 | 158 |
| 105 | 3300048906 | Ga0496103_0713400 | Ga0496103_0713400_25_501 | 158 |
| 106 | 3300048917 | Ga0496114_0012638 | Ga0496114_0012638_996_1472 | 158 |
| 107 | 3300048917 | Ga0496114_0031681 | Ga0496114_0031681_2883_3359 | 158 |
| 108 | 3300053085 | Ga0495619_0357437 | Ga0495619_0357437_64_540 | 158 |
| 109 | iso_pu_bacteria | 2844849076 | 2844850328 | 158 |
| 110 | iso_pu_bacteria | 2904770941 | 2904772465 | 158 |
| 111 | iso_pu_bacteria | 2908811453 | 2908816371 | 158 |
| 112 | 3300031548 | Ga0307408_100550253 | Ga0307408_1005502532 | 159 |
| 113 | 3300031903 | Ga0307407_10347239 | Ga0307407_103472392 | 159 |
| 114 | 3300037068 | Ga0373925_0000020 | Ga0373925_0000020_23583_24065 | 159 |
| 115 | 3300046530 | Ga0495654_0203538 | Ga0495654_0203538_41_520 | 159 |
| 116 | 3300046558 | Ga0495633_0030830 | Ga0495633_0030830_657_1136 | 159 |
| 117 | 3300046615 | Ga0495656_0006202 | Ga0495656_0006202_881_1360 | 159 |
| 118 | 3300046664 | Ga0495659_0425464 | Ga0495659_0425464_22_501 | 159 |
| 119 | 3300046665 | Ga0495661_0222679 | Ga0495661_0222679_298_777 | 159 |
| 120 | 3300046691 | Ga0495670_0002884 | Ga0495670_0002884_3760_4239 | 159 |
| 121 | 3300046809 | Ga0495600_0087587 | Ga0495600_0087587_939_1418 | 159 |
| 122 | 3300047315 | Ga0495581_0018083 | Ga0495581_0018083_1397_1876 | 159 |
| 123 | 3300047318 | Ga0495636_0011022 | Ga0495636_0011022_811_1290 | 159 |
| 124 | 3300047444 | Ga0495675_0131756 | Ga0495675_0131756_34_513 | 159 |
| 125 | 3300047445 | Ga0495677_0072206 | Ga0495677_0072206_700_1179 | 159 |
| 126 | 3300048922 | Ga0496119_0416767 | Ga0496119_0416767_52_531 | 159 |
| 127 | 3300049573 | Ga0501037_0410758 | Ga0501037_0410758_41_529 | 159 |
| 128 | 3300049574 | Ga0501038_0036709 | Ga0501038_0036709_3713_4201 | 159 |
| 129 | 3300049579 | Ga0501043_0184844 | Ga0501043_0184844_528_1016 | 159 |
| 130 | 3300049580 | Ga0501046_0011580 | Ga0501046_0011580_3450_3938 | 159 |
| 131 | 3300049581 | Ga0501047_0178099 | Ga0501047_0178099_367_855 | 159 |
| 132 | 3300049586 | Ga0501070_0944254 | Ga0501070_0944254_134_622 | 159 |
| 133 | 3300049590 | Ga0501074_0358682 | Ga0501074_0358682_462_950 | 159 |
| 134 | 3300049823 | Ga0501044_0240443 | Ga0501044_0240443_417_905 | 159 |
| 135 | 3300049824 | Ga0501045_0358754 | Ga0501045_0358754_529_1017 | 159 |
| 136 | 3300002774 | JGI25150J39212_1029224 | JGI25150J39212_10292241 | 160 |
| 137 | 3300005329 | Ga0070683_100242135 | Ga0070683_1002421352 | 160 |
| 138 | 3300005329 | Ga0070683_100580054 | Ga0070683_1005800542 | 160 |
| 139 | 3300005334 | Ga0068869_100308701 | Ga0068869_1003087013 | 160 |
| 140 | 3300005337 | Ga0070682_100461973 | Ga0070682_1004619732 | 160 |
| 141 | 3300005339 | Ga0070660_100037991 | Ga0070660_1000379914 | 160 |
| 142 | 3300005341 | Ga0070691_10130119 | Ga0070691_101301192 | 160 |
| 143 | 3300005345 | Ga0070692_10141289 | Ga0070692_101412892 | 160 |
| 144 | 3300005347 | Ga0070668_100323191 | Ga0070668_1003231912 | 160 |
| 145 | 3300005366 | Ga0070659_100596673 | Ga0070659_1005966731 | 160 |
| 146 | 3300005366 | Ga0070659_100735480 | Ga0070659_1007354801 | 160 |
| 147 | 3300005367 | Ga0070667_100855337 | Ga0070667_1008553371 | 160 |
| 148 | 3300005435 | Ga0070714_100076873 | Ga0070714_1000768733 | 160 |
| 149 | 3300005435 | Ga0070714_101000304 | Ga0070714_1010003041 | 160 |
| 150 | 3300005435 | Ga0070714_101150871 | Ga0070714_1011508711 | 160 |
| 151 | 3300005436 | Ga0070713_100074966 | Ga0070713_1000749663 | 160 |
| 152 | 3300005436 | Ga0070713_100159142 | Ga0070713_1001591423 | 160 |
| 153 | 3300005436 | Ga0070713_100161154 | Ga0070713_1001611543 | 160 |
| 154 | 3300005439 | Ga0070711_100023630 | Ga0070711_1000236303 | 160 |
| 155 | 3300005440 | Ga0070705_100266913 | Ga0070705_1002669132 | 160 |
| 156 | 3300005455 | Ga0070663_100426276 | Ga0070663_1004262762 | 160 |
| 157 | 3300005456 | Ga0070678_100194885 | Ga0070678_1001948852 | 160 |
| 158 | 3300005458 | Ga0070681_10274417 | Ga0070681_102744172 | 160 |
| 159 | 3300005466 | Ga0070685_11008424 | Ga0070685_110084241 | 160 |
| 160 | 3300005530 | Ga0070679_100087791 | Ga0070679_1000877912 | 160 |
| 161 | 3300005535 | Ga0070684_100057683 | Ga0070684_1000576832 | 160 |
| 162 | 3300005539 | Ga0068853_101106018 | Ga0068853_1011060182 | 160 |
| 163 | 3300005543 | Ga0070672_100146234 | Ga0070672_1001462342 | 160 |
| 164 | 3300005548 | Ga0070665_100185865 | Ga0070665_1001858655 | 160 |
| 165 | 3300005577 | Ga0068857_101022637 | Ga0068857_1010226372 | 160 |
| 166 | 3300005614 | Ga0068856_100652551 | Ga0068856_1006525512 | 160 |
| 167 | 3300005614 | Ga0068856_100784321 | Ga0068856_1007843212 | 160 |
| 168 | 3300005616 | Ga0068852_100199521 | Ga0068852_1001995213 | 160 |
| 169 | 3300005618 | Ga0068864_100813784 | Ga0068864_1008137842 | 160 |
| 170 | 3300005841 | Ga0068863_100957606 | Ga0068863_1009576062 | 160 |
| 171 | 3300005842 | Ga0068858_100034983 | Ga0068858_1000349832 | 160 |
| 172 | 3300005842 | Ga0068858_100934096 | Ga0068858_1009340962 | 160 |
| 173 | 3300005843 | Ga0068860_100014727 | Ga0068860_1000147276 | 160 |
| 174 | 3300005844 | Ga0068862_100041865 | Ga0068862_1000418653 | 160 |
| 175 | 3300006038 | Ga0075365_10031285 | Ga0075365_100312853 | 160 |
| 176 | 3300006038 | Ga0075365_10109934 | Ga0075365_101099342 | 160 |
| 177 | 3300006048 | Ga0075363_100626938 | Ga0075363_1006269381 | 160 |
| 178 | 3300006051 | Ga0075364_10467837 | Ga0075364_104678372 | 160 |
| 179 | 3300006175 | Ga0070712_101366458 | Ga0070712_1013664581 | 160 |
| 180 | 3300006177 | Ga0075362_10239170 | Ga0075362_102391702 | 160 |
| 181 | 3300006178 | Ga0075367_10667759 | Ga0075367_106677592 | 160 |
| 182 | 3300006353 | Ga0075370_10251202 | Ga0075370_102512022 | 160 |
| 183 | 3300009036 | Ga0105244_10010864 | Ga0105244_100108642 | 160 |
| 184 | 3300009036 | Ga0105244_10081604 | Ga0105244_100816042 | 160 |
| 185 | 3300009101 | Ga0105247_10631990 | Ga0105247_106319902 | 160 |
| 186 | 3300009148 | Ga0105243_10051988 | Ga0105243_100519883 | 160 |
| 187 | 3300009148 | Ga0105243_10587321 | Ga0105243_105873212 | 160 |
| 188 | 3300011119 | Ga0105246_10007977 | Ga0105246_100079774 | 160 |
| 189 | 3300013104 | Ga0157370_10038015 | Ga0157370_100380154 | 160 |
| 190 | 3300013105 | Ga0157369_10095681 | Ga0157369_100956813 | 160 |
| 191 | 3300013105 | Ga0157369_10974848 | Ga0157369_109748482 | 160 |
| 192 | 3300013297 | Ga0157378_10372226 | Ga0157378_103722262 | 160 |
| 193 | 3300013306 | Ga0163162_10001793 | Ga0163162_1000179313 | 160 |
| 194 | 3300013307 | Ga0157372_10837259 | Ga0157372_108372592 | 160 |
| 195 | 3300013308 | Ga0157375_10003423 | Ga0157375_100034236 | 160 |
| 196 | 3300013308 | Ga0157375_10096747 | Ga0157375_100967473 | 160 |
| 197 | 3300013308 | Ga0157375_10343357 | Ga0157375_103433572 | 160 |
| 198 | 3300014325 | Ga0163163_10721910 | Ga0163163_107219102 | 160 |
| 199 | 3300014497 | Ga0182008_10246706 | Ga0182008_102467062 | 160 |
| 200 | 3300014968 | Ga0157379_10287071 | Ga0157379_102870713 | 160 |
| 201 | 3300014969 | Ga0157376_11502449 | Ga0157376_115024491 | 160 |
| 202 | 3300020070 | Ga0206356_11465510 | Ga0206356_114655102 | 160 |
| 203 | 3300020075 | Ga0206349_1507694 | Ga0206349_15076941 | 160 |
| 204 | 3300020077 | Ga0206351_10576349 | Ga0206351_105763492 | 160 |
| 205 | 3300020077 | Ga0206351_10691340 | Ga0206351_106913402 | 160 |
| 206 | 3300020080 | Ga0206350_10127885 | Ga0206350_101278852 | 160 |
| 207 | 3300020080 | Ga0206350_10383883 | Ga0206350_103838833 | 160 |
| 208 | 3300020082 | Ga0206353_11094702 | Ga0206353_110947022 | 160 |
| 209 | 3300021388 | Ga0213875_10157203 | Ga0213875_101572032 | 160 |
| 210 | 3300022467 | Ga0224712_10047789 | Ga0224712_100477891 | 160 |
| 211 | 3300022467 | Ga0224712_10176069 | Ga0224712_101760692 | 160 |
| 212 | 3300022467 | Ga0224712_10421740 | Ga0224712_104217402 | 160 |
| 213 | 3300025245 | Ga0207425_1016965 | Ga0207425_10169652 | 160 |
| 214 | 3300025258 | Ga0209129_1000064 | Ga0209129_1000064191 | 160 |
| 215 | 3300025294 | Ga0209025_1001863 | Ga0209025_100186312 | 160 |
| 216 | 3300025303 | Ga0209051_1008018 | Ga0209051_10080184 | 160 |
| 217 | 3300025315 | Ga0207697_10007253 | Ga0207697_100072533 | 160 |
| 218 | 3300025728 | Ga0207655_1006782 | Ga0207655_100678210 | 160 |
| 219 | 3300025728 | Ga0207655_1027211 | Ga0207655_10272112 | 160 |
| 220 | 3300025893 | Ga0207682_10196894 | Ga0207682_101968942 | 160 |
| 221 | 3300025909 | Ga0207705_10189253 | Ga0207705_101892533 | 160 |
| 222 | 3300025912 | Ga0207707_10003354 | Ga0207707_1000335414 | 160 |
| 223 | 3300025915 | Ga0207693_10416856 | Ga0207693_104168562 | 160 |
| 224 | 3300025916 | Ga0207663_10223726 | Ga0207663_102237262 | 160 |
| 225 | 3300025917 | Ga0207660_10146096 | Ga0207660_101460963 | 160 |
| 226 | 3300025918 | Ga0207662_11005040 | Ga0207662_110050401 | 160 |
| 227 | 3300025919 | Ga0207657_10014957 | Ga0207657_100149575 | 160 |
| 228 | 3300025924 | Ga0207694_10701115 | Ga0207694_107011152 | 160 |
| 229 | 3300025925 | Ga0207650_10250447 | Ga0207650_102504472 | 160 |
| 230 | 3300025925 | Ga0207650_11055201 | Ga0207650_110552011 | 160 |
| 231 | 3300025928 | Ga0207700_10301398 | Ga0207700_103013982 | 160 |
| 232 | 3300025928 | Ga0207700_10440054 | Ga0207700_104400542 | 160 |
| 233 | 3300025928 | Ga0207700_10918844 | Ga0207700_109188442 | 160 |
| 234 | 3300025929 | Ga0207664_10009672 | Ga0207664_100096723 | 160 |
| 235 | 3300025929 | Ga0207664_10513526 | Ga0207664_105135262 | 160 |
| 236 | 3300025931 | Ga0207644_10442454 | Ga0207644_104424542 | 160 |
| 237 | 3300025935 | Ga0207709_10017656 | Ga0207709_100176563 | 160 |
| 238 | 3300025935 | Ga0207709_10282833 | Ga0207709_102828331 | 160 |
| 239 | 3300025935 | Ga0207709_10421256 | Ga0207709_104212562 | 160 |
| 240 | 3300025939 | Ga0207665_10390811 | Ga0207665_103908112 | 160 |
| 241 | 3300025940 | Ga0207691_10738593 | Ga0207691_107385932 | 160 |
| 242 | 3300025942 | Ga0207689_10223220 | Ga0207689_102232202 | 160 |
| 243 | 3300025942 | Ga0207689_10275526 | Ga0207689_102755262 | 160 |
| 244 | 3300025944 | Ga0207661_10059663 | Ga0207661_100596633 | 160 |
| 245 | 3300025944 | Ga0207661_10117885 | Ga0207661_101178852 | 160 |
| 246 | 3300025972 | Ga0207668_10296193 | Ga0207668_102961932 | 160 |
| 247 | 3300026023 | Ga0207677_11021489 | Ga0207677_110214892 | 160 |
| 248 | 3300026035 | Ga0207703_10149443 | Ga0207703_101494432 | 160 |
| 249 | 3300026035 | Ga0207703_10222658 | Ga0207703_102226582 | 160 |
| 250 | 3300026067 | Ga0207678_10028639 | Ga0207678_100286394 | 160 |
| 251 | 3300026075 | Ga0207708_10258750 | Ga0207708_102587502 | 160 |
| 252 | 3300026088 | Ga0207641_10882114 | Ga0207641_108821141 | 160 |
| 253 | 3300026095 | Ga0207676_10440793 | Ga0207676_104407932 | 160 |
| 254 | 3300026116 | Ga0207674_10121337 | Ga0207674_101213371 | 160 |
| 255 | 3300026118 | Ga0207675_100669535 | Ga0207675_1006695352 | 160 |
| 256 | 3300026121 | Ga0207683_10282289 | Ga0207683_102822892 | 160 |
| 257 | 3300026121 | Ga0207683_10728980 | Ga0207683_107289801 | 160 |
| 258 | 3300026142 | Ga0207698_10963328 | Ga0207698_109633282 | 160 |
| 259 | 3300028379 | Ga0268266_11332569 | Ga0268266_113325691 | 160 |
| 260 | 3300028381 | Ga0268264_10008739 | Ga0268264_100087395 | 160 |
| 261 | 3300028786 | Ga0307517_10001880 | Ga0307517_100018804 | 160 |
| 262 | 3300028786 | Ga0307517_10044397 | Ga0307517_100443974 | 160 |
| 263 | 3300028794 | Ga0307515_10000025 | Ga0307515_1000002529 | 160 |
| 264 | 3300028794 | Ga0307515_10051743 | Ga0307515_100517432 | 160 |
| 265 | 3300028794 | Ga0307515_10440936 | Ga0307515_104409361 | 160 |
| 266 | 3300030521 | Ga0307511_10018885 | Ga0307511_100188854 | 160 |
| 267 | 3300030521 | Ga0307511_10056542 | Ga0307511_100565422 | 160 |
| 268 | 3300030522 | Ga0307512_10001507 | Ga0307512_100015077 | 160 |
| 269 | 3300030522 | Ga0307512_10043743 | Ga0307512_100437433 | 160 |
| 270 | 3300030733 | Ga0314311_1250029 | Ga0314311_12500292 | 160 |
| 271 | 3300031456 | Ga0307513_10031957 | Ga0307513_100319575 | 160 |
| 272 | 3300031456 | Ga0307513_10377710 | Ga0307513_103777102 | 160 |
| 273 | 3300031507 | Ga0307509_10008111 | Ga0307509_1000811112 | 160 |
| 274 | 3300031507 | Ga0307509_10028028 | Ga0307509_100280284 | 160 |
| 275 | 3300031507 | Ga0307509_10094899 | Ga0307509_100948993 | 160 |
| 276 | 3300031507 | Ga0307509_10134928 | Ga0307509_101349283 | 160 |
| 277 | 3300031507 | Ga0307509_10475373 | Ga0307509_104753732 | 160 |
| 278 | 3300031548 | Ga0307408_100049738 | Ga0307408_1000497384 | 160 |
| 279 | 3300031548 | Ga0307408_100149859 | Ga0307408_1001498592 | 160 |
| 280 | 3300031616 | Ga0307508_10001011 | Ga0307508_1000101119 | 160 |
| 281 | 3300031616 | Ga0307508_10015571 | Ga0307508_100155712 | 160 |
| 282 | 3300031616 | Ga0307508_10023926 | Ga0307508_100239264 | 160 |
| 283 | 3300031616 | Ga0307508_10219990 | Ga0307508_102199902 | 160 |
| 284 | 3300031616 | Ga0307508_10281724 | Ga0307508_102817242 | 160 |
| 285 | 3300031616 | Ga0307508_10294367 | Ga0307508_102943672 | 160 |
| 286 | 3300031649 | Ga0307514_10033517 | Ga0307514_100335174 | 160 |
| 287 | 3300031649 | Ga0307514_10168116 | Ga0307514_101681162 | 160 |
| 288 | 3300031730 | Ga0307516_10127664 | Ga0307516_101276642 | 160 |
| 289 | 3300031730 | Ga0307516_10555602 | Ga0307516_105556022 | 160 |
| 290 | 3300031731 | Ga0307405_10117468 | Ga0307405_101174683 | 160 |
| 291 | 3300031731 | Ga0307405_10120417 | Ga0307405_101204172 | 160 |
| 292 | 3300031731 | Ga0307405_10474426 | Ga0307405_104744262 | 160 |
| 293 | 3300031824 | Ga0307413_10007847 | Ga0307413_100078474 | 160 |
| 294 | 3300031824 | Ga0307413_10011632 | Ga0307413_100116325 | 160 |
| 295 | 3300031824 | Ga0307413_10104925 | Ga0307413_101049253 | 160 |
| 296 | 3300031824 | Ga0307413_10517325 | Ga0307413_105173252 | 160 |
| 297 | 3300031838 | Ga0307518_10131071 | Ga0307518_101310713 | 160 |
| 298 | 3300031838 | Ga0307518_10501790 | Ga0307518_105017901 | 160 |
| 299 | 3300031852 | Ga0307410_10062549 | Ga0307410_100625493 | 160 |
| 300 | 3300031852 | Ga0307410_10153056 | Ga0307410_101530562 | 160 |
| 301 | 3300031852 | Ga0307410_10236863 | Ga0307410_102368632 | 160 |
| 302 | 3300031852 | Ga0307410_11379190 | Ga0307410_113791901 | 160 |
| 303 | 3300031901 | Ga0307406_10096832 | Ga0307406_100968322 | 160 |
| 304 | 3300031901 | Ga0307406_10107911 | Ga0307406_101079112 | 160 |
| 305 | 3300031901 | Ga0307406_10175115 | Ga0307406_101751152 | 160 |
| 306 | 3300031903 | Ga0307407_10029246 | Ga0307407_100292463 | 160 |
| 307 | 3300031903 | Ga0307407_10088405 | Ga0307407_100884053 | 160 |
| 308 | 3300031903 | Ga0307407_10188967 | Ga0307407_101889672 | 160 |
| 309 | 3300031911 | Ga0307412_10036474 | Ga0307412_100364744 | 160 |
| 310 | 3300031911 | Ga0307412_10052656 | Ga0307412_100526563 | 160 |
| 311 | 3300031911 | Ga0307412_10247102 | Ga0307412_102471022 | 160 |
| 312 | 3300031911 | Ga0307412_11766147 | Ga0307412_117661471 | 160 |
| 313 | 3300031995 | Ga0307409_100405748 | Ga0307409_1004057482 | 160 |
| 314 | 3300031995 | Ga0307409_100505859 | Ga0307409_1005058592 | 160 |
| 315 | 3300031995 | Ga0307409_100696679 | Ga0307409_1006966792 | 160 |
| 316 | 3300031995 | Ga0307409_100899749 | Ga0307409_1008997492 | 160 |
| 317 | 3300032002 | Ga0307416_100000832 | Ga0307416_1000008322 | 160 |
| 318 | 3300032002 | Ga0307416_100006456 | Ga0307416_1000064564 | 160 |
| 319 | 3300032002 | Ga0307416_100114994 | Ga0307416_1001149942 | 160 |
| 320 | 3300032002 | Ga0307416_100569760 | Ga0307416_1005697602 | 160 |
| 321 | 3300032002 | Ga0307416_102819869 | Ga0307416_1028198691 | 160 |
| 322 | 3300032004 | Ga0307414_10715165 | Ga0307414_107151652 | 160 |
| 323 | 3300032005 | Ga0307411_10481816 | Ga0307411_104818162 | 160 |
| 324 | 3300032005 | Ga0307411_11641733 | Ga0307411_116417331 | 160 |
| 325 | 3300032126 | Ga0307415_100060643 | Ga0307415_1000606432 | 160 |
| 326 | 3300033179 | Ga0307507_10000084 | Ga0307507_10000084120 | 160 |
| 327 | 3300033179 | Ga0307507_10010281 | Ga0307507_1001028110 | 160 |
| 328 | 3300033179 | Ga0307507_10079522 | Ga0307507_100795222 | 160 |
| 329 | 3300033180 | Ga0307510_10003046 | Ga0307510_1000304611 | 160 |
| 330 | 3300033180 | Ga0307510_10131082 | Ga0307510_101310823 | 160 |
| 331 | 3300035692 | Ga0373935_0002713 | Ga0373935_0002713_2989_3471 | 160 |
| 332 | 3300036401 | Ga0373937_0328745 | Ga0373937_0328745_752_1273 | 160 |
| 333 | 3300036459 | Ga0372808_033818 | Ga0372808_033818_206_691 | 160 |
| 334 | 3300037068 | Ga0373925_1181425 | Ga0373925_1181425_89_571 | 160 |
| 335 | 3300037466 | Ga0395898_0039482 | Ga0395898_0039482_2941_3426 | 160 |
| 336 | 3300037466 | Ga0395898_0099398 | Ga0395898_0099398_570_1055 | 160 |
| 337 | 3300037466 | Ga0395898_0449634 | Ga0395898_0449634_459_944 | 160 |
| 338 | 3300037466 | Ga0395898_0529183 | Ga0395898_0529183_573_1055 | 160 |
| 339 | 3300037471 | Ga0395905_0049729 | Ga0395905_0049729_1000_1485 | 160 |
| 340 | 3300037853 | Ga0436364_1132424 | Ga0436364_1132424_201_686 | 160 |
| 341 | 3300038443 | Ga0395901_0036661 | Ga0395901_0036661_1815_2300 | 160 |
| 342 | 3300038443 | Ga0395901_0089453 | Ga0395901_0089453_2004_2489 | 160 |
| 343 | 3300038443 | Ga0395901_0098258 | Ga0395901_0098258_721_1206 | 160 |
| 344 | 3300038443 | Ga0395901_0467140 | Ga0395901_0467140_60_542 | 160 |
| 345 | 3300041460 | Ga0451802_0443385 | Ga0451802_0443385_133_615 | 160 |
| 346 | 3300041492 | Ga0451835_0666825 | Ga0451835_0666825_994_1476 | 160 |
| 347 | 3300041494 | Ga0451837_1735119 | Ga0451837_1735119_678_1160 | 160 |
| 348 | 3300041501 | Ga0451845_0797742 | Ga0451845_0797742_252_734 | 160 |
| 349 | 3300041503 | Ga0451847_0520032 | Ga0451847_0520032_114_596 | 160 |
| 350 | 3300041512 | Ga0451853_3963956 | Ga0451853_3963956_1079_1561 | 160 |
| 351 | 3300044656 | Ga0466969_0000705 | Ga0466969_0000705_3585_4067 | 160 |
| 352 | 3300044658 | Ga0466972_0052361 | Ga0466972_0052361_1093_1575 | 160 |
| 353 | 3300044658 | Ga0466972_0144323 | Ga0466972_0144323_153_638 | 160 |
| 354 | 3300044683 | Ga0466965_0003253 | Ga0466965_0003253_2449_2931 | 160 |
| 355 | 3300044683 | Ga0466965_0385078 | Ga0466965_0385078_266_751 | 160 |
| 356 | 3300044684 | Ga0466966_0041873 | Ga0466966_0041873_175_657 | 160 |
| 357 | 3300044684 | Ga0466966_0053708 | Ga0466966_0053708_96_581 | 160 |
| 358 | 3300044693 | Ga0466961_0003833 | Ga0466961_0003833_94_576 | 160 |
| 359 | 3300044693 | Ga0466961_0045642 | Ga0466961_0045642_27_512 | 160 |
| 360 | 3300044694 | Ga0466963_0008224 | Ga0466963_0008224_4928_5413 | 160 |
| 361 | 3300044706 | Ga0466964_0286976 | Ga0466964_0286976_85_570 | 160 |
| 362 | 3300044719 | Ga0466971_0002406 | Ga0466971_0002406_330_812 | 160 |
| 363 | 3300044719 | Ga0466971_0012310 | Ga0466971_0012310_2884_3369 | 160 |
| 364 | 3300044735 | Ga0466968_0075918 | Ga0466968_0075918_589_1071 | 160 |
| 365 | 3300044765 | Ga0466970_0254431 | Ga0466970_0254431_128_613 | 160 |
| 366 | 3300044901 | Ga0466960_0067546 | Ga0466960_0067546_450_935 | 160 |
| 367 | 3300044901 | Ga0466960_0123442 | Ga0466960_0123442_154_639 | 160 |
| 368 | 3300045049 | Ga0466959_0004161 | Ga0466959_0004161_8990_9472 | 160 |
| 369 | 3300045049 | Ga0466959_0097056 | Ga0466959_0097056_899_1384 | 160 |
| 370 | 3300045049 | Ga0466959_0620223 | Ga0466959_0620223_24_506 | 160 |
| 371 | 3300045836 | Ga0466958_0236527 | Ga0466958_0236527_99_584 | 160 |
| 372 | 3300045976 | Ga0466967_0046461 | Ga0466967_0046461_1353_1838 | 160 |
| 373 | 3300046452 | Ga0495617_005542 | Ga0495617_005542_1166_1648 | 160 |
| 374 | 3300046454 | Ga0495592_0021090 | Ga0495592_0021090_2986_3471 | 160 |
| 375 | 3300046455 | Ga0495603_0004604 | Ga0495603_0004604_6021_6503 | 160 |
| 376 | 3300046459 | Ga0495629_0003536 | Ga0495629_0003536_6624_7109 | 160 |
| 377 | 3300046459 | Ga0495629_0014302 | Ga0495629_0014302_4784_5266 | 160 |
| 378 | 3300046459 | Ga0495629_0053055 | Ga0495629_0053055_2041_2526 | 160 |
| 379 | 3300046459 | Ga0495629_0195378 | Ga0495629_0195378_649_1134 | 160 |
| 380 | 3300046460 | Ga0495638_0131209 | Ga0495638_0131209_930_1415 | 160 |
| 381 | 3300046460 | Ga0495638_0266274 | Ga0495638_0266274_194_676 | 160 |
| 382 | 3300046462 | Ga0495651_0009009 | Ga0495651_0009009_1848_2333 | 160 |
| 383 | 3300046463 | Ga0495653_0065156 | Ga0495653_0065156_1345_1830 | 160 |
| 384 | 3300046472 | Ga0495580_0969978 | Ga0495580_0969978_17_499 | 160 |
| 385 | 3300046473 | Ga0495582_0035749 | Ga0495582_0035749_889_1374 | 160 |
| 386 | 3300046474 | Ga0495605_0013236 | Ga0495605_0013236_1211_1693 | 160 |
| 387 | 3300046476 | Ga0495662_0004188 | Ga0495662_0004188_1956_2441 | 160 |
| 388 | 3300046477 | Ga0495664_0003414 | Ga0495664_0003414_6578_7063 | 160 |
| 389 | 3300046491 | Ga0495584_0307007 | Ga0495584_0307007_295_777 | 160 |
| 390 | 3300046499 | Ga0495594_0064243 | Ga0495594_0064243_161_643 | 160 |
| 391 | 3300046499 | Ga0495594_0113872 | Ga0495594_0113872_285_770 | 160 |
| 392 | 3300046499 | Ga0495594_0282581 | Ga0495594_0282581_12_497 | 160 |
| 393 | 3300046500 | Ga0495596_0008135 | Ga0495596_0008135_941_1423 | 160 |
| 394 | 3300046501 | Ga0495607_0029983 | Ga0495607_0029983_188_670 | 160 |
| 395 | 3300046506 | Ga0495583_0148526 | Ga0495583_0148526_269_751 | 160 |
| 396 | 3300046507 | Ga0495606_0019954 | Ga0495606_0019954_317_799 | 160 |
| 397 | 3300046512 | Ga0495610_0015879 | Ga0495610_0015879_2145_2627 | 160 |
| 398 | 3300046513 | Ga0495616_0030674 | Ga0495616_0030674_864_1346 | 160 |
| 399 | 3300046514 | Ga0495618_0039130 | Ga0495618_0039130_1113_1598 | 160 |
| 400 | 3300046515 | Ga0495620_0047630 | Ga0495620_0047630_703_1185 | 160 |
| 401 | 3300046516 | Ga0495628_0027386 | Ga0495628_0027386_929_1414 | 160 |
| 402 | 3300046516 | Ga0495628_0045346 | Ga0495628_0045346_2903_3388 | 160 |
| 403 | 3300046516 | Ga0495628_0066066 | Ga0495628_0066066_2165_2647 | 160 |
| 404 | 3300046517 | Ga0495630_0269327 | Ga0495630_0269327_445_930 | 160 |
| 405 | 3300046518 | Ga0495631_0004942 | Ga0495631_0004942_4282_4764 | 160 |
| 406 | 3300046519 | Ga0495632_0052963 | Ga0495632_0052963_945_1430 | 160 |
| 407 | 3300046519 | Ga0495632_0239544 | Ga0495632_0239544_47_529 | 160 |
| 408 | 3300046520 | Ga0495637_0040125 | Ga0495637_0040125_99_581 | 160 |
| 409 | 3300046520 | Ga0495637_0076345 | Ga0495637_0076345_275_760 | 160 |
| 410 | 3300046522 | Ga0495643_0002386 | Ga0495643_0002386_10602_11087 | 160 |
| 411 | 3300046522 | Ga0495643_0182413 | Ga0495643_0182413_188_673 | 160 |
| 412 | 3300046526 | Ga0495666_0006190 | Ga0495666_0006190_4449_4931 | 160 |
| 413 | 3300046529 | Ga0495652_0509251 | Ga0495652_0509251_44_529 | 160 |
| 414 | 3300046530 | Ga0495654_0025934 | Ga0495654_0025934_1522_2004 | 160 |
| 415 | 3300046533 | Ga0495640_0220603 | Ga0495640_0220603_549_1031 | 160 |
| 416 | 3300046535 | Ga0495586_0035865 | Ga0495586_0035865_1848_2333 | 160 |
| 417 | 3300046535 | Ga0495586_0159896 | Ga0495586_0159896_101_586 | 160 |
| 418 | 3300046536 | Ga0495587_0004886 | Ga0495587_0004886_1230_1715 | 160 |
| 419 | 3300046542 | Ga0495597_0017671 | Ga0495597_0017671_2552_3034 | 160 |
| 420 | 3300046543 | Ga0495645_0035305 | Ga0495645_0035305_2017_2502 | 160 |
| 421 | 3300046557 | Ga0495622_0002284 | Ga0495622_0002284_5318_5800 | 160 |
| 422 | 3300046558 | Ga0495633_0050793 | Ga0495633_0050793_44_529 | 160 |
| 423 | 3300046558 | Ga0495633_0053018 | Ga0495633_0053018_984_1466 | 160 |
| 424 | 3300046615 | Ga0495656_0520726 | Ga0495656_0520726_98_580 | 160 |
| 425 | 3300046616 | Ga0495668_0052802 | Ga0495668_0052802_445_927 | 160 |
| 426 | 3300046642 | Ga0495634_0002275 | Ga0495634_0002275_14543_15028 | 160 |
| 427 | 3300046642 | Ga0495634_0022620 | Ga0495634_0022620_3631_4113 | 160 |
| 428 | 3300046642 | Ga0495634_0516719 | Ga0495634_0516719_27_512 | 160 |
| 429 | 3300046648 | Ga0495611_0023684 | Ga0495611_0023684_1152_1634 | 160 |
| 430 | 3300046660 | Ga0495625_0015228 | Ga0495625_0015228_4947_5429 | 160 |
| 431 | 3300046663 | Ga0495635_0002001 | Ga0495635_0002001_2592_3077 | 160 |
| 432 | 3300046663 | Ga0495635_0005416 | Ga0495635_0005416_3574_4059 | 160 |
| 433 | 3300046663 | Ga0495635_0198720 | Ga0495635_0198720_552_1037 | 160 |
| 434 | 3300046665 | Ga0495661_0049053 | Ga0495661_0049053_1619_2101 | 160 |
| 435 | 3300046674 | Ga0495588_0483829 | Ga0495588_0483829_58_540 | 160 |
| 436 | 3300046675 | Ga0495657_0005197 | Ga0495657_0005197_6630_7115 | 160 |
| 437 | 3300046678 | Ga0495599_0086238 | Ga0495599_0086238_639_1121 | 160 |
| 438 | 3300046680 | Ga0495646_0001460 | Ga0495646_0001460_11239_11724 | 160 |
| 439 | 3300046683 | Ga0495658_0141924 | Ga0495658_0141924_256_741 | 160 |
| 440 | 3300046689 | Ga0495613_0000475 | Ga0495613_0000475_5205_5690 | 160 |
| 441 | 3300046689 | Ga0495613_0175061 | Ga0495613_0175061_434_916 | 160 |
| 442 | 3300046689 | Ga0495613_0205860 | Ga0495613_0205860_172_657 | 160 |
| 443 | 3300046690 | Ga0495624_0009902 | Ga0495624_0009902_3385_3867 | 160 |
| 444 | 3300046690 | Ga0495624_0209120 | Ga0495624_0209120_289_774 | 160 |
| 445 | 3300046691 | Ga0495670_0102431 | Ga0495670_0102431_474_959 | 160 |
| 446 | 3300046691 | Ga0495670_0207423 | Ga0495670_0207423_319_801 | 160 |
| 447 | 3300046692 | Ga0495671_0039411 | Ga0495671_0039411_239_724 | 160 |
| 448 | 3300046692 | Ga0495671_0280754 | Ga0495671_0280754_12_497 | 160 |
| 449 | 3300046694 | Ga0495649_0072714 | Ga0495649_0072714_842_1324 | 160 |
| 450 | 3300046794 | Ga0495589_0018175 | Ga0495589_0018175_182_664 | 160 |
| 451 | 3300046794 | Ga0495589_0109410 | Ga0495589_0109410_326_811 | 160 |
| 452 | 3300046809 | Ga0495600_0015613 | Ga0495600_0015613_1531_2016 | 160 |
| 453 | 3300046809 | Ga0495600_0016644 | Ga0495600_0016644_3133_3618 | 160 |
| 454 | 3300046810 | Ga0495660_0022038 | Ga0495660_0022038_531_1013 | 160 |
| 455 | 3300047315 | Ga0495581_0004899 | Ga0495581_0004899_1088_1573 | 160 |
| 456 | 3300047315 | Ga0495581_0207111 | Ga0495581_0207111_408_893 | 160 |
| 457 | 3300047317 | Ga0495604_0000213 | Ga0495604_0000213_13843_14328 | 160 |
| 458 | 3300047318 | Ga0495636_0026045 | Ga0495636_0026045_515_997 | 160 |
| 459 | 3300047318 | Ga0495636_0118999 | Ga0495636_0118999_222_707 | 160 |
| 460 | 3300047321 | Ga0495676_0009406 | Ga0495676_0009406_6598_7080 | 160 |
| 461 | 3300047321 | Ga0495676_0022814 | Ga0495676_0022814_2761_3246 | 160 |
| 462 | 3300047323 | Ga0495683_0143025 | Ga0495683_0143025_464_949 | 160 |
| 463 | 3300047443 | Ga0495687_000466 | Ga0495687_000466_18616_19101 | 160 |
| 464 | 3300047443 | Ga0495687_015559 | Ga0495687_015559_1334_1819 | 160 |
| 465 | 3300047443 | Ga0495687_157226 | Ga0495687_157226_269_751 | 160 |
| 466 | 3300047444 | Ga0495675_0350327 | Ga0495675_0350327_339_824 | 160 |
| 467 | 3300047445 | Ga0495677_0093759 | Ga0495677_0093759_581_1066 | 160 |
| 468 | 3300047446 | Ga0495679_028981 | Ga0495679_028981_840_1325 | 160 |
| 469 | 3300047447 | Ga0495685_025644 | Ga0495685_025644_753_1238 | 160 |
| 470 | 3300047447 | Ga0495685_028398 | Ga0495685_028398_444_926 | 160 |
| 471 | 3300047470 | Ga0495681_0009898 | Ga0495681_0009898_535_1020 | 160 |
| 472 | 3300047470 | Ga0495681_0033993 | Ga0495681_0033993_1727_2209 | 160 |
| 473 | 3300047472 | Ga0495686_0047417 | Ga0495686_0047417_1824_2309 | 160 |
| 474 | 3300047472 | Ga0495686_0161562 | Ga0495686_0161562_583_1065 | 160 |
| 475 | 3300047673 | Ga0495593_0004809 | Ga0495593_0004809_2067_2552 | 160 |
| 476 | 3300047673 | Ga0495593_0194898 | Ga0495593_0194898_511_996 | 160 |
| 477 | 3300048088 | Ga0495602_0023315 | Ga0495602_0023315_5239_5724 | 160 |
| 478 | 3300048089 | Ga0495614_0005924 | Ga0495614_0005924_2422_2907 | 160 |
| 479 | 3300048089 | Ga0495614_0005960 | Ga0495614_0005960_3446_3931 | 160 |
| 480 | 3300048089 | Ga0495614_0046047 | Ga0495614_0046047_576_1058 | 160 |
| 481 | 3300048091 | Ga0495626_0014942 | Ga0495626_0014942_1303_1785 | 160 |
| 482 | 3300048903 | Ga0496100_0002031 | Ga0496100_0002031_5523_6005 | 160 |
| 483 | 3300048905 | Ga0496102_0571971 | Ga0496102_0571971_353_838 | 160 |
| 484 | 3300048905 | Ga0496102_0914537 | Ga0496102_0914537_70_555 | 160 |
| 485 | 3300048906 | Ga0496103_0001760 | Ga0496103_0001760_7907_8389 | 160 |
| 486 | 3300048909 | Ga0496106_0004423 | Ga0496106_0004423_5668_6150 | 160 |
| 487 | 3300048909 | Ga0496106_0341890 | Ga0496106_0341890_296_781 | 160 |
| 488 | 3300048910 | Ga0496107_0009192 | Ga0496107_0009192_2042_2524 | 160 |
| 489 | 3300048911 | Ga0496108_0193543 | Ga0496108_0193543_859_1341 | 160 |
| 490 | 3300048912 | Ga0496109_0031421 | Ga0496109_0031421_2360_2842 | 160 |
| 491 | 3300048912 | Ga0496109_0086057 | Ga0496109_0086057_673_1158 | 160 |
| 492 | 3300048913 | Ga0496110_0006989 | Ga0496110_0006989_3170_3652 | 160 |
| 493 | 3300048914 | Ga0496111_0005653 | Ga0496111_0005653_4151_4633 | 160 |
| 494 | 3300048915 | Ga0496112_0282422 | Ga0496112_0282422_245_730 | 160 |
| 495 | 3300048916 | Ga0496113_0067276 | Ga0496113_0067276_804_1289 | 160 |
| 496 | 3300048916 | Ga0496113_0508446 | Ga0496113_0508446_413_895 | 160 |
| 497 | 3300048917 | Ga0496114_0977211 | Ga0496114_0977211_193_675 | 160 |
| 498 | 3300048927 | Ga0496124_0411641 | Ga0496124_0411641_135_620 | 160 |
| 499 | 3300048929 | Ga0496126_0476839 | Ga0496126_0476839_457_942 | 160 |
| 500 | 3300048929 | Ga0496126_0705294 | Ga0496126_0705294_54_539 | 160 |
| 501 | 3300049459 | Ga0495678_020964 | Ga0495678_020964_1421_1903 | 160 |
| 502 | 3300049568 | Ga0501031_0008220 | Ga0501031_0008220_1447_1932 | 160 |
| 503 | 3300049569 | Ga0501032_0002053 | Ga0501032_0002053_1705_2187 | 160 |
| 504 | 3300049569 | Ga0501032_0027150 | Ga0501032_0027150_2738_3223 | 160 |
| 505 | 3300049571 | Ga0501034_0000010 | Ga0501034_0000010_31725_32207 | 160 |
| 506 | 3300049571 | Ga0501034_0019694 | Ga0501034_0019694_1770_2252 | 160 |
| 507 | 3300049571 | Ga0501034_0462180 | Ga0501034_0462180_206_691 | 160 |
| 508 | 3300049572 | Ga0501036_0006800 | Ga0501036_0006800_8626_9108 | 160 |
| 509 | 3300049572 | Ga0501036_0036621 | Ga0501036_0036621_2524_3009 | 160 |
| 510 | 3300049573 | Ga0501037_0010193 | Ga0501037_0010193_5179_5661 | 160 |
| 511 | 3300049573 | Ga0501037_0050621 | Ga0501037_0050621_1477_1962 | 160 |
| 512 | 3300049574 | Ga0501038_0002293 | Ga0501038_0002293_17102_17584 | 160 |
| 513 | 3300049574 | Ga0501038_0091085 | Ga0501038_0091085_535_1020 | 160 |
| 514 | 3300049574 | Ga0501038_0755995 | Ga0501038_0755995_116_598 | 160 |
| 515 | 3300049576 | Ga0501040_0138496 | Ga0501040_0138496_713_1198 | 160 |
| 516 | 3300049578 | Ga0501042_0020483 | Ga0501042_0020483_1088_1573 | 160 |
| 517 | 3300049578 | Ga0501042_0111474 | Ga0501042_0111474_1253_1735 | 160 |
| 518 | 3300049579 | Ga0501043_0078090 | Ga0501043_0078090_1035_1517 | 160 |
| 519 | 3300049579 | Ga0501043_0225172 | Ga0501043_0225172_74_559 | 160 |
| 520 | 3300049581 | Ga0501047_0011939 | Ga0501047_0011939_1419_1901 | 160 |
| 521 | 3300049583 | Ga0501067_0236371 | Ga0501067_0236371_457_942 | 160 |
| 522 | 3300049584 | Ga0501068_0352415 | Ga0501068_0352415_389_874 | 160 |
| 523 | 3300049585 | Ga0501069_0116060 | Ga0501069_0116060_376_861 | 160 |
| 524 | 3300049585 | Ga0501069_0263329 | Ga0501069_0263329_401_886 | 160 |
| 525 | 3300049586 | Ga0501070_0384506 | Ga0501070_0384506_372_857 | 160 |
| 526 | 3300049587 | Ga0501071_0031881 | Ga0501071_0031881_1905_2390 | 160 |
| 527 | 3300049588 | Ga0501072_0017795 | Ga0501072_0017795_1529_2014 | 160 |
| 528 | 3300049589 | Ga0501073_0045723 | Ga0501073_0045723_2065_2547 | 160 |
| 529 | 3300049590 | Ga0501074_0026846 | Ga0501074_0026846_2976_3461 | 160 |
| 530 | 3300049590 | Ga0501074_0030892 | Ga0501074_0030892_2865_3347 | 160 |
| 531 | 3300049591 | Ga0501075_0015168 | Ga0501075_0015168_3491_3976 | 160 |
| 532 | 3300049592 | Ga0501076_0002407 | Ga0501076_0002407_9602_10087 | 160 |
| 533 | 3300049593 | Ga0501077_0006102 | Ga0501077_0006102_5298_5783 | 160 |
| 534 | 3300049741 | Ga0501079_0046602 | Ga0501079_0046602_2314_2799 | 160 |
| 535 | 3300049742 | Ga0501080_0749092 | Ga0501080_0749092_168_653 | 160 |
| 536 | 3300049743 | Ga0501081_0256122 | Ga0501081_0256122_357_842 | 160 |
| 537 | 3300049822 | Ga0501035_0060884 | Ga0501035_0060884_841_1326 | 160 |
| 538 | 3300049823 | Ga0501044_0001745 | Ga0501044_0001745_11121_11603 | 160 |
| 539 | 3300049823 | Ga0501044_0133003 | Ga0501044_0133003_1883_2365 | 160 |
| 540 | 3300049824 | Ga0501045_0138440 | Ga0501045_0138440_54_539 | 160 |
| 541 | 3300050490 | nmdc:mga03n38_368094_c1 | nmdc:mga03n38_368094_c1_143_628 | 160 |
| 542 | 3300050491 | nmdc:mga00v17_569770_c1 | nmdc:mga00v17_569770_c1_47_532 | 160 |
| 543 | 3300050492 | nmdc:mga0yw44_13973_c2 | nmdc:mga0yw44_13973_c2_2319_2804 | 160 |
| 544 | 3300050492 | nmdc:mga0yw44_31518_c1 | nmdc:mga0yw44_31518_c1_2369_2854 | 160 |
| 545 | 3300050492 | nmdc:mga0yw44_422688_c1 | nmdc:mga0yw44_422688_c1_271_756 | 160 |
| 546 | 3300050494 | nmdc:mga06z11_340815_c1 | nmdc:mga06z11_340815_c1_142_627 | 160 |
| 547 | 3300050508 | nmdc:mga09592_1192697_c1 | nmdc:mga09592_1192697_c1_126_608 | 160 |
| 548 | 3300053077 | Ga0495601_0003378 | Ga0495601_0003378_4511_4993 | 160 |
| 549 | 3300053077 | Ga0495601_0008679 | Ga0495601_0008679_717_1202 | 160 |
| 550 | 3300053078 | Ga0495612_0152715 | Ga0495612_0152715_84_569 | 160 |
| 551 | 3300053078 | Ga0495612_0161106 | Ga0495612_0161106_98_580 | 160 |
| 552 | 3300053080 | Ga0500635_0320143 | Ga0500635_0320143_60_545 | 160 |
| 553 | 3300053087 | Ga0500643_000496 | Ga0500643_000496_20796_21284 | 160 |
| 554 | 3300053092 | Ga0500583_0056167 | Ga0500583_0056167_1041_1526 | 160 |
| 555 | 3300053095 | Ga0500640_004214 | Ga0500640_004214_1130_1615 | 160 |
| 556 | 3300053098 | Ga0500650_0216956 | Ga0500650_0216956_178_663 | 160 |
| 557 | 3300053100 | Ga0500660_049324 | Ga0500660_049324_1573_2058 | 160 |
| 558 | 3300053100 | Ga0500660_218065 | Ga0500660_218065_20_502 | 160 |
| 559 | 3300053101 | Ga0500553_049642 | Ga0500553_049642_1092_1577 | 160 |
| 560 | 3300053107 | Ga0500560_079176 | Ga0500560_079176_336_821 | 160 |
| 561 | 3300053111 | Ga0500572_068892 | Ga0500572_068892_16_501 | 160 |
| 562 | 3300053113 | Ga0500580_098264 | Ga0500580_098264_569_1054 | 160 |
| 563 | 3300053118 | Ga0500594_0101110 | Ga0500594_0101110_113_598 | 160 |
| 564 | 3300053123 | Ga0500614_008180 | Ga0500614_008180_1028_1513 | 160 |
| 565 | 3300053123 | Ga0500614_047749 | Ga0500614_047749_44_529 | 160 |
| 566 | 3300053129 | Ga0500628_022473 | Ga0500628_022473_669_1154 | 160 |
| 567 | 3300053131 | Ga0500652_007570 | Ga0500652_007570_2353_2838 | 160 |
| 568 | 3300053131 | Ga0500652_172101 | Ga0500652_172101_187_672 | 160 |
| 569 | 3300053134 | Ga0500658_0045652 | Ga0500658_0045652_133_618 | 160 |
| 570 | 3300053136 | Ga0500559_0012293 | Ga0500559_0012293_3084_3569 | 160 |
| 571 | 3300053137 | Ga0500561_0001430 | Ga0500561_0001430_304_789 | 160 |
| 572 | 3300053143 | Ga0500579_185584 | Ga0500579_185584_304_789 | 160 |
| 573 | 3300053149 | Ga0500600_0006942 | Ga0500600_0006942_4776_5261 | 160 |
| 574 | 3300053153 | Ga0500616_0239618 | Ga0500616_0239618_11_496 | 160 |
| 575 | 3300053157 | Ga0500624_035669 | Ga0500624_035669_212_697 | 160 |
| 576 | 3300053160 | Ga0500633_0023775 | Ga0500633_0023775_304_789 | 160 |
| 577 | 3300053161 | Ga0500634_0145799 | Ga0500634_0145799_537_1022 | 160 |
| 578 | 3300053177 | Ga0500636_0126421 | Ga0500636_0126421_437_922 | 160 |
| 579 | 3300053732 | Ga0500656_009012 | Ga0500656_009012_481_966 | 160 |
| 580 | 3300053739 | Ga0500587_008183 | Ga0500587_008183_725_1210 | 160 |
| 581 | 3300060353 | Ga0501082_0290718 | Ga0501082_0290718_830_1315 | 160 |
| 582 | 3300061719 | Ga0466962_0000456 | Ga0466962_0000456_1710_2192 | 160 |
| 583 | 3300061719 | Ga0466962_0004821 | Ga0466962_0004821_3760_4245 | 160 |
| 584 | 3300061734 | Ga0530510_0089856 | Ga0530510_0089856_1638_2123 | 160 |
| 585 | 3300037312 | Ga0395899_0002326 | Ga0395899_0002326_14348_14833 | 161 |
| 586 | 3300037418 | Ga0395900_0231683 | Ga0395900_0231683_305_790 | 161 |
| 587 | 3300037466 | Ga0395898_0009860 | Ga0395898_0009860_8015_8500 | 161 |
| 588 | 3300038443 | Ga0395901_0105512 | Ga0395901_0105512_345_830 | 161 |
| 589 | 3300044694 | Ga0466963_0535922 | Ga0466963_0535922_275_778 | 161 |
| 590 | 3300002773 | JGI25152J39213_1000298 | JGI25152J39213_10002983 | 162 |
| 591 | 3300003187 | JGI25151J46595_10046195 | JGI25151J46595_100461952 | 162 |
| 592 | 3300005539 | Ga0068853_100027362 | Ga0068853_1000273626 | 162 |
| 593 | 3300009148 | Ga0105243_10022723 | Ga0105243_100227236 | 162 |
| 594 | 3300011119 | Ga0105246_10008282 | Ga0105246_100082822 | 162 |
| 595 | 3300025258 | Ga0209129_1000064 | Ga0209129_1000064195 | 162 |
| 596 | 3300025294 | Ga0209025_1001863 | Ga0209025_10018638 | 162 |
| 597 | 3300025315 | Ga0207697_10236818 | Ga0207697_102368181 | 162 |
| 598 | 3300025935 | Ga0207709_10012576 | Ga0207709_100125766 | 162 |
| 599 | 3300026041 | Ga0207639_10052921 | Ga0207639_100529214 | 162 |
| 600 | 3300027907 | Ga0207428_10088141 | Ga0207428_100881412 | 162 |
| 601 | 3300028786 | Ga0307517_10074650 | Ga0307517_100746502 | 162 |
| 602 | 3300031852 | Ga0307410_10362263 | Ga0307410_103622632 | 162 |
| 603 | 3300032002 | Ga0307416_100033029 | Ga0307416_1000330292 | 162 |
| 604 | 3300048905 | Ga0496102_0185384 | Ga0496102_0185384_680_1168 | 162 |
| 605 | 3300048913 | Ga0496110_1353111 | Ga0496110_1353111_16_504 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d82-assembly1.cif.gz_E | crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution | 0.8889 | 60 | 140 |
| 8e8w-assembly1.cif.gz_A | crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway | 0.8877 | 62 | 140 |
| 8e8w-assembly1.cif.gz_B | crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway | 0.8757 | 60 | 140 |
| 6xcv-assembly1.cif.gz_B | crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 | 0.873 | 61 | 140 |
| 5wse-assembly2.cif.gz_C | crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i | 0.8708 | 59 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A3Z5_62_265_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9067 | 62 | 141 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8792 | 59 | 140 | 2.60.120.10 |
| af_Q9LUJ7_61_262_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8713 | 62 | 147 | 2.60.120.10 |
| 5yjsA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8677 | 61 | 147 | 2.60.120.10 |
| af_P33487_36_198_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.866 | 62 | 150 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A1MHR5-F1-model_v4 | Cupin domain protein | 0.9525 | 62 | 149 |
|
| AF-A0A6P1B8I6-F1-model_v4 | Cupin domain-containing protein | 0.9466 | 59 | 162 |
|
| AF-A0A4R3PZ87-F1-model_v4 | Cupin domain | 0.9418 | 61 | 152 |
|
| AF-A0A7Y2G8C9-F1-model_v4 | Cupin domain-containing protein | 0.9389 | 59 | 140 |
|
| AF-A0A1F8VLZ3-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9342 | 62 | 149 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar