F468487

General Info

Members Datasets Scaffolds Average Seq Length
605 365 570 159

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10074650|Ga0307517_100746502
Length 178
Sequence MEPAPRRQPHSEDGRGENRDGNRGEYRLEGDDSMYRLPSGLLAPVVTRAGEEHTDAAGSGGAVRISGVSIQHTPATRLWYGKVSNEPGYRSVTHHHGEAETGGYVLSGRARIYFGEKFEDYLDMEEGDWVFVPPFMPHVECNLSRTSPLVWMTTRTPENIVVNLPDVDDAELRDWLNR

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
5 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
6 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
7 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
8 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
9 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
10 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
11 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
12 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
13 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
14 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
15 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
16 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
17 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
18 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
19 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
20 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
21 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
22 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
23 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
24 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
25 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
26 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
27 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
170 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
173 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
174 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
177 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
180 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
181 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
182 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
183 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
213 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
270 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
335 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
336 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
337 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
338 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
339 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
340 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
341 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
342 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
343 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
344 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
345 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
346 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
349 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
350 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
353 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
354 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
355 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
356 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
357 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
360 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
361 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
362 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
363 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
364 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
365 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.74
Metatranscriptomes 2.81
Isolates 5.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 8.6
Nodule 0
Rhizoplane 5.12
Rhizosphere 75.7
Stem 0
Stem Tuber 0
Unclassified 10.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000298 3300002773 Bacteria 32097
2 JGI25150J39212_1029224 3300002774 Bacteria 775
3 JGI25151J46595_10046195 3300003187 Bacteria 1527
4 Ga0070683_100174604 3300005329 Bacteria 2040
5 Ga0070683_100242135 3300005329 Bacteria 1716
6 Ga0070683_100580054 3300005329 Bacteria 1073
7 Ga0068869_100308701 3300005334 Bacteria 1280
8 Ga0070682_100461973 3300005337 Bacteria 975
9 Ga0070660_100037991 3300005339 Bacteria 3652
10 Ga0070691_10130119 3300005341 Bacteria 1275
11 Ga0070692_10141289 3300005345 Bacteria 1363
12 Ga0070668_100323191 3300005347 Bacteria 1299
13 Ga0070659_100596673 3300005366 Bacteria 949
14 Ga0070659_100735480 3300005366 Bacteria 855
15 Ga0070667_100343302 3300005367 Bacteria 1351
16 Ga0070667_100855337 3300005367 Bacteria 845
17 Ga0070714_100076873 3300005435 Bacteria 2899
18 Ga0070714_101000304 3300005435 Bacteria 814
19 Ga0070714_101150871 3300005435 Bacteria 757
20 Ga0070713_100074966 3300005436 Bacteria 2868
21 Ga0070713_100159142 3300005436 Bacteria 2015
22 Ga0070713_100161154 3300005436 Bacteria 2003
23 Ga0070711_100023630 3300005439 Bacteria 4001
24 Ga0070705_100266913 3300005440 Bacteria 1210
25 Ga0070663_100426276 3300005455 Bacteria 1089
26 Ga0070678_100194885 3300005456 Bacteria 1668
27 Ga0070681_10274417 3300005458 Bacteria 1597
28 Ga0070685_11008424 3300005466 Bacteria 625
29 Ga0070679_100087791 3300005530 Bacteria 3097
30 Ga0070679_100302946 3300005530 Bacteria 1549
31 Ga0070684_100057683 3300005535 Bacteria 3391
32 Ga0068853_100027362 3300005539 Bacteria 4791
33 Ga0068853_101106018 3300005539 Bacteria 764
34 Ga0070672_100146234 3300005543 Bacteria 1953
35 Ga0070665_100004557 3300005548 Bacteria 14522
36 Ga0070665_100185865 3300005548 Bacteria 2079
37 Ga0068857_100296446 3300005577 Bacteria 1490
38 Ga0068857_101022637 3300005577 Bacteria 796
39 Ga0068856_100652551 3300005614 Bacteria 1073
40 Ga0068856_100784321 3300005614 Bacteria 973
41 Ga0068852_100199521 3300005616 Bacteria 1893
42 Ga0068864_100813784 3300005618 Bacteria 919
43 Ga0068863_100009897 3300005841 Bacteria 9284
44 Ga0068863_100957606 3300005841 Bacteria 858
45 Ga0068858_100034983 3300005842 Bacteria 4659
46 Ga0068858_100934096 3300005842 Bacteria 849
47 Ga0068860_100014727 3300005843 Bacteria 7648
48 Ga0068860_100059694 3300005843 Bacteria 3626
49 Ga0068862_100041865 3300005844 Bacteria 3899
50 Ga0075365_10031285 3300006038 Bacteria 3413
51 Ga0075365_10109934 3300006038 Bacteria 1894
52 Ga0075363_100626938 3300006048 Bacteria 646
53 Ga0075364_10467837 3300006051 Bacteria 862
54 Ga0070712_101366458 3300006175 Bacteria 618
55 Ga0075362_10239170 3300006177 Bacteria 891
56 Ga0075367_10667759 3300006178 Bacteria 661
57 Ga0075370_10251202 3300006353 Bacteria 1048
58 Ga0105244_10010864 3300009036 Bacteria 5496
59 Ga0105244_10081604 3300009036 Bacteria 1600
60 Ga0105247_10631990 3300009101 Bacteria 798
61 Ga0105243_10022723 3300009148 Bacteria 4769
62 Ga0105243_10051988 3300009148 Bacteria 3243
63 Ga0105243_10587321 3300009148 Bacteria 1070
64 Ga0105246_10007977 3300011119 Bacteria 6498
65 Ga0105246_10008282 3300011119 Bacteria 6386
66 Ga0157370_10038015 3300013104 Bacteria 4659
67 Ga0157369_10095681 3300013105 Bacteria 3168
68 Ga0157369_10974848 3300013105 Bacteria 868
69 Ga0157378_10372226 3300013297 Bacteria 1401
70 Ga0163162_10001793 3300013306 Bacteria 20150
71 Ga0157372_10837259 3300013307 Bacteria 1068
72 Ga0157375_10003423 3300013308 Bacteria 13755
73 Ga0157375_10096747 3300013308 Bacteria 3025
74 Ga0157375_10343357 3300013308 Bacteria 1658
75 Ga0163163_10721910 3300014325 Bacteria 1060
76 Ga0182008_10246706 3300014497 Bacteria 920
77 Ga0157379_10287071 3300014968 Bacteria 1498
78 Ga0157376_11502449 3300014969 Bacteria 707
79 Ga0206356_11465510 3300020070 Bacteria 1997
80 Ga0206349_1507694 3300020075 Bacteria 827
81 Ga0206351_10576349 3300020077 Bacteria 744
82 Ga0206351_10691340 3300020077 Bacteria 779
83 Ga0206350_10127885 3300020080 Bacteria 840
84 Ga0206350_10383883 3300020080 Bacteria 1948
85 Ga0206354_10930448 3300020081 Bacteria 1175
86 Ga0206353_10810260 3300020082 Bacteria 1952
87 Ga0206353_11094702 3300020082 Bacteria 1411
88 Ga0206353_11389892 3300020082 Bacteria 3802
89 Ga0213875_10157203 3300021388 Bacteria 1066
90 Ga0224712_10047789 3300022467 Bacteria 1648
91 Ga0224712_10176069 3300022467 Bacteria 962
92 Ga0224712_10421740 3300022467 Bacteria 638
93 Ga0224712_10543283 3300022467 Bacteria 564
94 Ga0224712_10581953 3300022467 Bacteria 546
95 Ga0207425_1016965 3300025245 Bacteria 1609
96 Ga0209129_1000064 3300025258 Bacteria 236026
97 Ga0209025_1001863 3300025294 Bacteria 24711
98 Ga0209051_1008018 3300025303 Bacteria 5661
99 Ga0207697_10007253 3300025315 Bacteria 4952
100 Ga0207697_10236818 3300025315 Bacteria 806
101 Ga0207655_1006782 3300025728 Bacteria 7532
102 Ga0207655_1027211 3300025728 Bacteria 2729
103 Ga0207682_10196894 3300025893 Bacteria 925
104 Ga0207705_10189253 3300025909 Bacteria 1555
105 Ga0207707_10003354 3300025912 Bacteria 14219
106 Ga0207693_10416856 3300025915 Bacteria 1050
107 Ga0207663_10223726 3300025916 Bacteria 1371
108 Ga0207660_10146096 3300025917 Bacteria 1812
109 Ga0207662_11005040 3300025918 Bacteria 592
110 Ga0207657_10014957 3300025919 Bacteria 7540
111 Ga0207694_10701115 3300025924 Bacteria 854
112 Ga0207650_10250447 3300025925 Bacteria 1434
113 Ga0207650_11055201 3300025925 Bacteria 691
114 Ga0207700_10301398 3300025928 Bacteria 1384
115 Ga0207700_10440054 3300025928 Bacteria 1147
116 Ga0207700_10918844 3300025928 Bacteria 783
117 Ga0207664_10009672 3300025929 Bacteria 6777
118 Ga0207664_10513526 3300025929 Bacteria 1074
119 Ga0207644_10442454 3300025931 Bacteria 1067
120 Ga0207709_10012576 3300025935 Bacteria 4663
121 Ga0207709_10017656 3300025935 Bacteria 3985
122 Ga0207709_10282833 3300025935 Bacteria 1226
123 Ga0207709_10421256 3300025935 Bacteria 1026
124 Ga0207665_10390811 3300025939 Bacteria 1057
125 Ga0207691_10738593 3300025940 Bacteria 829
126 Ga0207689_10223220 3300025942 Bacteria 1557
127 Ga0207689_10275526 3300025942 Bacteria 1393
128 Ga0207661_10059663 3300025944 Bacteria 3075
129 Ga0207661_10107146 3300025944 Bacteria 2357
130 Ga0207661_10117885 3300025944 Bacteria 2256
131 Ga0207668_10296193 3300025972 Bacteria 1333
132 Ga0207658_10723733 3300025986 Bacteria 900
133 Ga0207677_11021489 3300026023 Bacteria 751
134 Ga0207703_10149443 3300026035 Bacteria 2035
135 Ga0207703_10222658 3300026035 Bacteria 1688
136 Ga0207639_10052921 3300026041 Bacteria 3095
137 Ga0207678_10028639 3300026067 Bacteria 4860
138 Ga0207708_10258750 3300026075 Bacteria 1404
139 Ga0207641_10011017 3300026088 Bacteria 7416
140 Ga0207641_10882114 3300026088 Bacteria 888
141 Ga0207676_10440793 3300026095 Bacteria 1226
142 Ga0207674_10121337 3300026116 Bacteria 2581
143 Ga0207674_10137627 3300026116 Bacteria 2403
144 Ga0207674_10515595 3300026116 Bacteria 1155
145 Ga0207675_100669535 3300026118 Bacteria 1045
146 Ga0207683_10282289 3300026121 Bacteria 1517
147 Ga0207683_10728980 3300026121 Bacteria 919
148 Ga0207698_10963328 3300026142 Bacteria 863
149 Ga0207428_10088141 3300027907 Bacteria 2414
150 Ga0268266_10028984 3300028379 Bacteria 4704
151 Ga0268266_11332569 3300028379 Bacteria 693
152 Ga0268264_10008739 3300028381 Bacteria 8410
153 Ga0268264_10023396 3300028381 Bacteria 5042
154 Ga0307517_10001880 3300028786 Bacteria 34363
155 Ga0307517_10044397 3300028786 Bacteria 4702
156 Ga0307517_10074650 3300028786 Bacteria 2987
157 Ga0307515_10000025 3300028794 Bacteria 390205
158 Ga0307515_10051743 3300028794 Bacteria 6113
159 Ga0307515_10440936 3300028794 Bacteria 919
160 Ga0307511_10018885 3300030521 Bacteria 6573
161 Ga0307511_10056542 3300030521 Bacteria 3066
162 Ga0307512_10001507 3300030522 Bacteria 32791
163 Ga0307512_10043743 3300030522 Bacteria 3690
164 Ga0314311_1250029 3300030733 Bacteria 2039
165 Ga0307513_10001759 3300031456 Bacteria 30872
166 Ga0307513_10031957 3300031456 Bacteria 5948
167 Ga0307513_10377710 3300031456 Bacteria 1157
168 Ga0307513_10412592 3300031456 Bacteria 1082
169 Ga0307509_10008111 3300031507 Bacteria 13478
170 Ga0307509_10028028 3300031507 Bacteria 6263
171 Ga0307509_10094899 3300031507 Bacteria 3040
172 Ga0307509_10134928 3300031507 Bacteria 2415
173 Ga0307509_10475373 3300031507 Bacteria 939
174 Ga0307408_100049738 3300031548 Bacteria 3012
175 Ga0307408_100149859 3300031548 Bacteria 1840
176 Ga0307408_100550253 3300031548 Bacteria 1018
177 Ga0307508_10001011 3300031616 Bacteria 32731
178 Ga0307508_10015571 3300031616 Bacteria 6928
179 Ga0307508_10023926 3300031616 Bacteria 5544
180 Ga0307508_10219990 3300031616 Bacteria 1499
181 Ga0307508_10281724 3300031616 Bacteria 1255
182 Ga0307508_10294367 3300031616 Bacteria 1216
183 Ga0307514_10033517 3300031649 Bacteria 4098
184 Ga0307514_10168116 3300031649 Bacteria 1437
185 Ga0307516_10127664 3300031730 Bacteria 2326
186 Ga0307516_10555602 3300031730 Bacteria 802
187 Ga0307405_10117468 3300031731 Bacteria 1813
188 Ga0307405_10120417 3300031731 Bacteria 1795
189 Ga0307405_10474426 3300031731 Bacteria 997
190 Ga0307413_10007847 3300031824 Bacteria 4993
191 Ga0307413_10011632 3300031824 Bacteria 4339
192 Ga0307413_10104925 3300031824 Bacteria 1877
193 Ga0307413_10490735 3300031824 Bacteria 984
194 Ga0307413_10517325 3300031824 Bacteria 962
195 Ga0307518_10131071 3300031838 Bacteria 1762
196 Ga0307518_10501790 3300031838 Bacteria 624
197 Ga0307410_10062549 3300031852 Bacteria 2551
198 Ga0307410_10153056 3300031852 Bacteria 1719
199 Ga0307410_10236863 3300031852 Bacteria 1412
200 Ga0307410_10362263 3300031852 Bacteria 1161
201 Ga0307410_10418203 3300031852 Bacteria 1087
202 Ga0307410_11379190 3300031852 Bacteria 618
203 Ga0307406_10096832 3300031901 Bacteria 2000
204 Ga0307406_10107911 3300031901 Bacteria 1910
205 Ga0307406_10175115 3300031901 Bacteria 1557
206 Ga0307407_10029246 3300031903 Bacteria 2957
207 Ga0307407_10088405 3300031903 Bacteria 1893
208 Ga0307407_10188967 3300031903 Bacteria 1371
209 Ga0307407_10347239 3300031903 Bacteria 1050
210 Ga0307412_10036474 3300031911 Bacteria 3150
211 Ga0307412_10052656 3300031911 Bacteria 2696
212 Ga0307412_10247102 3300031911 Bacteria 1383
213 Ga0307412_11766147 3300031911 Bacteria 568
214 Ga0307409_100405748 3300031995 Bacteria 1303
215 Ga0307409_100432462 3300031995 Bacteria 1266
216 Ga0307409_100505859 3300031995 Bacteria 1177
217 Ga0307409_100696679 3300031995 Bacteria 1015
218 Ga0307409_100899749 3300031995 Bacteria 899
219 Ga0307416_100000832 3300032002 Bacteria 16241
220 Ga0307416_100006456 3300032002 Bacteria 7343
221 Ga0307416_100033029 3300032002 Bacteria 3918
222 Ga0307416_100114994 3300032002 Bacteria 2381
223 Ga0307416_100569760 3300032002 Bacteria 1208
224 Ga0307416_100777901 3300032002 Bacteria 1052
225 Ga0307416_102819869 3300032002 Bacteria 581
226 Ga0307414_10642025 3300032004 Bacteria 956
227 Ga0307414_10715165 3300032004 Bacteria 908
228 Ga0307411_10481816 3300032005 Bacteria 1045
229 Ga0307411_11641733 3300032005 Bacteria 594
230 Ga0307415_100060643 3300032126 Bacteria 2615
231 Ga0307507_10000084 3300033179 Bacteria 145642
232 Ga0307507_10010281 3300033179 Bacteria 12145
233 Ga0307507_10079522 3300033179 Bacteria 2897
234 Ga0307510_10003046 3300033180 Bacteria 19352
235 Ga0307510_10131082 3300033180 Bacteria 2180
236 Ga0373944_0207041 3300035089 Bacteria 712
237 Ga0373946_0639991 3300035171 Bacteria 553
238 Ga0373935_0002713 3300035692 Bacteria 10187
239 Ga0373935_0094401 3300035692 Bacteria 1963
240 Ga0373927_0367561 3300035695 Bacteria 948
241 Ga0373947_0231310 3300035725 Bacteria 1218
242 Ga0373937_0328745 3300036401 Bacteria 1447
243 Ga0372808_007824 3300036459 Bacteria 1470
244 Ga0372808_033818 3300036459 Bacteria 733
245 Ga0373925_0000020 3300037068 Bacteria 170299
246 Ga0373925_1181425 3300037068 Bacteria 629
247 Ga0395899_0002326 3300037312 Bacteria 15475
248 Ga0395900_0231683 3300037418 Bacteria 1857
249 Ga0395898_0009860 3300037466 Bacteria 10011
250 Ga0395898_0039482 3300037466 Bacteria 4672
251 Ga0395898_0099398 3300037466 Bacteria 2794
252 Ga0395898_0449634 3300037466 Bacteria 1227
253 Ga0395898_0529183 3300037466 Bacteria 1120
254 Ga0395905_0049729 3300037471 Bacteria 3929
255 Ga0436364_1132424 3300037853 Bacteria 1258
256 Ga0395901_0036661 3300038443 Bacteria 5069
257 Ga0395901_0089453 3300038443 Bacteria 3222
258 Ga0395901_0098258 3300038443 Bacteria 3069
259 Ga0395901_0105512 3300038443 Bacteria 2957
260 Ga0395901_0467140 3300038443 Bacteria 1288
261 Ga0451791_1894528 3300041451 Bacteria 854
262 Ga0451802_0443385 3300041460 Bacteria 663
263 Ga0451807_1599420 3300041486 Bacteria 673
264 Ga0451835_0666825 3300041492 Bacteria 1543
265 Ga0451837_1735119 3300041494 Bacteria 1769
266 Ga0451839_1472345 3300041496 Bacteria 1047
267 Ga0451841_0364791 3300041498 Bacteria 929
268 Ga0451845_0797742 3300041501 Bacteria 881
269 Ga0451847_0520032 3300041503 Bacteria 709
270 Ga0451853_2470593 3300041512 Bacteria 3458
271 Ga0451853_3963956 3300041512 Bacteria 1589
272 Ga0439433_0169911 3300041999 Bacteria 567
273 Ga0450894_003861 3300042131 Bacteria 1961
274 Ga0450898_004651 3300042134 Bacteria 2039
275 Ga0450899_000631 3300042135 Bacteria 4017
276 Ga0450906_002466 3300042145 Bacteria 4046
277 Ga0466969_0000705 3300044656 Bacteria 18097
278 Ga0466972_0052361 3300044658 Bacteria 1967
279 Ga0466972_0144323 3300044658 Bacteria 1120
280 Ga0466965_0003253 3300044683 Bacteria 7106
281 Ga0466965_0385078 3300044683 Bacteria 773
282 Ga0466966_0041873 3300044684 Bacteria 2942
283 Ga0466966_0053708 3300044684 Bacteria 2555
284 Ga0466961_0003833 3300044693 Bacteria 9407
285 Ga0466961_0045642 3300044693 Bacteria 2803
286 Ga0466963_0008224 3300044694 Bacteria 6252
287 Ga0466963_0535922 3300044694 Bacteria 827
288 Ga0466964_0286976 3300044706 Bacteria 825
289 Ga0466971_0002406 3300044719 Bacteria 7896
290 Ga0466971_0012310 3300044719 Bacteria 3747
291 Ga0466968_0075918 3300044735 Bacteria 1470
292 Ga0466970_0254431 3300044765 Bacteria 985
293 Ga0466960_0067546 3300044901 Bacteria 1771
294 Ga0466960_0123442 3300044901 Bacteria 1359
295 Ga0466959_0004161 3300045049 Bacteria 9637
296 Ga0466959_0097056 3300045049 Bacteria 2112
297 Ga0466959_0620223 3300045049 Bacteria 727
298 Ga0466958_0236527 3300045836 Bacteria 1167
299 Ga0466967_0046461 3300045976 Bacteria 3780
300 Ga0495617_005542 3300046452 Bacteria 4470
301 Ga0495592_0021090 3300046454 Bacteria 4954
302 Ga0495592_0041342 3300046454 Bacteria 3455
303 Ga0495603_0004604 3300046455 Bacteria 8230
304 Ga0495603_0044785 3300046455 Bacteria 2640
305 Ga0495629_0003536 3300046459 Bacteria 11808
306 Ga0495629_0014302 3300046459 Bacteria 5710
307 Ga0495629_0053055 3300046459 Bacteria 2837
308 Ga0495629_0195378 3300046459 Bacteria 1399
309 Ga0495638_0131209 3300046460 Bacteria 1471
310 Ga0495638_0266274 3300046460 Bacteria 937
311 Ga0495651_0000674 3300046462 Bacteria 26519
312 Ga0495651_0009009 3300046462 Bacteria 7662
313 Ga0495653_0065156 3300046463 Bacteria 2743
314 Ga0495580_0969978 3300046472 Bacteria 543
315 Ga0495582_0035749 3300046473 Bacteria 2732
316 Ga0495605_0013236 3300046474 Bacteria 4554
317 Ga0495639_0479176 3300046475 Bacteria 634
318 Ga0495662_0004188 3300046476 Bacteria 7267
319 Ga0495664_0003414 3300046477 Bacteria 8631
320 Ga0495664_0143593 3300046477 Bacteria 1447
321 Ga0495584_0307007 3300046491 Bacteria 806
322 Ga0495585_0038237 3300046492 Bacteria 2701
323 Ga0495594_0064243 3300046499 Bacteria 2034
324 Ga0495594_0113872 3300046499 Bacteria 1526
325 Ga0495594_0282581 3300046499 Bacteria 945
326 Ga0495596_0008135 3300046500 Bacteria 4683
327 Ga0495607_0029983 3300046501 Bacteria 3344
328 Ga0495583_0148526 3300046506 Bacteria 972
329 Ga0495606_0019954 3300046507 Bacteria 4961
330 Ga0495608_0289874 3300046511 Bacteria 1015
331 Ga0495610_0015879 3300046512 Bacteria 4356
332 Ga0495616_0030674 3300046513 Bacteria 2822
333 Ga0495618_0039130 3300046514 Bacteria 2981
334 Ga0495620_0047630 3300046515 Bacteria 1843
335 Ga0495628_0027386 3300046516 Bacteria 4639
336 Ga0495628_0045346 3300046516 Bacteria 3496
337 Ga0495628_0066066 3300046516 Bacteria 2827
338 Ga0495630_0269327 3300046517 Bacteria 1301
339 Ga0495631_0004942 3300046518 Bacteria 7025
340 Ga0495632_0052963 3300046519 Bacteria 1994
341 Ga0495632_0239544 3300046519 Bacteria 816
342 Ga0495637_0040125 3300046520 Bacteria 2017
343 Ga0495637_0076345 3300046520 Bacteria 1343
344 Ga0495643_0002386 3300046522 Bacteria 14999
345 Ga0495643_0182413 3300046522 Bacteria 1019
346 Ga0495666_0006190 3300046526 Bacteria 6022
347 Ga0495652_0014703 3300046529 Bacteria 7018
348 Ga0495652_0509251 3300046529 Bacteria 833
349 Ga0495654_0025934 3300046530 Bacteria 3018
350 Ga0495654_0203538 3300046530 Bacteria 846
351 Ga0495640_0085571 3300046533 Bacteria 2089
352 Ga0495640_0220603 3300046533 Bacteria 1196
353 Ga0495586_0035865 3300046535 Bacteria 2664
354 Ga0495586_0159896 3300046535 Bacteria 1270
355 Ga0495586_0475278 3300046535 Bacteria 721
356 Ga0495587_0004886 3300046536 Bacteria 8788
357 Ga0495587_0498333 3300046536 Bacteria 673
358 Ga0495597_0017671 3300046542 Bacteria 3351
359 Ga0495645_0035305 3300046543 Bacteria 3645
360 Ga0495622_0002284 3300046557 Bacteria 9319
361 Ga0495622_0331474 3300046557 Bacteria 660
362 Ga0495633_0030830 3300046558 Bacteria 2603
363 Ga0495633_0050793 3300046558 Bacteria 1954
364 Ga0495633_0053018 3300046558 Bacteria 1909
365 Ga0495656_0006202 3300046615 Bacteria 4183
366 Ga0495656_0520726 3300046615 Bacteria 632
367 Ga0495656_0579823 3300046615 Bacteria 599
368 Ga0495668_0052802 3300046616 Bacteria 2248
369 Ga0495634_0002275 3300046642 Bacteria 16081
370 Ga0495634_0022620 3300046642 Bacteria 4428
371 Ga0495634_0028711 3300046642 Bacteria 3859
372 Ga0495634_0516719 3300046642 Bacteria 699
373 Ga0495611_0023684 3300046648 Bacteria 2666
374 Ga0495625_0015228 3300046660 Bacteria 6100
375 Ga0495625_0146512 3300046660 Bacteria 1589
376 Ga0495635_0002001 3300046663 Bacteria 13853
377 Ga0495635_0005416 3300046663 Bacteria 8874
378 Ga0495635_0198720 3300046663 Bacteria 1360
379 Ga0495659_0425464 3300046664 Bacteria 575
380 Ga0495661_0049053 3300046665 Bacteria 2562
381 Ga0495661_0222679 3300046665 Bacteria 977
382 Ga0495588_0483829 3300046674 Bacteria 649
383 Ga0495657_0005197 3300046675 Bacteria 10309
384 Ga0495599_0086238 3300046678 Bacteria 1961
385 Ga0495623_0036279 3300046679 Bacteria 3159
386 Ga0495646_0001460 3300046680 Bacteria 14050
387 Ga0495647_0115978 3300046681 Bacteria 1122
388 Ga0495658_0141924 3300046683 Bacteria 1469
389 Ga0495658_0488742 3300046683 Bacteria 787
390 Ga0495613_0000475 3300046689 Bacteria 34309
391 Ga0495613_0175061 3300046689 Bacteria 1521
392 Ga0495613_0205860 3300046689 Bacteria 1385
393 Ga0495624_0009902 3300046690 Bacteria 6588
394 Ga0495624_0209120 3300046690 Bacteria 1184
395 Ga0495670_0002884 3300046691 Bacteria 8471
396 Ga0495670_0047588 3300046691 Bacteria 2144
397 Ga0495670_0102431 3300046691 Bacteria 1475
398 Ga0495670_0207423 3300046691 Bacteria 1039
399 Ga0495671_0039411 3300046692 Bacteria 2385
400 Ga0495671_0280754 3300046692 Bacteria 802
401 Ga0495649_0072714 3300046694 Bacteria 1843
402 Ga0495589_0018175 3300046794 Bacteria 3607
403 Ga0495589_0109410 3300046794 Bacteria 1334
404 Ga0495600_0015613 3300046809 Bacteria 4807
405 Ga0495600_0016644 3300046809 Bacteria 4671
406 Ga0495600_0087587 3300046809 Bacteria 2031
407 Ga0495660_0022038 3300046810 Bacteria 3641
408 Ga0495581_0004899 3300047315 Bacteria 7743
409 Ga0495581_0018083 3300047315 Bacteria 4094
410 Ga0495581_0207111 3300047315 Bacteria 1147
411 Ga0495604_0000213 3300047317 Bacteria 53409
412 Ga0495636_0011022 3300047318 Bacteria 3577
413 Ga0495636_0026045 3300047318 Bacteria 2377
414 Ga0495636_0118999 3300047318 Bacteria 1167
415 Ga0495676_0009406 3300047321 Bacteria 8902
416 Ga0495676_0022814 3300047321 Bacteria 5439
417 Ga0495676_0088834 3300047321 Bacteria 2316
418 Ga0495683_0143025 3300047323 Bacteria 1119
419 Ga0495687_000466 3300047443 Bacteria 48926
420 Ga0495687_015559 3300047443 Bacteria 3862
421 Ga0495687_157226 3300047443 Bacteria 769
422 Ga0495687_202024 3300047443 Bacteria 630
423 Ga0495675_0131756 3300047444 Bacteria 1553
424 Ga0495675_0350327 3300047444 Bacteria 868
425 Ga0495677_0072206 3300047445 Bacteria 1287
426 Ga0495677_0093759 3300047445 Bacteria 1133
427 Ga0495679_028981 3300047446 Bacteria 1810
428 Ga0495685_025644 3300047447 Bacteria 2027
429 Ga0495685_028398 3300047447 Bacteria 1924
430 Ga0495681_0009898 3300047470 Bacteria 5823
431 Ga0495681_0033993 3300047470 Bacteria 2545
432 Ga0495686_0047417 3300047472 Bacteria 2713
433 Ga0495686_0161562 3300047472 Bacteria 1308
434 Ga0495593_0004809 3300047673 Bacteria 8009
435 Ga0495593_0194898 3300047673 Bacteria 1019
436 Ga0495602_0023315 3300048088 Bacteria 6032
437 Ga0495602_0120454 3300048088 Bacteria 2112
438 Ga0495614_0005924 3300048089 Bacteria 5506
439 Ga0495614_0005960 3300048089 Bacteria 5490
440 Ga0495614_0046047 3300048089 Bacteria 1870
441 Ga0495626_0014942 3300048091 Bacteria 3984
442 Ga0496100_0002031 3300048903 Bacteria 10135
443 Ga0496100_0058765 3300048903 Bacteria 2525
444 Ga0496100_0170779 3300048903 Bacteria 1566
445 Ga0496101_0104490 3300048904 Bacteria 2124
446 Ga0496102_0004390 3300048905 Bacteria 11912
447 Ga0496102_0129463 3300048905 Bacteria 2361
448 Ga0496102_0185384 3300048905 Bacteria 1961
449 Ga0496102_0571971 3300048905 Bacteria 1053
450 Ga0496102_0914537 3300048905 Bacteria 799
451 Ga0496103_0001760 3300048906 Bacteria 14119
452 Ga0496103_0198784 3300048906 Bacteria 1289
453 Ga0496103_0713400 3300048906 Bacteria 635
454 Ga0496106_0004423 3300048909 Bacteria 10413
455 Ga0496106_0341890 3300048909 Bacteria 1202
456 Ga0496107_0009192 3300048910 Bacteria 6850
457 Ga0496108_0193543 3300048911 Bacteria 1763
458 Ga0496109_0031421 3300048912 Bacteria 4765
459 Ga0496109_0086057 3300048912 Bacteria 2903
460 Ga0496110_0006989 3300048913 Bacteria 8979
461 Ga0496110_1353111 3300048913 Bacteria 621
462 Ga0496111_0005653 3300048914 Bacteria 8050
463 Ga0496112_0282422 3300048915 Bacteria 1607
464 Ga0496113_0067276 3300048916 Bacteria 2716
465 Ga0496113_0508446 3300048916 Bacteria 967
466 Ga0496114_0012638 3300048917 Bacteria 6763
467 Ga0496114_0031681 3300048917 Bacteria 4349
468 Ga0496114_0977211 3300048917 Bacteria 729
469 Ga0496119_0416767 3300048922 Bacteria 638
470 Ga0496124_0411641 3300048927 Bacteria 935
471 Ga0496126_0476839 3300048929 Bacteria 1000
472 Ga0496126_0705294 3300048929 Bacteria 784
473 Ga0495678_020964 3300049459 Bacteria 2885
474 Ga0501031_0008220 3300049568 Bacteria 6788
475 Ga0501032_0002053 3300049569 Bacteria 15906
476 Ga0501032_0027150 3300049569 Bacteria 3936
477 Ga0501034_0000010 3300049571 Bacteria 312213
478 Ga0501034_0019694 3300049571 Bacteria 6898
479 Ga0501034_0462180 3300049571 Bacteria 1186
480 Ga0501036_0006800 3300049572 Bacteria 9290
481 Ga0501036_0036621 3300049572 Bacteria 4152
482 Ga0501037_0010193 3300049573 Bacteria 6893
483 Ga0501037_0050621 3300049573 Bacteria 3040
484 Ga0501037_0410758 3300049573 Bacteria 927
485 Ga0501038_0002293 3300049574 Bacteria 17788
486 Ga0501038_0036709 3300049574 Bacteria 4300
487 Ga0501038_0091085 3300049574 Bacteria 2555
488 Ga0501038_0755995 3300049574 Bacteria 725
489 Ga0501040_0138496 3300049576 Bacteria 1713
490 Ga0501042_0020483 3300049578 Bacteria 4603
491 Ga0501042_0111474 3300049578 Bacteria 1970
492 Ga0501043_0078090 3300049579 Bacteria 2601
493 Ga0501043_0184844 3300049579 Bacteria 1623
494 Ga0501043_0225172 3300049579 Bacteria 1450
495 Ga0501046_0011580 3300049580 Bacteria 7541
496 Ga0501047_0011939 3300049581 Bacteria 8221
497 Ga0501047_0178099 3300049581 Bacteria 1993
498 Ga0501067_0236371 3300049583 Bacteria 1017
499 Ga0501068_0352415 3300049584 Bacteria 946
500 Ga0501069_0116060 3300049585 Bacteria 1527
501 Ga0501069_0263329 3300049585 Bacteria 1007
502 Ga0501070_0384506 3300049586 Bacteria 1137
503 Ga0501070_0944254 3300049586 Bacteria 671
504 Ga0501071_0031881 3300049587 Bacteria 3739
505 Ga0501072_0017795 3300049588 Bacteria 5465
506 Ga0501073_0045723 3300049589 Bacteria 3083
507 Ga0501074_0026846 3300049590 Bacteria 4174
508 Ga0501074_0030892 3300049590 Bacteria 3881
509 Ga0501074_0358682 3300049590 Bacteria 1034
510 Ga0501075_0015168 3300049591 Bacteria 5527
511 Ga0501076_0002407 3300049592 Bacteria 12816
512 Ga0501077_0006102 3300049593 Bacteria 7358
513 Ga0501079_0046602 3300049741 Bacteria 3345
514 Ga0501080_0749092 3300049742 Bacteria 859
515 Ga0501081_0256122 3300049743 Bacteria 1278
516 Ga0501035_0060884 3300049822 Bacteria 3361
517 Ga0501044_0001745 3300049823 Bacteria 25377
518 Ga0501044_0133003 3300049823 Bacteria 2480
519 Ga0501044_0240443 3300049823 Bacteria 1754
520 Ga0501045_0138440 3300049824 Bacteria 1810
521 Ga0501045_0358754 3300049824 Bacteria 1085
522 nmdc:mga03n38_368094_c1 3300050490 Bacteria 785
523 nmdc:mga00v17_569770_c1 3300050491 Bacteria 731
524 nmdc:mga0yw44_13973_c2 3300050492 Bacteria 3739
525 nmdc:mga0yw44_31518_c1 3300050492 Bacteria 3084
526 nmdc:mga0yw44_422688_c1 3300050492 Bacteria 902
527 nmdc:mga06z11_340815_c1 3300050494 Bacteria 896
528 nmdc:mga09592_1192697_c1 3300050508 Bacteria 629
529 Ga0495601_0003378 3300053077 Bacteria 9141
530 Ga0495601_0008679 3300053077 Bacteria 5996
531 Ga0495601_0134829 3300053077 Bacteria 1609
532 Ga0495612_0152715 3300053078 Bacteria 1005
533 Ga0495612_0161106 3300053078 Bacteria 979
534 Ga0500635_0320143 3300053080 Bacteria 613
535 Ga0495619_0106467 3300053085 Bacteria 1912
536 Ga0495619_0357437 3300053085 Bacteria 1010
537 Ga0495619_0671765 3300053085 Bacteria 705
538 Ga0500643_000496 3300053087 Bacteria 28282
539 Ga0500583_0056167 3300053092 Bacteria 1844
540 Ga0500640_004214 3300053095 Bacteria 5187
541 Ga0500650_0216956 3300053098 Bacteria 867
542 Ga0500654_110879 3300053099 Bacteria 1124
543 Ga0500660_049324 3300053100 Bacteria 2093
544 Ga0500660_218065 3300053100 Bacteria 632
545 Ga0500553_049642 3300053101 Bacteria 2017
546 Ga0500560_079176 3300053107 Bacteria 1090
547 Ga0500572_068892 3300053111 Bacteria 1089
548 Ga0500580_098264 3300053113 Bacteria 1156
549 Ga0500594_0101110 3300053118 Bacteria 887
550 Ga0500614_008180 3300053123 Bacteria 2215
551 Ga0500614_047749 3300053123 Bacteria 1113
552 Ga0500628_022473 3300053129 Bacteria 1290
553 Ga0500652_007570 3300053131 Bacteria 3563
554 Ga0500652_172101 3300053131 Bacteria 891
555 Ga0500658_0045652 3300053134 Bacteria 1771
556 Ga0500559_0012293 3300053136 Bacteria 3642
557 Ga0500561_0001430 3300053137 Bacteria 3872
558 Ga0500579_185584 3300053143 Bacteria 807
559 Ga0500600_0006942 3300053149 Bacteria 6783
560 Ga0500616_0239618 3300053153 Bacteria 780
561 Ga0500624_035669 3300053157 Bacteria 875
562 Ga0500633_0023775 3300053160 Bacteria 1895
563 Ga0500634_0145799 3300053161 Bacteria 1113
564 Ga0500636_0126421 3300053177 Bacteria 1429
565 Ga0500656_009012 3300053732 Bacteria 1067
566 Ga0500587_008183 3300053739 Bacteria 1348
567 Ga0501082_0290718 3300060353 Bacteria 1423
568 Ga0466962_0000456 3300061719 Bacteria 17753
569 Ga0466962_0004821 3300061719 Bacteria 6492
570 Ga0530510_0089856 3300061734 Bacteria 2240

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2808606439 2809194394 143
2 iso_pu_bacteria 2811994878 2812349153 143
3 3300041451 Ga0451791_1894528 Ga0451791_1894528_286_729 144
4 3300031456 Ga0307513_10412592 Ga0307513_104125921 145
5 3300036459 Ga0372808_007824 Ga0372808_007824_997_1437 145
6 3300041486 Ga0451807_1599420 Ga0451807_1599420_88_528 145
7 3300041512 Ga0451853_2470593 Ga0451853_2470593_1261_1701 145
8 3300041999 Ga0439433_0169911 Ga0439433_0169911_15_455 145
9 3300042131 Ga0450894_003861 Ga0450894_003861_804_1244 145
10 3300042134 Ga0450898_004651 Ga0450898_004651_900_1340 145
11 3300042135 Ga0450899_000631 Ga0450899_000631_1707_2147 145
12 3300042145 Ga0450906_002466 Ga0450906_002466_1634_2074 145
13 3300046660 Ga0495625_0146512 Ga0495625_0146512_18_455 145
14 3300047443 Ga0495687_202024 Ga0495687_202024_34_471 145
15 3300053099 Ga0500654_110879 Ga0500654_110879_669_1109 145
16 3300031456 Ga0307513_10001759 Ga0307513_1000175912 146
17 3300041496 Ga0451839_1472345 Ga0451839_1472345_345_785 146
18 3300031824 Ga0307413_10490735 Ga0307413_104907352 147
19 3300031852 Ga0307410_10418203 Ga0307410_104182032 147
20 3300031995 Ga0307409_100432462 Ga0307409_1004324622 147
21 3300032004 Ga0307414_10642025 Ga0307414_106420252 147
22 3300005367 Ga0070667_100343302 Ga0070667_1003433022 151
23 3300005548 Ga0070665_100004557 Ga0070665_1000045572 151
24 3300005841 Ga0068863_100009897 Ga0068863_1000098977 151
25 3300005843 Ga0068860_100059694 Ga0068860_1000596941 151
26 3300025986 Ga0207658_10723733 Ga0207658_107237332 151
27 3300026088 Ga0207641_10011017 Ga0207641_100110173 151
28 3300028379 Ga0268266_10028984 Ga0268266_100289843 151
29 3300028381 Ga0268264_10023396 Ga0268264_100233963 151
30 3300035089 Ga0373944_0207041 Ga0373944_0207041_14_472 152
31 3300035171 Ga0373946_0639991 Ga0373946_0639991_15_473 152
32 3300035692 Ga0373935_0094401 Ga0373935_0094401_1281_1739 152
33 3300035695 Ga0373927_0367561 Ga0373927_0367561_178_636 152
34 3300035725 Ga0373947_0231310 Ga0373947_0231310_12_470 152
35 3300046455 Ga0495603_0044785 Ga0495603_0044785_1958_2416 152
36 3300046475 Ga0495639_0479176 Ga0495639_0479176_115_573 152
37 3300046492 Ga0495585_0038237 Ga0495585_0038237_1837_2295 152
38 3300046533 Ga0495640_0085571 Ga0495640_0085571_1535_1993 152
39 3300046557 Ga0495622_0331474 Ga0495622_0331474_155_613 152
40 3300046615 Ga0495656_0579823 Ga0495656_0579823_108_566 152
41 3300046642 Ga0495634_0028711 Ga0495634_0028711_3269_3727 152
42 3300046681 Ga0495647_0115978 Ga0495647_0115978_274_732 152
43 3300046683 Ga0495658_0488742 Ga0495658_0488742_231_689 152
44 3300046691 Ga0495670_0047588 Ga0495670_0047588_282_740 152
45 3300047321 Ga0495676_0088834 Ga0495676_0088834_391_858 152
46 3300053077 Ga0495601_0134829 Ga0495601_0134829_19_486 152
47 3300053085 Ga0495619_0671765 Ga0495619_0671765_47_505 152
48 3300032002 Ga0307416_100777901 Ga0307416_1007779012 153
49 3300041498 Ga0451841_0364791 Ga0451841_0364791_205_672 153
50 3300046454 Ga0495592_0041342 Ga0495592_0041342_624_1109 155
51 3300046462 Ga0495651_0000674 Ga0495651_0000674_11461_11946 155
52 3300046477 Ga0495664_0143593 Ga0495664_0143593_100_585 155
53 3300046511 Ga0495608_0289874 Ga0495608_0289874_346_831 155
54 3300046529 Ga0495652_0014703 Ga0495652_0014703_4135_4620 155
55 3300046536 Ga0495587_0498333 Ga0495587_0498333_169_654 155
56 3300046679 Ga0495623_0036279 Ga0495623_0036279_1403_1888 155
57 3300048088 Ga0495602_0120454 Ga0495602_0120454_460_945 155
58 3300053085 Ga0495619_0106467 Ga0495619_0106467_514_999 155
59 iso_pu_bacteria 2537561592 2537900626 156
60 iso_pu_bacteria 2643221567 2643851548 156
61 iso_pu_bacteria 2643221624 2644137862 156
62 iso_pu_bacteria 2751185782 2753263029 156
63 iso_pu_bacteria 2791355406 2793981647 156
64 iso_pu_bacteria 2808606365 2808872646 156
65 iso_pu_bacteria 2844849076 2844850332 156
66 iso_pu_bacteria 2857740372 2857744080 156
67 iso_pu_bacteria 2904497146 2904498890 156
68 iso_pu_bacteria 2904776348 2904780163 156
69 iso_pu_bacteria 2910809715 2910809911 156
70 iso_pu_bacteria 2919034639 2919036783 156
71 iso_pu_bacteria 2919059106 2919061148 156
72 iso_pu_bacteria 2919446982 2919448957 156
73 iso_pu_bacteria 2919538618 2919541553 156
74 iso_pu_bacteria 2932426870 2932429657 156
75 iso_pu_bacteria 2933418574 2933420374 156
76 iso_pu_bacteria 2939647034 2939649801 156
77 iso_pu_bacteria 2939674588 2939677832 156
78 iso_pu_bacteria 2945941187 2945943488 156
79 iso_pu_bacteria 2953998280 2954000578 156
80 iso_pu_bacteria 2984576629 2984579389 156
81 iso_pu_bacteria 2990256926 2990256999 156
82 iso_pu_bacteria 8047893842 8047900905 156
83 iso_pu_bacteria 8048127548 8048134340 156
84 iso_pu_bacteria 8048356638 8048357997 156
85 iso_pu_bacteria 8048369669 8048377847 156
86 iso_pu_bacteria 8048379754 8048386945 156
87 3300005329 Ga0070683_100174604 Ga0070683_1001746042 158
88 3300005530 Ga0070679_100302946 Ga0070679_1003029462 158
89 3300005577 Ga0068857_100296446 Ga0068857_1002964462 158
90 3300020081 Ga0206354_10930448 Ga0206354_109304483 158
91 3300020082 Ga0206353_10810260 Ga0206353_108102604 158
92 3300020082 Ga0206353_11389892 Ga0206353_113898925 158
93 3300022467 Ga0224712_10543283 Ga0224712_105432831 158
94 3300022467 Ga0224712_10581953 Ga0224712_105819531 158
95 3300025944 Ga0207661_10107146 Ga0207661_101071463 158
96 3300026116 Ga0207674_10137627 Ga0207674_101376273 158
97 3300026116 Ga0207674_10515595 Ga0207674_105155952 158
98 3300046535 Ga0495586_0475278 Ga0495586_0475278_172_648 158
99 3300048903 Ga0496100_0058765 Ga0496100_0058765_260_736 158
100 3300048903 Ga0496100_0170779 Ga0496100_0170779_75_551 158
101 3300048904 Ga0496101_0104490 Ga0496101_0104490_1139_1615 158
102 3300048905 Ga0496102_0004390 Ga0496102_0004390_4931_5407 158
103 3300048905 Ga0496102_0129463 Ga0496102_0129463_1220_1696 158
104 3300048906 Ga0496103_0198784 Ga0496103_0198784_675_1151 158
105 3300048906 Ga0496103_0713400 Ga0496103_0713400_25_501 158
106 3300048917 Ga0496114_0012638 Ga0496114_0012638_996_1472 158
107 3300048917 Ga0496114_0031681 Ga0496114_0031681_2883_3359 158
108 3300053085 Ga0495619_0357437 Ga0495619_0357437_64_540 158
109 iso_pu_bacteria 2844849076 2844850328 158
110 iso_pu_bacteria 2904770941 2904772465 158
111 iso_pu_bacteria 2908811453 2908816371 158
112 3300031548 Ga0307408_100550253 Ga0307408_1005502532 159
113 3300031903 Ga0307407_10347239 Ga0307407_103472392 159
114 3300037068 Ga0373925_0000020 Ga0373925_0000020_23583_24065 159
115 3300046530 Ga0495654_0203538 Ga0495654_0203538_41_520 159
116 3300046558 Ga0495633_0030830 Ga0495633_0030830_657_1136 159
117 3300046615 Ga0495656_0006202 Ga0495656_0006202_881_1360 159
118 3300046664 Ga0495659_0425464 Ga0495659_0425464_22_501 159
119 3300046665 Ga0495661_0222679 Ga0495661_0222679_298_777 159
120 3300046691 Ga0495670_0002884 Ga0495670_0002884_3760_4239 159
121 3300046809 Ga0495600_0087587 Ga0495600_0087587_939_1418 159
122 3300047315 Ga0495581_0018083 Ga0495581_0018083_1397_1876 159
123 3300047318 Ga0495636_0011022 Ga0495636_0011022_811_1290 159
124 3300047444 Ga0495675_0131756 Ga0495675_0131756_34_513 159
125 3300047445 Ga0495677_0072206 Ga0495677_0072206_700_1179 159
126 3300048922 Ga0496119_0416767 Ga0496119_0416767_52_531 159
127 3300049573 Ga0501037_0410758 Ga0501037_0410758_41_529 159
128 3300049574 Ga0501038_0036709 Ga0501038_0036709_3713_4201 159
129 3300049579 Ga0501043_0184844 Ga0501043_0184844_528_1016 159
130 3300049580 Ga0501046_0011580 Ga0501046_0011580_3450_3938 159
131 3300049581 Ga0501047_0178099 Ga0501047_0178099_367_855 159
132 3300049586 Ga0501070_0944254 Ga0501070_0944254_134_622 159
133 3300049590 Ga0501074_0358682 Ga0501074_0358682_462_950 159
134 3300049823 Ga0501044_0240443 Ga0501044_0240443_417_905 159
135 3300049824 Ga0501045_0358754 Ga0501045_0358754_529_1017 159
136 3300002774 JGI25150J39212_1029224 JGI25150J39212_10292241 160
137 3300005329 Ga0070683_100242135 Ga0070683_1002421352 160
138 3300005329 Ga0070683_100580054 Ga0070683_1005800542 160
139 3300005334 Ga0068869_100308701 Ga0068869_1003087013 160
140 3300005337 Ga0070682_100461973 Ga0070682_1004619732 160
141 3300005339 Ga0070660_100037991 Ga0070660_1000379914 160
142 3300005341 Ga0070691_10130119 Ga0070691_101301192 160
143 3300005345 Ga0070692_10141289 Ga0070692_101412892 160
144 3300005347 Ga0070668_100323191 Ga0070668_1003231912 160
145 3300005366 Ga0070659_100596673 Ga0070659_1005966731 160
146 3300005366 Ga0070659_100735480 Ga0070659_1007354801 160
147 3300005367 Ga0070667_100855337 Ga0070667_1008553371 160
148 3300005435 Ga0070714_100076873 Ga0070714_1000768733 160
149 3300005435 Ga0070714_101000304 Ga0070714_1010003041 160
150 3300005435 Ga0070714_101150871 Ga0070714_1011508711 160
151 3300005436 Ga0070713_100074966 Ga0070713_1000749663 160
152 3300005436 Ga0070713_100159142 Ga0070713_1001591423 160
153 3300005436 Ga0070713_100161154 Ga0070713_1001611543 160
154 3300005439 Ga0070711_100023630 Ga0070711_1000236303 160
155 3300005440 Ga0070705_100266913 Ga0070705_1002669132 160
156 3300005455 Ga0070663_100426276 Ga0070663_1004262762 160
157 3300005456 Ga0070678_100194885 Ga0070678_1001948852 160
158 3300005458 Ga0070681_10274417 Ga0070681_102744172 160
159 3300005466 Ga0070685_11008424 Ga0070685_110084241 160
160 3300005530 Ga0070679_100087791 Ga0070679_1000877912 160
161 3300005535 Ga0070684_100057683 Ga0070684_1000576832 160
162 3300005539 Ga0068853_101106018 Ga0068853_1011060182 160
163 3300005543 Ga0070672_100146234 Ga0070672_1001462342 160
164 3300005548 Ga0070665_100185865 Ga0070665_1001858655 160
165 3300005577 Ga0068857_101022637 Ga0068857_1010226372 160
166 3300005614 Ga0068856_100652551 Ga0068856_1006525512 160
167 3300005614 Ga0068856_100784321 Ga0068856_1007843212 160
168 3300005616 Ga0068852_100199521 Ga0068852_1001995213 160
169 3300005618 Ga0068864_100813784 Ga0068864_1008137842 160
170 3300005841 Ga0068863_100957606 Ga0068863_1009576062 160
171 3300005842 Ga0068858_100034983 Ga0068858_1000349832 160
172 3300005842 Ga0068858_100934096 Ga0068858_1009340962 160
173 3300005843 Ga0068860_100014727 Ga0068860_1000147276 160
174 3300005844 Ga0068862_100041865 Ga0068862_1000418653 160
175 3300006038 Ga0075365_10031285 Ga0075365_100312853 160
176 3300006038 Ga0075365_10109934 Ga0075365_101099342 160
177 3300006048 Ga0075363_100626938 Ga0075363_1006269381 160
178 3300006051 Ga0075364_10467837 Ga0075364_104678372 160
179 3300006175 Ga0070712_101366458 Ga0070712_1013664581 160
180 3300006177 Ga0075362_10239170 Ga0075362_102391702 160
181 3300006178 Ga0075367_10667759 Ga0075367_106677592 160
182 3300006353 Ga0075370_10251202 Ga0075370_102512022 160
183 3300009036 Ga0105244_10010864 Ga0105244_100108642 160
184 3300009036 Ga0105244_10081604 Ga0105244_100816042 160
185 3300009101 Ga0105247_10631990 Ga0105247_106319902 160
186 3300009148 Ga0105243_10051988 Ga0105243_100519883 160
187 3300009148 Ga0105243_10587321 Ga0105243_105873212 160
188 3300011119 Ga0105246_10007977 Ga0105246_100079774 160
189 3300013104 Ga0157370_10038015 Ga0157370_100380154 160
190 3300013105 Ga0157369_10095681 Ga0157369_100956813 160
191 3300013105 Ga0157369_10974848 Ga0157369_109748482 160
192 3300013297 Ga0157378_10372226 Ga0157378_103722262 160
193 3300013306 Ga0163162_10001793 Ga0163162_1000179313 160
194 3300013307 Ga0157372_10837259 Ga0157372_108372592 160
195 3300013308 Ga0157375_10003423 Ga0157375_100034236 160
196 3300013308 Ga0157375_10096747 Ga0157375_100967473 160
197 3300013308 Ga0157375_10343357 Ga0157375_103433572 160
198 3300014325 Ga0163163_10721910 Ga0163163_107219102 160
199 3300014497 Ga0182008_10246706 Ga0182008_102467062 160
200 3300014968 Ga0157379_10287071 Ga0157379_102870713 160
201 3300014969 Ga0157376_11502449 Ga0157376_115024491 160
202 3300020070 Ga0206356_11465510 Ga0206356_114655102 160
203 3300020075 Ga0206349_1507694 Ga0206349_15076941 160
204 3300020077 Ga0206351_10576349 Ga0206351_105763492 160
205 3300020077 Ga0206351_10691340 Ga0206351_106913402 160
206 3300020080 Ga0206350_10127885 Ga0206350_101278852 160
207 3300020080 Ga0206350_10383883 Ga0206350_103838833 160
208 3300020082 Ga0206353_11094702 Ga0206353_110947022 160
209 3300021388 Ga0213875_10157203 Ga0213875_101572032 160
210 3300022467 Ga0224712_10047789 Ga0224712_100477891 160
211 3300022467 Ga0224712_10176069 Ga0224712_101760692 160
212 3300022467 Ga0224712_10421740 Ga0224712_104217402 160
213 3300025245 Ga0207425_1016965 Ga0207425_10169652 160
214 3300025258 Ga0209129_1000064 Ga0209129_1000064191 160
215 3300025294 Ga0209025_1001863 Ga0209025_100186312 160
216 3300025303 Ga0209051_1008018 Ga0209051_10080184 160
217 3300025315 Ga0207697_10007253 Ga0207697_100072533 160
218 3300025728 Ga0207655_1006782 Ga0207655_100678210 160
219 3300025728 Ga0207655_1027211 Ga0207655_10272112 160
220 3300025893 Ga0207682_10196894 Ga0207682_101968942 160
221 3300025909 Ga0207705_10189253 Ga0207705_101892533 160
222 3300025912 Ga0207707_10003354 Ga0207707_1000335414 160
223 3300025915 Ga0207693_10416856 Ga0207693_104168562 160
224 3300025916 Ga0207663_10223726 Ga0207663_102237262 160
225 3300025917 Ga0207660_10146096 Ga0207660_101460963 160
226 3300025918 Ga0207662_11005040 Ga0207662_110050401 160
227 3300025919 Ga0207657_10014957 Ga0207657_100149575 160
228 3300025924 Ga0207694_10701115 Ga0207694_107011152 160
229 3300025925 Ga0207650_10250447 Ga0207650_102504472 160
230 3300025925 Ga0207650_11055201 Ga0207650_110552011 160
231 3300025928 Ga0207700_10301398 Ga0207700_103013982 160
232 3300025928 Ga0207700_10440054 Ga0207700_104400542 160
233 3300025928 Ga0207700_10918844 Ga0207700_109188442 160
234 3300025929 Ga0207664_10009672 Ga0207664_100096723 160
235 3300025929 Ga0207664_10513526 Ga0207664_105135262 160
236 3300025931 Ga0207644_10442454 Ga0207644_104424542 160
237 3300025935 Ga0207709_10017656 Ga0207709_100176563 160
238 3300025935 Ga0207709_10282833 Ga0207709_102828331 160
239 3300025935 Ga0207709_10421256 Ga0207709_104212562 160
240 3300025939 Ga0207665_10390811 Ga0207665_103908112 160
241 3300025940 Ga0207691_10738593 Ga0207691_107385932 160
242 3300025942 Ga0207689_10223220 Ga0207689_102232202 160
243 3300025942 Ga0207689_10275526 Ga0207689_102755262 160
244 3300025944 Ga0207661_10059663 Ga0207661_100596633 160
245 3300025944 Ga0207661_10117885 Ga0207661_101178852 160
246 3300025972 Ga0207668_10296193 Ga0207668_102961932 160
247 3300026023 Ga0207677_11021489 Ga0207677_110214892 160
248 3300026035 Ga0207703_10149443 Ga0207703_101494432 160
249 3300026035 Ga0207703_10222658 Ga0207703_102226582 160
250 3300026067 Ga0207678_10028639 Ga0207678_100286394 160
251 3300026075 Ga0207708_10258750 Ga0207708_102587502 160
252 3300026088 Ga0207641_10882114 Ga0207641_108821141 160
253 3300026095 Ga0207676_10440793 Ga0207676_104407932 160
254 3300026116 Ga0207674_10121337 Ga0207674_101213371 160
255 3300026118 Ga0207675_100669535 Ga0207675_1006695352 160
256 3300026121 Ga0207683_10282289 Ga0207683_102822892 160
257 3300026121 Ga0207683_10728980 Ga0207683_107289801 160
258 3300026142 Ga0207698_10963328 Ga0207698_109633282 160
259 3300028379 Ga0268266_11332569 Ga0268266_113325691 160
260 3300028381 Ga0268264_10008739 Ga0268264_100087395 160
261 3300028786 Ga0307517_10001880 Ga0307517_100018804 160
262 3300028786 Ga0307517_10044397 Ga0307517_100443974 160
263 3300028794 Ga0307515_10000025 Ga0307515_1000002529 160
264 3300028794 Ga0307515_10051743 Ga0307515_100517432 160
265 3300028794 Ga0307515_10440936 Ga0307515_104409361 160
266 3300030521 Ga0307511_10018885 Ga0307511_100188854 160
267 3300030521 Ga0307511_10056542 Ga0307511_100565422 160
268 3300030522 Ga0307512_10001507 Ga0307512_100015077 160
269 3300030522 Ga0307512_10043743 Ga0307512_100437433 160
270 3300030733 Ga0314311_1250029 Ga0314311_12500292 160
271 3300031456 Ga0307513_10031957 Ga0307513_100319575 160
272 3300031456 Ga0307513_10377710 Ga0307513_103777102 160
273 3300031507 Ga0307509_10008111 Ga0307509_1000811112 160
274 3300031507 Ga0307509_10028028 Ga0307509_100280284 160
275 3300031507 Ga0307509_10094899 Ga0307509_100948993 160
276 3300031507 Ga0307509_10134928 Ga0307509_101349283 160
277 3300031507 Ga0307509_10475373 Ga0307509_104753732 160
278 3300031548 Ga0307408_100049738 Ga0307408_1000497384 160
279 3300031548 Ga0307408_100149859 Ga0307408_1001498592 160
280 3300031616 Ga0307508_10001011 Ga0307508_1000101119 160
281 3300031616 Ga0307508_10015571 Ga0307508_100155712 160
282 3300031616 Ga0307508_10023926 Ga0307508_100239264 160
283 3300031616 Ga0307508_10219990 Ga0307508_102199902 160
284 3300031616 Ga0307508_10281724 Ga0307508_102817242 160
285 3300031616 Ga0307508_10294367 Ga0307508_102943672 160
286 3300031649 Ga0307514_10033517 Ga0307514_100335174 160
287 3300031649 Ga0307514_10168116 Ga0307514_101681162 160
288 3300031730 Ga0307516_10127664 Ga0307516_101276642 160
289 3300031730 Ga0307516_10555602 Ga0307516_105556022 160
290 3300031731 Ga0307405_10117468 Ga0307405_101174683 160
291 3300031731 Ga0307405_10120417 Ga0307405_101204172 160
292 3300031731 Ga0307405_10474426 Ga0307405_104744262 160
293 3300031824 Ga0307413_10007847 Ga0307413_100078474 160
294 3300031824 Ga0307413_10011632 Ga0307413_100116325 160
295 3300031824 Ga0307413_10104925 Ga0307413_101049253 160
296 3300031824 Ga0307413_10517325 Ga0307413_105173252 160
297 3300031838 Ga0307518_10131071 Ga0307518_101310713 160
298 3300031838 Ga0307518_10501790 Ga0307518_105017901 160
299 3300031852 Ga0307410_10062549 Ga0307410_100625493 160
300 3300031852 Ga0307410_10153056 Ga0307410_101530562 160
301 3300031852 Ga0307410_10236863 Ga0307410_102368632 160
302 3300031852 Ga0307410_11379190 Ga0307410_113791901 160
303 3300031901 Ga0307406_10096832 Ga0307406_100968322 160
304 3300031901 Ga0307406_10107911 Ga0307406_101079112 160
305 3300031901 Ga0307406_10175115 Ga0307406_101751152 160
306 3300031903 Ga0307407_10029246 Ga0307407_100292463 160
307 3300031903 Ga0307407_10088405 Ga0307407_100884053 160
308 3300031903 Ga0307407_10188967 Ga0307407_101889672 160
309 3300031911 Ga0307412_10036474 Ga0307412_100364744 160
310 3300031911 Ga0307412_10052656 Ga0307412_100526563 160
311 3300031911 Ga0307412_10247102 Ga0307412_102471022 160
312 3300031911 Ga0307412_11766147 Ga0307412_117661471 160
313 3300031995 Ga0307409_100405748 Ga0307409_1004057482 160
314 3300031995 Ga0307409_100505859 Ga0307409_1005058592 160
315 3300031995 Ga0307409_100696679 Ga0307409_1006966792 160
316 3300031995 Ga0307409_100899749 Ga0307409_1008997492 160
317 3300032002 Ga0307416_100000832 Ga0307416_1000008322 160
318 3300032002 Ga0307416_100006456 Ga0307416_1000064564 160
319 3300032002 Ga0307416_100114994 Ga0307416_1001149942 160
320 3300032002 Ga0307416_100569760 Ga0307416_1005697602 160
321 3300032002 Ga0307416_102819869 Ga0307416_1028198691 160
322 3300032004 Ga0307414_10715165 Ga0307414_107151652 160
323 3300032005 Ga0307411_10481816 Ga0307411_104818162 160
324 3300032005 Ga0307411_11641733 Ga0307411_116417331 160
325 3300032126 Ga0307415_100060643 Ga0307415_1000606432 160
326 3300033179 Ga0307507_10000084 Ga0307507_10000084120 160
327 3300033179 Ga0307507_10010281 Ga0307507_1001028110 160
328 3300033179 Ga0307507_10079522 Ga0307507_100795222 160
329 3300033180 Ga0307510_10003046 Ga0307510_1000304611 160
330 3300033180 Ga0307510_10131082 Ga0307510_101310823 160
331 3300035692 Ga0373935_0002713 Ga0373935_0002713_2989_3471 160
332 3300036401 Ga0373937_0328745 Ga0373937_0328745_752_1273 160
333 3300036459 Ga0372808_033818 Ga0372808_033818_206_691 160
334 3300037068 Ga0373925_1181425 Ga0373925_1181425_89_571 160
335 3300037466 Ga0395898_0039482 Ga0395898_0039482_2941_3426 160
336 3300037466 Ga0395898_0099398 Ga0395898_0099398_570_1055 160
337 3300037466 Ga0395898_0449634 Ga0395898_0449634_459_944 160
338 3300037466 Ga0395898_0529183 Ga0395898_0529183_573_1055 160
339 3300037471 Ga0395905_0049729 Ga0395905_0049729_1000_1485 160
340 3300037853 Ga0436364_1132424 Ga0436364_1132424_201_686 160
341 3300038443 Ga0395901_0036661 Ga0395901_0036661_1815_2300 160
342 3300038443 Ga0395901_0089453 Ga0395901_0089453_2004_2489 160
343 3300038443 Ga0395901_0098258 Ga0395901_0098258_721_1206 160
344 3300038443 Ga0395901_0467140 Ga0395901_0467140_60_542 160
345 3300041460 Ga0451802_0443385 Ga0451802_0443385_133_615 160
346 3300041492 Ga0451835_0666825 Ga0451835_0666825_994_1476 160
347 3300041494 Ga0451837_1735119 Ga0451837_1735119_678_1160 160
348 3300041501 Ga0451845_0797742 Ga0451845_0797742_252_734 160
349 3300041503 Ga0451847_0520032 Ga0451847_0520032_114_596 160
350 3300041512 Ga0451853_3963956 Ga0451853_3963956_1079_1561 160
351 3300044656 Ga0466969_0000705 Ga0466969_0000705_3585_4067 160
352 3300044658 Ga0466972_0052361 Ga0466972_0052361_1093_1575 160
353 3300044658 Ga0466972_0144323 Ga0466972_0144323_153_638 160
354 3300044683 Ga0466965_0003253 Ga0466965_0003253_2449_2931 160
355 3300044683 Ga0466965_0385078 Ga0466965_0385078_266_751 160
356 3300044684 Ga0466966_0041873 Ga0466966_0041873_175_657 160
357 3300044684 Ga0466966_0053708 Ga0466966_0053708_96_581 160
358 3300044693 Ga0466961_0003833 Ga0466961_0003833_94_576 160
359 3300044693 Ga0466961_0045642 Ga0466961_0045642_27_512 160
360 3300044694 Ga0466963_0008224 Ga0466963_0008224_4928_5413 160
361 3300044706 Ga0466964_0286976 Ga0466964_0286976_85_570 160
362 3300044719 Ga0466971_0002406 Ga0466971_0002406_330_812 160
363 3300044719 Ga0466971_0012310 Ga0466971_0012310_2884_3369 160
364 3300044735 Ga0466968_0075918 Ga0466968_0075918_589_1071 160
365 3300044765 Ga0466970_0254431 Ga0466970_0254431_128_613 160
366 3300044901 Ga0466960_0067546 Ga0466960_0067546_450_935 160
367 3300044901 Ga0466960_0123442 Ga0466960_0123442_154_639 160
368 3300045049 Ga0466959_0004161 Ga0466959_0004161_8990_9472 160
369 3300045049 Ga0466959_0097056 Ga0466959_0097056_899_1384 160
370 3300045049 Ga0466959_0620223 Ga0466959_0620223_24_506 160
371 3300045836 Ga0466958_0236527 Ga0466958_0236527_99_584 160
372 3300045976 Ga0466967_0046461 Ga0466967_0046461_1353_1838 160
373 3300046452 Ga0495617_005542 Ga0495617_005542_1166_1648 160
374 3300046454 Ga0495592_0021090 Ga0495592_0021090_2986_3471 160
375 3300046455 Ga0495603_0004604 Ga0495603_0004604_6021_6503 160
376 3300046459 Ga0495629_0003536 Ga0495629_0003536_6624_7109 160
377 3300046459 Ga0495629_0014302 Ga0495629_0014302_4784_5266 160
378 3300046459 Ga0495629_0053055 Ga0495629_0053055_2041_2526 160
379 3300046459 Ga0495629_0195378 Ga0495629_0195378_649_1134 160
380 3300046460 Ga0495638_0131209 Ga0495638_0131209_930_1415 160
381 3300046460 Ga0495638_0266274 Ga0495638_0266274_194_676 160
382 3300046462 Ga0495651_0009009 Ga0495651_0009009_1848_2333 160
383 3300046463 Ga0495653_0065156 Ga0495653_0065156_1345_1830 160
384 3300046472 Ga0495580_0969978 Ga0495580_0969978_17_499 160
385 3300046473 Ga0495582_0035749 Ga0495582_0035749_889_1374 160
386 3300046474 Ga0495605_0013236 Ga0495605_0013236_1211_1693 160
387 3300046476 Ga0495662_0004188 Ga0495662_0004188_1956_2441 160
388 3300046477 Ga0495664_0003414 Ga0495664_0003414_6578_7063 160
389 3300046491 Ga0495584_0307007 Ga0495584_0307007_295_777 160
390 3300046499 Ga0495594_0064243 Ga0495594_0064243_161_643 160
391 3300046499 Ga0495594_0113872 Ga0495594_0113872_285_770 160
392 3300046499 Ga0495594_0282581 Ga0495594_0282581_12_497 160
393 3300046500 Ga0495596_0008135 Ga0495596_0008135_941_1423 160
394 3300046501 Ga0495607_0029983 Ga0495607_0029983_188_670 160
395 3300046506 Ga0495583_0148526 Ga0495583_0148526_269_751 160
396 3300046507 Ga0495606_0019954 Ga0495606_0019954_317_799 160
397 3300046512 Ga0495610_0015879 Ga0495610_0015879_2145_2627 160
398 3300046513 Ga0495616_0030674 Ga0495616_0030674_864_1346 160
399 3300046514 Ga0495618_0039130 Ga0495618_0039130_1113_1598 160
400 3300046515 Ga0495620_0047630 Ga0495620_0047630_703_1185 160
401 3300046516 Ga0495628_0027386 Ga0495628_0027386_929_1414 160
402 3300046516 Ga0495628_0045346 Ga0495628_0045346_2903_3388 160
403 3300046516 Ga0495628_0066066 Ga0495628_0066066_2165_2647 160
404 3300046517 Ga0495630_0269327 Ga0495630_0269327_445_930 160
405 3300046518 Ga0495631_0004942 Ga0495631_0004942_4282_4764 160
406 3300046519 Ga0495632_0052963 Ga0495632_0052963_945_1430 160
407 3300046519 Ga0495632_0239544 Ga0495632_0239544_47_529 160
408 3300046520 Ga0495637_0040125 Ga0495637_0040125_99_581 160
409 3300046520 Ga0495637_0076345 Ga0495637_0076345_275_760 160
410 3300046522 Ga0495643_0002386 Ga0495643_0002386_10602_11087 160
411 3300046522 Ga0495643_0182413 Ga0495643_0182413_188_673 160
412 3300046526 Ga0495666_0006190 Ga0495666_0006190_4449_4931 160
413 3300046529 Ga0495652_0509251 Ga0495652_0509251_44_529 160
414 3300046530 Ga0495654_0025934 Ga0495654_0025934_1522_2004 160
415 3300046533 Ga0495640_0220603 Ga0495640_0220603_549_1031 160
416 3300046535 Ga0495586_0035865 Ga0495586_0035865_1848_2333 160
417 3300046535 Ga0495586_0159896 Ga0495586_0159896_101_586 160
418 3300046536 Ga0495587_0004886 Ga0495587_0004886_1230_1715 160
419 3300046542 Ga0495597_0017671 Ga0495597_0017671_2552_3034 160
420 3300046543 Ga0495645_0035305 Ga0495645_0035305_2017_2502 160
421 3300046557 Ga0495622_0002284 Ga0495622_0002284_5318_5800 160
422 3300046558 Ga0495633_0050793 Ga0495633_0050793_44_529 160
423 3300046558 Ga0495633_0053018 Ga0495633_0053018_984_1466 160
424 3300046615 Ga0495656_0520726 Ga0495656_0520726_98_580 160
425 3300046616 Ga0495668_0052802 Ga0495668_0052802_445_927 160
426 3300046642 Ga0495634_0002275 Ga0495634_0002275_14543_15028 160
427 3300046642 Ga0495634_0022620 Ga0495634_0022620_3631_4113 160
428 3300046642 Ga0495634_0516719 Ga0495634_0516719_27_512 160
429 3300046648 Ga0495611_0023684 Ga0495611_0023684_1152_1634 160
430 3300046660 Ga0495625_0015228 Ga0495625_0015228_4947_5429 160
431 3300046663 Ga0495635_0002001 Ga0495635_0002001_2592_3077 160
432 3300046663 Ga0495635_0005416 Ga0495635_0005416_3574_4059 160
433 3300046663 Ga0495635_0198720 Ga0495635_0198720_552_1037 160
434 3300046665 Ga0495661_0049053 Ga0495661_0049053_1619_2101 160
435 3300046674 Ga0495588_0483829 Ga0495588_0483829_58_540 160
436 3300046675 Ga0495657_0005197 Ga0495657_0005197_6630_7115 160
437 3300046678 Ga0495599_0086238 Ga0495599_0086238_639_1121 160
438 3300046680 Ga0495646_0001460 Ga0495646_0001460_11239_11724 160
439 3300046683 Ga0495658_0141924 Ga0495658_0141924_256_741 160
440 3300046689 Ga0495613_0000475 Ga0495613_0000475_5205_5690 160
441 3300046689 Ga0495613_0175061 Ga0495613_0175061_434_916 160
442 3300046689 Ga0495613_0205860 Ga0495613_0205860_172_657 160
443 3300046690 Ga0495624_0009902 Ga0495624_0009902_3385_3867 160
444 3300046690 Ga0495624_0209120 Ga0495624_0209120_289_774 160
445 3300046691 Ga0495670_0102431 Ga0495670_0102431_474_959 160
446 3300046691 Ga0495670_0207423 Ga0495670_0207423_319_801 160
447 3300046692 Ga0495671_0039411 Ga0495671_0039411_239_724 160
448 3300046692 Ga0495671_0280754 Ga0495671_0280754_12_497 160
449 3300046694 Ga0495649_0072714 Ga0495649_0072714_842_1324 160
450 3300046794 Ga0495589_0018175 Ga0495589_0018175_182_664 160
451 3300046794 Ga0495589_0109410 Ga0495589_0109410_326_811 160
452 3300046809 Ga0495600_0015613 Ga0495600_0015613_1531_2016 160
453 3300046809 Ga0495600_0016644 Ga0495600_0016644_3133_3618 160
454 3300046810 Ga0495660_0022038 Ga0495660_0022038_531_1013 160
455 3300047315 Ga0495581_0004899 Ga0495581_0004899_1088_1573 160
456 3300047315 Ga0495581_0207111 Ga0495581_0207111_408_893 160
457 3300047317 Ga0495604_0000213 Ga0495604_0000213_13843_14328 160
458 3300047318 Ga0495636_0026045 Ga0495636_0026045_515_997 160
459 3300047318 Ga0495636_0118999 Ga0495636_0118999_222_707 160
460 3300047321 Ga0495676_0009406 Ga0495676_0009406_6598_7080 160
461 3300047321 Ga0495676_0022814 Ga0495676_0022814_2761_3246 160
462 3300047323 Ga0495683_0143025 Ga0495683_0143025_464_949 160
463 3300047443 Ga0495687_000466 Ga0495687_000466_18616_19101 160
464 3300047443 Ga0495687_015559 Ga0495687_015559_1334_1819 160
465 3300047443 Ga0495687_157226 Ga0495687_157226_269_751 160
466 3300047444 Ga0495675_0350327 Ga0495675_0350327_339_824 160
467 3300047445 Ga0495677_0093759 Ga0495677_0093759_581_1066 160
468 3300047446 Ga0495679_028981 Ga0495679_028981_840_1325 160
469 3300047447 Ga0495685_025644 Ga0495685_025644_753_1238 160
470 3300047447 Ga0495685_028398 Ga0495685_028398_444_926 160
471 3300047470 Ga0495681_0009898 Ga0495681_0009898_535_1020 160
472 3300047470 Ga0495681_0033993 Ga0495681_0033993_1727_2209 160
473 3300047472 Ga0495686_0047417 Ga0495686_0047417_1824_2309 160
474 3300047472 Ga0495686_0161562 Ga0495686_0161562_583_1065 160
475 3300047673 Ga0495593_0004809 Ga0495593_0004809_2067_2552 160
476 3300047673 Ga0495593_0194898 Ga0495593_0194898_511_996 160
477 3300048088 Ga0495602_0023315 Ga0495602_0023315_5239_5724 160
478 3300048089 Ga0495614_0005924 Ga0495614_0005924_2422_2907 160
479 3300048089 Ga0495614_0005960 Ga0495614_0005960_3446_3931 160
480 3300048089 Ga0495614_0046047 Ga0495614_0046047_576_1058 160
481 3300048091 Ga0495626_0014942 Ga0495626_0014942_1303_1785 160
482 3300048903 Ga0496100_0002031 Ga0496100_0002031_5523_6005 160
483 3300048905 Ga0496102_0571971 Ga0496102_0571971_353_838 160
484 3300048905 Ga0496102_0914537 Ga0496102_0914537_70_555 160
485 3300048906 Ga0496103_0001760 Ga0496103_0001760_7907_8389 160
486 3300048909 Ga0496106_0004423 Ga0496106_0004423_5668_6150 160
487 3300048909 Ga0496106_0341890 Ga0496106_0341890_296_781 160
488 3300048910 Ga0496107_0009192 Ga0496107_0009192_2042_2524 160
489 3300048911 Ga0496108_0193543 Ga0496108_0193543_859_1341 160
490 3300048912 Ga0496109_0031421 Ga0496109_0031421_2360_2842 160
491 3300048912 Ga0496109_0086057 Ga0496109_0086057_673_1158 160
492 3300048913 Ga0496110_0006989 Ga0496110_0006989_3170_3652 160
493 3300048914 Ga0496111_0005653 Ga0496111_0005653_4151_4633 160
494 3300048915 Ga0496112_0282422 Ga0496112_0282422_245_730 160
495 3300048916 Ga0496113_0067276 Ga0496113_0067276_804_1289 160
496 3300048916 Ga0496113_0508446 Ga0496113_0508446_413_895 160
497 3300048917 Ga0496114_0977211 Ga0496114_0977211_193_675 160
498 3300048927 Ga0496124_0411641 Ga0496124_0411641_135_620 160
499 3300048929 Ga0496126_0476839 Ga0496126_0476839_457_942 160
500 3300048929 Ga0496126_0705294 Ga0496126_0705294_54_539 160
501 3300049459 Ga0495678_020964 Ga0495678_020964_1421_1903 160
502 3300049568 Ga0501031_0008220 Ga0501031_0008220_1447_1932 160
503 3300049569 Ga0501032_0002053 Ga0501032_0002053_1705_2187 160
504 3300049569 Ga0501032_0027150 Ga0501032_0027150_2738_3223 160
505 3300049571 Ga0501034_0000010 Ga0501034_0000010_31725_32207 160
506 3300049571 Ga0501034_0019694 Ga0501034_0019694_1770_2252 160
507 3300049571 Ga0501034_0462180 Ga0501034_0462180_206_691 160
508 3300049572 Ga0501036_0006800 Ga0501036_0006800_8626_9108 160
509 3300049572 Ga0501036_0036621 Ga0501036_0036621_2524_3009 160
510 3300049573 Ga0501037_0010193 Ga0501037_0010193_5179_5661 160
511 3300049573 Ga0501037_0050621 Ga0501037_0050621_1477_1962 160
512 3300049574 Ga0501038_0002293 Ga0501038_0002293_17102_17584 160
513 3300049574 Ga0501038_0091085 Ga0501038_0091085_535_1020 160
514 3300049574 Ga0501038_0755995 Ga0501038_0755995_116_598 160
515 3300049576 Ga0501040_0138496 Ga0501040_0138496_713_1198 160
516 3300049578 Ga0501042_0020483 Ga0501042_0020483_1088_1573 160
517 3300049578 Ga0501042_0111474 Ga0501042_0111474_1253_1735 160
518 3300049579 Ga0501043_0078090 Ga0501043_0078090_1035_1517 160
519 3300049579 Ga0501043_0225172 Ga0501043_0225172_74_559 160
520 3300049581 Ga0501047_0011939 Ga0501047_0011939_1419_1901 160
521 3300049583 Ga0501067_0236371 Ga0501067_0236371_457_942 160
522 3300049584 Ga0501068_0352415 Ga0501068_0352415_389_874 160
523 3300049585 Ga0501069_0116060 Ga0501069_0116060_376_861 160
524 3300049585 Ga0501069_0263329 Ga0501069_0263329_401_886 160
525 3300049586 Ga0501070_0384506 Ga0501070_0384506_372_857 160
526 3300049587 Ga0501071_0031881 Ga0501071_0031881_1905_2390 160
527 3300049588 Ga0501072_0017795 Ga0501072_0017795_1529_2014 160
528 3300049589 Ga0501073_0045723 Ga0501073_0045723_2065_2547 160
529 3300049590 Ga0501074_0026846 Ga0501074_0026846_2976_3461 160
530 3300049590 Ga0501074_0030892 Ga0501074_0030892_2865_3347 160
531 3300049591 Ga0501075_0015168 Ga0501075_0015168_3491_3976 160
532 3300049592 Ga0501076_0002407 Ga0501076_0002407_9602_10087 160
533 3300049593 Ga0501077_0006102 Ga0501077_0006102_5298_5783 160
534 3300049741 Ga0501079_0046602 Ga0501079_0046602_2314_2799 160
535 3300049742 Ga0501080_0749092 Ga0501080_0749092_168_653 160
536 3300049743 Ga0501081_0256122 Ga0501081_0256122_357_842 160
537 3300049822 Ga0501035_0060884 Ga0501035_0060884_841_1326 160
538 3300049823 Ga0501044_0001745 Ga0501044_0001745_11121_11603 160
539 3300049823 Ga0501044_0133003 Ga0501044_0133003_1883_2365 160
540 3300049824 Ga0501045_0138440 Ga0501045_0138440_54_539 160
541 3300050490 nmdc:mga03n38_368094_c1 nmdc:mga03n38_368094_c1_143_628 160
542 3300050491 nmdc:mga00v17_569770_c1 nmdc:mga00v17_569770_c1_47_532 160
543 3300050492 nmdc:mga0yw44_13973_c2 nmdc:mga0yw44_13973_c2_2319_2804 160
544 3300050492 nmdc:mga0yw44_31518_c1 nmdc:mga0yw44_31518_c1_2369_2854 160
545 3300050492 nmdc:mga0yw44_422688_c1 nmdc:mga0yw44_422688_c1_271_756 160
546 3300050494 nmdc:mga06z11_340815_c1 nmdc:mga06z11_340815_c1_142_627 160
547 3300050508 nmdc:mga09592_1192697_c1 nmdc:mga09592_1192697_c1_126_608 160
548 3300053077 Ga0495601_0003378 Ga0495601_0003378_4511_4993 160
549 3300053077 Ga0495601_0008679 Ga0495601_0008679_717_1202 160
550 3300053078 Ga0495612_0152715 Ga0495612_0152715_84_569 160
551 3300053078 Ga0495612_0161106 Ga0495612_0161106_98_580 160
552 3300053080 Ga0500635_0320143 Ga0500635_0320143_60_545 160
553 3300053087 Ga0500643_000496 Ga0500643_000496_20796_21284 160
554 3300053092 Ga0500583_0056167 Ga0500583_0056167_1041_1526 160
555 3300053095 Ga0500640_004214 Ga0500640_004214_1130_1615 160
556 3300053098 Ga0500650_0216956 Ga0500650_0216956_178_663 160
557 3300053100 Ga0500660_049324 Ga0500660_049324_1573_2058 160
558 3300053100 Ga0500660_218065 Ga0500660_218065_20_502 160
559 3300053101 Ga0500553_049642 Ga0500553_049642_1092_1577 160
560 3300053107 Ga0500560_079176 Ga0500560_079176_336_821 160
561 3300053111 Ga0500572_068892 Ga0500572_068892_16_501 160
562 3300053113 Ga0500580_098264 Ga0500580_098264_569_1054 160
563 3300053118 Ga0500594_0101110 Ga0500594_0101110_113_598 160
564 3300053123 Ga0500614_008180 Ga0500614_008180_1028_1513 160
565 3300053123 Ga0500614_047749 Ga0500614_047749_44_529 160
566 3300053129 Ga0500628_022473 Ga0500628_022473_669_1154 160
567 3300053131 Ga0500652_007570 Ga0500652_007570_2353_2838 160
568 3300053131 Ga0500652_172101 Ga0500652_172101_187_672 160
569 3300053134 Ga0500658_0045652 Ga0500658_0045652_133_618 160
570 3300053136 Ga0500559_0012293 Ga0500559_0012293_3084_3569 160
571 3300053137 Ga0500561_0001430 Ga0500561_0001430_304_789 160
572 3300053143 Ga0500579_185584 Ga0500579_185584_304_789 160
573 3300053149 Ga0500600_0006942 Ga0500600_0006942_4776_5261 160
574 3300053153 Ga0500616_0239618 Ga0500616_0239618_11_496 160
575 3300053157 Ga0500624_035669 Ga0500624_035669_212_697 160
576 3300053160 Ga0500633_0023775 Ga0500633_0023775_304_789 160
577 3300053161 Ga0500634_0145799 Ga0500634_0145799_537_1022 160
578 3300053177 Ga0500636_0126421 Ga0500636_0126421_437_922 160
579 3300053732 Ga0500656_009012 Ga0500656_009012_481_966 160
580 3300053739 Ga0500587_008183 Ga0500587_008183_725_1210 160
581 3300060353 Ga0501082_0290718 Ga0501082_0290718_830_1315 160
582 3300061719 Ga0466962_0000456 Ga0466962_0000456_1710_2192 160
583 3300061719 Ga0466962_0004821 Ga0466962_0004821_3760_4245 160
584 3300061734 Ga0530510_0089856 Ga0530510_0089856_1638_2123 160
585 3300037312 Ga0395899_0002326 Ga0395899_0002326_14348_14833 161
586 3300037418 Ga0395900_0231683 Ga0395900_0231683_305_790 161
587 3300037466 Ga0395898_0009860 Ga0395898_0009860_8015_8500 161
588 3300038443 Ga0395901_0105512 Ga0395901_0105512_345_830 161
589 3300044694 Ga0466963_0535922 Ga0466963_0535922_275_778 161
590 3300002773 JGI25152J39213_1000298 JGI25152J39213_10002983 162
591 3300003187 JGI25151J46595_10046195 JGI25151J46595_100461952 162
592 3300005539 Ga0068853_100027362 Ga0068853_1000273626 162
593 3300009148 Ga0105243_10022723 Ga0105243_100227236 162
594 3300011119 Ga0105246_10008282 Ga0105246_100082822 162
595 3300025258 Ga0209129_1000064 Ga0209129_1000064195 162
596 3300025294 Ga0209025_1001863 Ga0209025_10018638 162
597 3300025315 Ga0207697_10236818 Ga0207697_102368181 162
598 3300025935 Ga0207709_10012576 Ga0207709_100125766 162
599 3300026041 Ga0207639_10052921 Ga0207639_100529214 162
600 3300027907 Ga0207428_10088141 Ga0207428_100881412 162
601 3300028786 Ga0307517_10074650 Ga0307517_100746502 162
602 3300031852 Ga0307410_10362263 Ga0307410_103622632 162
603 3300032002 Ga0307416_100033029 Ga0307416_1000330292 162
604 3300048905 Ga0496102_0185384 Ga0496102_0185384_680_1168 162
605 3300048913 Ga0496110_1353111 Ga0496110_1353111_16_504 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

81

155

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.8889 60 140
8e8w-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8877 62 140
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8757 60 140
6xcv-assembly1.cif.gz_B crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.873 61 140
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8708 59 142
ID Description Score Start End Superfamily
af_Q5A3Z5_62_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9067 62 141 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8792 59 140 2.60.120.10
af_Q9LUJ7_61_262_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8713 62 147 2.60.120.10
5yjsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8677 61 147 2.60.120.10
af_P33487_36_198_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.866 62 150 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0A1MHR5-F1-model_v4 Cupin domain protein 0.9525 62 149
AF-A0A6P1B8I6-F1-model_v4 Cupin domain-containing protein 0.9466 59 162
AF-A0A4R3PZ87-F1-model_v4 Cupin domain 0.9418 61 152
AF-A0A7Y2G8C9-F1-model_v4 Cupin domain-containing protein 0.9389 59 140
AF-A0A1F8VLZ3-F1-model_v4 Cupin type-2 domain-containing protein 0.9342 62 149

Feature Viewer

pLDDT pTM Quality
80.84 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map