F468266

General Info

Members Datasets Scaffolds Average Seq Length
603 362 568 183

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10147889|Ga0105240_101478893
Length 196
Sequence LVCRVVFSEINAVQTFPTLIPDVLVIEPKVFGDARGFFLESFNQQAFSQALGFSVEFKQDNHSRSTKGVLRGLHYQVKQPQGKLVRVVRGAVFDVAVDIRPSSATFGKWVGVELNEDNHRQLWIPAGLAHGFLVLSETADFLYKTTDYYAPAYERSIAWNDPAIGIEWPLAGATPALSAKDAAALSLAESIAGEVF

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2511231024 Pseudomonas sp. GM84 Isolate Nodule
3 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
4 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
5 2643221658 Variovorax sp. Root411 Isolate Unclassified
6 2643221672 Variovorax sp. Root434 Isolate Unclassified
7 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
8 2765235841 Pseudomonas putida AA7 Isolate Unclassified
9 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
10 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
11 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
12 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
13 2855730933 Achromobacter sp. HZ28 Isolate Nodule
14 2855767633 Achromobacter sp. HZ34 Isolate Nodule
15 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
16 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
17 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
18 2899924645 Variovorax sp. 369 Isolate Unclassified
19 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
20 2928037797 Variovorax sp. 1126 Isolate Unclassified
21 2928044640 Variovorax sp. 1128 Isolate Unclassified
22 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
23 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
24 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
25 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
26 2952252522 Salinicola sp. DM10 Isolate Unclassified
27 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
28 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
29 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
206 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
207 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
210 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
211 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
212 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
213 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
214 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
215 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
230 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
269 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
289 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
290 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
310 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
311 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
312 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
313 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
314 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
315 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
318 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
319 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
336 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
337 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
338 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
339 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
340 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
341 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
342 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
343 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
344 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
347 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
350 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
351 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
352 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
353 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
357 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
358 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
359 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
360 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
361 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
362 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.03
Metatranscriptomes 0.17
Isolates 5.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.89
Nodule 1.49
Rhizoplane 1.99
Rhizosphere 63.35
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000074 3300002987 Bacteria 48266
2 JGI25159J45721_1000713 3300002987 Bacteria 14514
3 JGI25159J45721_1011365 3300002987 Bacteria 2188
4 JGI25151J46595_10000281 3300003187 Bacteria 58019
5 JGI25151J46595_10000935 3300003187 Bacteria 22615
6 JGI25151J46595_10001155 3300003187 Bacteria 19111
7 JGI25151J46595_10001333 3300003187 Bacteria 17247
8 JGI25151J46595_10005180 3300003187 Bacteria 6765
9 JGI25151J46595_10010457 3300003187 Bacteria 4312
10 JGI25153J46596_10000994 3300003215 Bacteria 17227
11 Ga0006777J48905_1115107 3300003308 Bacteria 1133
12 rootH1_10052883 3300003316 Bacteria 6876
13 rootH2_10023139 3300003320 Bacteria 3016
14 rootL2_10001457 3300003322 Bacteria 117785
15 rootH1_10016403 3300003323 Bacteria 11335
16 JGI25160J50197_1000106 3300003354 Bacteria 80449
17 JGI25160J50197_1000677 3300003354 Bacteria 18888
18 JGI25161J50226_1000041 3300003374 Bacteria 124485
19 JGI25161J50226_1002438 3300003374 Bacteria 4774
20 Ga0055525_1000004 3300003759 Bacteria 888039
21 Ga0055526_1000857 3300003771 Bacteria 22645
22 Ga0055526_1023702 3300003771 Bacteria 2039
23 Ga0055526_1059064 3300003771 Bacteria 827
24 Ga0055537_1000740 3300003773 Bacteria 16735
25 Ga0055537_1000906 3300003773 Bacteria 13986
26 Ga0055524_1000915 3300003775 Bacteria 19046
27 Ga0055524_1031142 3300003775 Bacteria 1539
28 Ga0055536_1000022 3300003781 Bacteria 198244
29 Ga0055534_1000554 3300003784 Bacteria 19780
30 Ga0055534_1000687 3300003784 Bacteria 16711
31 Ga0055534_1002035 3300003784 Bacteria 7328
32 Ga0055534_1010398 3300003784 Bacteria 1952
33 Ga0055528_1001217 3300003790 Bacteria 16493
34 Ga0055530_10003228 3300003791 Bacteria 9525
35 Ga0055540_1000821 3300003792 Bacteria 20906
36 Ga0055540_1007554 3300003792 Bacteria 4072
37 Ga0055531_10000257 3300003794 Bacteria 56547
38 Ga0055531_10001061 3300003794 Bacteria 21644
39 Ga0058692_1001916 3300003856 Bacteria 7271
40 Ga0055543_1000092 3300004625 Bacteria 78538
41 Ga0055543_1000801 3300004625 Bacteria 15548
42 Ga0055543_1016654 3300004625 Bacteria 1395
43 Ga0065165_1000492 3300005262 Bacteria 61002
44 Ga0065165_1002142 3300005262 Bacteria 17905
45 Ga0065165_1002576 3300005262 Bacteria 14961
46 Ga0070658_10084195 3300005327 Bacteria 2615
47 Ga0070658_10191418 3300005327 Bacteria 1724
48 Ga0070658_10231535 3300005327 Bacteria 1564
49 Ga0070658_10392212 3300005327 Bacteria 1192
50 Ga0070658_11098751 3300005327 Bacteria 692
51 Ga0070670_100199097 3300005331 Bacteria 1740
52 Ga0070670_100228166 3300005331 Bacteria 1620
53 Ga0068869_100176384 3300005334 Bacteria 1673
54 Ga0070666_10197286 3300005335 Bacteria 1416
55 Ga0070680_100673583 3300005336 Bacteria 890
56 Ga0068868_100063332 3300005338 Bacteria 2933
57 Ga0068868_100107535 3300005338 Bacteria 2263
58 Ga0070692_10073725 3300005345 Bacteria 1824
59 Ga0070668_100004017 3300005347 Bacteria 10879
60 Ga0070669_100021996 3300005353 Bacteria 4561
61 Ga0070669_100390838 3300005353 Bacteria 1136
62 Ga0070671_100104464 3300005355 Bacteria 2377
63 Ga0070671_100104920 3300005355 Bacteria 2372
64 Ga0070673_100430724 3300005364 Bacteria 1184
65 Ga0070659_100169343 3300005366 Bacteria 1788
66 Ga0070659_100496837 3300005366 Bacteria 1039
67 Ga0070708_101022127 3300005445 Bacteria 775
68 Ga0070662_100180304 3300005457 Bacteria 1664
69 Ga0068867_100062241 3300005459 Bacteria 2772
70 Ga0068867_100536851 3300005459 Bacteria 1011
71 Ga0068867_100625151 3300005459 Bacteria 942
72 Ga0070672_100471152 3300005543 Bacteria 1084
73 Ga0070665_100717328 3300005548 Bacteria 1013
74 Ga0068855_100248217 3300005563 Bacteria 1986
75 Ga0068855_100308763 3300005563 Bacteria 1750
76 Ga0070664_100036216 3300005564 Bacteria 4146
77 Ga0070664_100286439 3300005564 Bacteria 1486
78 Ga0068859_100027883 3300005617 Bacteria 5663
79 Ga0068864_100027620 3300005618 Bacteria 4795
80 Ga0068864_100511018 3300005618 Bacteria 1157
81 Ga0068851_10002637 3300005834 Bacteria 7904
82 Ga0068863_100041190 3300005841 Bacteria 4391
83 Ga0068863_100048910 3300005841 Bacteria 4009
84 Ga0070717_10108261 3300006028 Bacteria 2367
85 Ga0075365_10542694 3300006038 Bacteria 822
86 Ga0075368_10115599 3300006042 Bacteria 1108
87 Ga0075363_100009562 3300006048 Bacteria 4562
88 Ga0075366_10004140 3300006195 Bacteria 7766
89 Ga0075370_10183896 3300006353 Bacteria 1230
90 Ga0075370_10301827 3300006353 Bacteria 952
91 Ga0068871_100176619 3300006358 Bacteria 1833
92 Ga0075428_100028212 3300006844 Bacteria 6208
93 Ga0075431_100502114 3300006847 Unclassified 1204
94 Ga0075429_100018939 3300006880 Bacteria 5963
95 Ga0068865_100575783 3300006881 Bacteria 949
96 Ga0097620_100027883 3300006931 Bacteria 5663
97 Ga0079104_1015671 3300006946 Bacteria 2239
98 Ga0079104_1028083 3300006946 Bacteria 1434
99 Ga0105251_10001421 3300009011 Bacteria 20627
100 Ga0105244_10003335 3300009036 Bacteria 11539
101 Ga0105244_10314278 3300009036 Bacteria 724
102 Ga0105240_10147889 3300009093 Bacteria 2801
103 Ga0105240_10281846 3300009093 Bacteria 1909
104 Ga0111539_10620344 3300009094 Bacteria 1259
105 Ga0105245_10024461 3300009098 Bacteria 5304
106 Ga0114129_10023178 3300009147 Bacteria 8805
107 Ga0105243_10004984 3300009148 Bacteria 10408
108 Ga0105241_10033513 3300009174 Bacteria 3855
109 Ga0105242_10022682 3300009176 Bacteria 4941
110 Ga0105248_10995055 3300009177 Bacteria 947
111 Ga0105248_11304130 3300009177 Bacteria 821
112 Ga0105237_10026158 3300009545 Bacteria 5964
113 Ga0105237_10265310 3300009545 Bacteria 1720
114 Ga0105237_10844684 3300009545 Bacteria 922
115 Ga0105238_10263704 3300009551 Bacteria 1703
116 Ga0105238_10398196 3300009551 Bacteria 1370
117 Ga0105238_10416484 3300009551 Bacteria 1338
118 Ga0105246_10030410 3300011119 Bacteria 3566
119 Ga0157347_1000148 3300012502 Bacteria 3652
120 Ga0157373_10011431 3300013100 Bacteria 6529
121 Ga0157373_10048731 3300013100 Bacteria 3020
122 Ga0157370_10002225 3300013104 Bacteria 23625
123 Ga0157370_10307509 3300013104 Bacteria 1463
124 Ga0157370_10370343 3300013104 Bacteria 1320
125 Ga0157370_10721703 3300013104 Bacteria 909
126 Ga0157369_10000138 3300013105 Bacteria 102776
127 Ga0157369_10001085 3300013105 Bacteria 34008
128 Ga0157374_10112840 3300013296 Bacteria 2616
129 Ga0157378_10208955 3300013297 Bacteria 1850
130 Ga0163162_10471239 3300013306 Bacteria 1387
131 Ga0163162_11382568 3300013306 Bacteria 801
132 Ga0157372_10036646 3300013307 Bacteria 5407
133 Ga0157375_10061000 3300013308 Bacteria 3742
134 Ga0163163_10484298 3300014325 Bacteria 1298
135 Ga0157380_10046775 3300014326 Bacteria 3400
136 Ga0157380_10513522 3300014326 Bacteria 1167
137 Ga0182008_10000156 3300014497 Bacteria 53866
138 Ga0182008_10000188 3300014497 Bacteria 48848
139 Ga0182008_10088916 3300014497 Bacteria 1522
140 Ga0182008_10220422 3300014497 Bacteria 970
141 Ga0157379_10317750 3300014968 Bacteria 1421
142 Ga0157376_10457054 3300014969 Bacteria 1247
143 Ga0182006_1000014 3300015261 Bacteria 340159
144 Ga0182006_1014460 3300015261 Bacteria 3403
145 Ga0182006_1046930 3300015261 Bacteria 1677
146 Ga0182007_10072352 3300015262 Bacteria 1129
147 Ga0182007_10168897 3300015262 Bacteria 751
148 Ga0183362_10005 3300015683 Bacteria 437616
149 Ga0163161_10082801 3300017792 Bacteria 2365
150 Ga0163161_10263690 3300017792 Bacteria 1346
151 Ga0163161_10285717 3300017792 Bacteria 1295
152 Ga0213872_10000036 3300021361 Bacteria 129233
153 Ga0213872_10000216 3300021361 Bacteria 50826
154 Ga0209436_100453 3300025208 Bacteria 18317
155 Ga0209759_1000443 3300025256 Bacteria 48263
156 Ga0209129_1000954 3300025258 Bacteria 17410
157 Ga0209565_1000752 3300025263 Bacteria 19073
158 Ga0209565_1000869 3300025263 Bacteria 16699
159 Ga0209673_1000578 3300025273 Bacteria 57974
160 Ga0209673_1005958 3300025273 Bacteria 6009
161 Ga0209673_1006531 3300025273 Bacteria 5605
162 Ga0209130_1000099 3300025284 Bacteria 141717
163 Ga0209130_1000551 3300025284 Bacteria 37431
164 Ga0209130_1001244 3300025284 Bacteria 17857
165 Ga0209130_1036408 3300025284 Bacteria 977
166 Ga0209675_1000546 3300025291 Bacteria 27468
167 Ga0209675_1000720 3300025291 Bacteria 22548
168 Ga0209675_1000990 3300025291 Bacteria 17951
169 Ga0209675_1001398 3300025291 Bacteria 14016
170 Ga0209676_1000012 3300025292 Bacteria 841431
171 Ga0209676_1001174 3300025292 Bacteria 28334
172 Ga0209676_1001483 3300025292 Bacteria 21677
173 Ga0209676_1009702 3300025292 Bacteria 4118
174 Ga0209676_1013029 3300025292 Bacteria 3221
175 Ga0209025_1000039 3300025294 Bacteria 377396
176 Ga0209025_1000124 3300025294 Bacteria 201973
177 Ga0209025_1001144 3300025294 Bacteria 37770
178 Ga0209025_1001306 3300025294 Bacteria 34010
179 Ga0209025_1002293 3300025294 Bacteria 20779
180 Ga0209025_1008688 3300025294 Bacteria 7256
181 Ga0209564_1000108 3300025295 Bacteria 213699
182 Ga0209564_1000211 3300025295 Bacteria 133277
183 Ga0209564_1002628 3300025295 Bacteria 13736
184 Ga0209758_1002709 3300025297 Bacteria 17456
185 Ga0209050_1000366 3300025298 Bacteria 86616
186 Ga0209050_1000662 3300025298 Bacteria 53092
187 Ga0209050_1044661 3300025298 Bacteria 1183
188 Ga0209050_1057919 3300025298 Bacteria 934
189 Ga0209256_1000101 3300025299 Bacteria 200246
190 Ga0209256_1004481 3300025299 Bacteria 8732
191 Ga0209256_1031276 3300025299 Bacteria 1457
192 Ga0207426_1000062 3300025302 Bacteria 362040
193 Ga0207426_1000086 3300025302 Bacteria 292089
194 Ga0207426_1000351 3300025302 Bacteria 84439
195 Ga0209051_1000025 3300025303 Bacteria 415397
196 Ga0209051_1000186 3300025303 Bacteria 109900
197 Ga0209051_1000537 3300025303 Bacteria 46665
198 Ga0209051_1000924 3300025303 Bacteria 29157
199 Ga0209051_1021493 3300025303 Bacteria 2745
200 Ga0209051_1044351 3300025303 Bacteria 1550
201 Ga0209051_1066091 3300025303 Bacteria 1112
202 Ga0209051_1084691 3300025303 Bacteria 902
203 Ga0209257_1000039 3300025304 Bacteria 591694
204 Ga0209257_1000516 3300025304 Bacteria 67246
205 Ga0209257_1017312 3300025304 Bacteria 2849
206 Ga0209257_1040014 3300025304 Bacteria 1403
207 Ga0207656_10004263 3300025321 Bacteria 4982
208 Ga0207655_1002241 3300025728 Bacteria 15993
209 Ga0207655_1014470 3300025728 Bacteria 4457
210 Ga0207655_1015600 3300025728 Bacteria 4209
211 Ga0207655_1042654 3300025728 Bacteria 1929
212 Ga0207713_1024387 3300025735 Bacteria 2822
213 Ga0207713_1044200 3300025735 Bacteria 1832
214 Ga0207645_10367545 3300025907 Bacteria 964
215 Ga0207705_10009877 3300025909 Bacteria 6950
216 Ga0207705_10163856 3300025909 Bacteria 1671
217 Ga0207705_10433426 3300025909 Bacteria 1018
218 Ga0207654_10878730 3300025911 Bacteria 649
219 Ga0207695_10555858 3300025913 Bacteria 1029
220 Ga0207671_10080650 3300025914 Bacteria 2439
221 Ga0207657_10031595 3300025919 Bacteria 4794
222 Ga0207649_10813483 3300025920 Bacteria 730
223 Ga0207681_10758591 3300025923 Bacteria 809
224 Ga0207694_10259581 3300025924 Bacteria 1423
225 Ga0207650_10268693 3300025925 Bacteria 1385
226 Ga0207644_10197118 3300025931 Bacteria 1586
227 Ga0207644_10405968 3300025931 Bacteria 1114
228 Ga0207690_10016600 3300025932 Bacteria 4484
229 Ga0207686_10004128 3300025934 Bacteria 7791
230 Ga0207709_10000395 3300025935 Bacteria 42894
231 Ga0207709_10009049 3300025935 Bacteria 5490
232 Ga0207704_10193823 3300025938 Bacteria 1480
233 Ga0207665_10127675 3300025939 Bacteria 1802
234 Ga0207691_10207211 3300025940 Bacteria 1704
235 Ga0207691_10323881 3300025940 Bacteria 1321
236 Ga0207711_10022681 3300025941 Bacteria 5251
237 Ga0207711_10172764 3300025941 Bacteria 1962
238 Ga0207711_10241784 3300025941 Bacteria 1655
239 Ga0207689_10473594 3300025942 Bacteria 1048
240 Ga0207679_10019330 3300025945 Bacteria 4573
241 Ga0207679_10064896 3300025945 Bacteria 2731
242 Ga0207667_10137473 3300025949 Bacteria 2516
243 Ga0207651_10254335 3300025960 Bacteria 1439
244 Ga0207658_10334963 3300025986 Bacteria 1314
245 Ga0207703_10272505 3300026035 Bacteria 1534
246 Ga0207639_10163482 3300026041 Bacteria 1878
247 Ga0207641_11020022 3300026088 Bacteria 824
248 Ga0207648_10024407 3300026089 Bacteria 5397
249 Ga0207648_10387506 3300026089 Bacteria 1264
250 Ga0207648_10555571 3300026089 Bacteria 1055
251 Ga0207648_11003199 3300026089 Bacteria 782
252 Ga0207676_10186965 3300026095 Bacteria 1819
253 Ga0207683_10107436 3300026121 Bacteria 2496
254 Ga0207698_10689675 3300026142 Bacteria 1015
255 Ga0209281_1017093 3300027111 Bacteria 1478
256 Ga0209371_1002065 3300027312 Bacteria 11976
257 Ga0209371_1011923 3300027312 Bacteria 2549
258 Ga0209282_1000064 3300027666 Bacteria 91973
259 Ga0209971_1036256 3300027682 Bacteria 1187
260 Ga0209813_10103584 3300027866 Bacteria 971
261 Ga0209974_10010539 3300027876 Bacteria 3117
262 Ga0268266_10302476 3300028379 Bacteria 1492
263 Ga0268266_10431861 3300028379 Bacteria 1250
264 Ga0268264_10181511 3300028381 Bacteria 1912
265 Ga0307515_10007523 3300028794 Bacteria 21519
266 Ga0307515_10352587 3300028794 Bacteria 1117
267 Ga0268256_1001820 3300030500 Bacteria 11990
268 Ga0268256_1008847 3300030500 Bacteria 3409
269 Ga0268256_1040518 3300030500 Bacteria 1046
270 Ga0316183_1105275 3300030742 Bacteria 2738
271 Ga0265332_10032458 3300031238 Bacteria 2275
272 Ga0265327_10002512 3300031251 Bacteria 19153
273 Ga0265327_10003400 3300031251 Bacteria 15268
274 Ga0307513_10000008 3300031456 Bacteria 442128
275 Ga0307513_10000090 3300031456 Bacteria 129750
276 Ga0307513_10024220 3300031456 Bacteria 7067
277 Ga0307513_10042159 3300031456 Bacteria 5029
278 Ga0307408_100001094 3300031548 Bacteria 20723
279 Ga0307408_100004769 3300031548 Bacteria 9142
280 Ga0307408_100221213 3300031548 Bacteria 1545
281 Ga0307408_100488092 3300031548 Bacteria 1076
282 Ga0307408_101444294 3300031548 Bacteria 649
283 Ga0265342_10261243 3300031712 Bacteria 921
284 Ga0307516_10000845 3300031730 Bacteria 42008
285 Ga0307405_10000696 3300031731 Bacteria 13019
286 Ga0307405_10023166 3300031731 Bacteria 3524
287 Ga0307405_10071753 3300031731 Bacteria 2229
288 Ga0307405_10205519 3300031731 Bacteria 1434
289 Ga0307405_10665360 3300031731 Bacteria 858
290 Ga0307413_10029678 3300031824 Bacteria 3063
291 Ga0307406_10023076 3300031901 Bacteria 3699
292 Ga0307406_10029447 3300031901 Bacteria 3325
293 Ga0307407_10723770 3300031903 Bacteria 751
294 Ga0307412_10001117 3300031911 Bacteria 15389
295 Ga0307412_10036686 3300031911 Bacteria 3143
296 Ga0307412_10128660 3300031911 Bacteria 1836
297 Ga0307412_10516872 3300031911 Bacteria 997
298 Ga0307409_101112514 3300031995 Bacteria 811
299 Ga0307416_100164655 3300032002 Bacteria 2055
300 Ga0307416_100317622 3300032002 Bacteria 1558
301 Ga0307416_100519975 3300032002 Bacteria 1258
302 Ga0307416_100890514 3300032002 Bacteria 990
303 Ga0307414_10025459 3300032004 Bacteria 3791
304 Ga0307411_10078563 3300032005 Bacteria 2262
305 Ga0307411_10931186 3300032005 Bacteria 774
306 Ga0395899_0001811 3300037312 Bacteria 17695
307 Ga0395900_0057726 3300037418 Bacteria 3996
308 Ga0395900_0164753 3300037418 Bacteria 2259
309 Ga0395898_0049874 3300037466 Bacteria 4099
310 Ga0395898_1230002 3300037466 Bacteria 679
311 Ga0395905_0172333 3300037471 Bacteria 2032
312 Ga0395905_0600124 3300037471 Bacteria 1003
313 Ga0436364_1233550 3300037853 Bacteria 2175
314 Ga0395901_0064008 3300038443 Bacteria 3827
315 Ga0436361_0206950 3300039447 Bacteria 229672
316 Ga0436361_0931379 3300039447 Bacteria 1756
317 Ga0451789_1326119 3300041443 Bacteria 1927
318 Ga0451807_1110695 3300041486 Bacteria 959
319 Ga0451841_0879473 3300041498 Bacteria 1210
320 Ga0451843_1664536 3300041509 Bacteria 850
321 Ga0451855_1957971 3300041511 Bacteria 669
322 Ga0439449_0001237 3300042007 Bacteria 10011
323 Ga0439449_0011518 3300042007 Bacteria 3327
324 Ga0439452_000001 3300042010 Bacteria 1725439
325 Ga0439456_000183 3300042013 Bacteria 18256
326 Ga0439462_0007797 3300042015 Bacteria 2686
327 Ga0439463_127403 3300042016 Bacteria 658
328 Ga0450911_000126 3300042115 Bacteria 30361
329 Ga0450903_025012 3300042138 Bacteria 914
330 Ga0439464_0132897 3300042439 Bacteria 771
331 Ga0451577_0001405 3300042876 Bacteria 32181
332 Ga0451577_0006621 3300042876 Bacteria 11511
333 Ga0451577_0483823 3300042876 Bacteria 1124
334 Ga0451577_0686074 3300042876 Unclassified 928
335 Ga0451577_0946058 3300042876 Bacteria 775
336 Ga0466969_0189416 3300044656 Bacteria 940
337 Ga0466972_0002243 3300044658 Bacteria 9494
338 Ga0453683_0007367 3300044673 Bacteria 7472
339 Ga0453683_0031032 3300044673 Bacteria 3377
340 Ga0453683_0365171 3300044673 Bacteria 928
341 Ga0466961_0005151 3300044693 Bacteria 8223
342 Ga0453684_0000066 3300044712 Bacteria 465545
343 Ga0453684_0079806 3300044712 Bacteria 4089
344 Ga0453684_0338235 3300044712 Bacteria 1700
345 Ga0453684_0361908 3300044712 Bacteria 1633
346 Ga0453684_0425841 3300044712 Bacteria 1482
347 Ga0453684_0482073 3300044712 Bacteria 1376
348 Ga0453684_0653086 3300044712 Bacteria 1147
349 Ga0466968_0061422 3300044735 Unclassified 1621
350 Ga0466957_0000568 3300044842 Bacteria 18608
351 Ga0466957_0606387 3300044842 Bacteria 767
352 Ga0466957_0796295 3300044842 Bacteria 671
353 Ga0466960_0133327 3300044901 Bacteria 1313
354 Ga0466959_0001298 3300045049 Bacteria 15133
355 Ga0451576_0000006 3300045051 Bacteria 949698
356 Ga0451576_0009603 3300045051 Bacteria 11194
357 Ga0451576_0017861 3300045051 Bacteria 7792
358 Ga0451576_0033048 3300045051 Bacteria 5500
359 Ga0451576_0290057 3300045051 Bacteria 1711
360 Ga0466958_0787304 3300045836 Bacteria 620
361 Ga0466967_0002897 3300045976 Bacteria 10925
362 Ga0466967_0135637 3300045976 Bacteria 2289
363 Ga0495627_007933 3300046453 Bacteria 4022
364 Ga0495590_0013419 3300046457 Bacteria 3013
365 Ga0495638_0030235 3300046460 Bacteria 3488
366 Ga0495638_0125577 3300046460 Bacteria 1512
367 Ga0495651_0399450 3300046462 Unclassified 898
368 Ga0495605_0000747 3300046474 Bacteria 23843
369 Ga0495605_0044460 3300046474 Bacteria 2196
370 Ga0495605_0084553 3300046474 Bacteria 1479
371 Ga0495584_0000285 3300046491 Bacteria 35720
372 Ga0495607_0007590 3300046501 Bacteria 7483
373 Ga0495583_0005479 3300046506 Bacteria 8609
374 Ga0495610_0029144 3300046512 Bacteria 2911
375 Ga0495616_0001520 3300046513 Bacteria 15995
376 Ga0495616_0004920 3300046513 Bacteria 8346
377 Ga0495620_0001167 3300046515 Bacteria 16094
378 Ga0495631_0003744 3300046518 Bacteria 8284
379 Ga0495632_0000527 3300046519 Bacteria 36131
380 Ga0495637_0101538 3300046520 Bacteria 1123
381 Ga0495643_0001350 3300046522 Bacteria 23094
382 Ga0495644_0000166 3300046523 Bacteria 31051
383 Ga0495648_0001988 3300046524 Bacteria 19429
384 Ga0495648_0216978 3300046524 Bacteria 946
385 Ga0495642_0000096 3300046528 Bacteria 50386
386 Ga0495642_0036878 3300046528 Bacteria 1977
387 Ga0495609_0000396 3300046538 Bacteria 36617
388 Ga0495609_0004055 3300046538 Bacteria 8165
389 Ga0495621_0015922 3300046539 Bacteria 2405
390 Ga0495621_0037044 3300046539 Bacteria 1695
391 Ga0495597_0041376 3300046542 Bacteria 2059
392 Ga0495622_0123543 3300046557 Bacteria 1181
393 Ga0495668_0035448 3300046616 Bacteria 2797
394 Ga0495611_0000500 3300046648 Bacteria 23344
395 Ga0495625_0172357 3300046660 Bacteria 1444
396 Ga0495625_0178991 3300046660 Bacteria 1411
397 Ga0495625_0410639 3300046660 Bacteria 844
398 Ga0495659_0006855 3300046664 Bacteria 3602
399 Ga0495661_0062473 3300046665 Bacteria 2206
400 Ga0495588_0027358 3300046674 Bacteria 2850
401 Ga0495670_0024030 3300046691 Bacteria 3009
402 Ga0495671_0006377 3300046692 Bacteria 6817
403 Ga0495671_0017797 3300046692 Bacteria 3780
404 Ga0495649_0000432 3300046694 Bacteria 36223
405 Ga0495649_0250976 3300046694 Bacteria 909
406 Ga0495589_0003288 3300046794 Bacteria 8775
407 Ga0495589_0183731 3300046794 Bacteria 991
408 Ga0495660_0184525 3300046810 Bacteria 1007
409 Ga0495636_0000191 3300047318 Bacteria 24040
410 Ga0495636_0000545 3300047318 Bacteria 13844
411 Ga0495674_0046206 3300047319 Bacteria 3865
412 Ga0495672_0001359 3300047320 Bacteria 24241
413 Ga0495672_0010237 3300047320 Bacteria 6700
414 Ga0495676_0173611 3300047321 Bacteria 1515
415 Ga0495683_0002902 3300047323 Bacteria 10139
416 Ga0495687_001895 3300047443 Bacteria 18025
417 Ga0495677_0031483 3300047445 Bacteria 1930
418 Ga0495677_0291999 3300047445 Bacteria 640
419 Ga0495685_000008 3300047447 Bacteria 95629
420 Ga0495686_0281098 3300047472 Bacteria 925
421 Ga0495615_0013776 3300048090 Bacteria 1696
422 Ga0495626_0000699 3300048091 Bacteria 31942
423 Ga0496106_0000058 3300048909 Bacteria 88804
424 Ga0496106_0156761 3300048909 Bacteria 1799
425 Ga0496108_0643426 3300048911 Bacteria 922
426 Ga0496110_0017273 3300048913 Bacteria 6035
427 Ga0496110_0442389 3300048913 Bacteria 1185
428 Ga0496111_0147102 3300048914 Bacteria 1747
429 Ga0496111_0181455 3300048914 Bacteria 1565
430 Ga0496116_0003742 3300048919 Bacteria 14874
431 Ga0496116_0102357 3300048919 Bacteria 1708
432 Ga0496116_0108568 3300048919 Bacteria 1638
433 Ga0496117_0044240 3300048920 Bacteria 3227
434 Ga0496117_0430097 3300048920 Bacteria 658
435 Ga0496118_0029317 3300048921 Bacteria 4617
436 Ga0496118_0045814 3300048921 Bacteria 3408
437 Ga0496118_0104155 3300048921 Bacteria 1905
438 Ga0496118_0319932 3300048921 Bacteria 842
439 Ga0496120_0027735 3300048923 Bacteria 3478
440 Ga0496120_0093605 3300048923 Bacteria 1601
441 Ga0496121_0001067 3300048924 Bacteria 48503
442 Ga0496121_0001565 3300048924 Bacteria 38210
443 Ga0496121_0002670 3300048924 Bacteria 26700
444 Ga0496121_0007659 3300048924 Bacteria 12968
445 Ga0496121_0010210 3300048924 Bacteria 10630
446 Ga0496121_0022497 3300048924 Bacteria 6116
447 Ga0496121_0039261 3300048924 Bacteria 4176
448 Ga0496122_0000184 3300048925 Bacteria 144437
449 Ga0496122_0024605 3300048925 Bacteria 5263
450 Ga0496122_0027806 3300048925 Bacteria 4822
451 Ga0496122_0042526 3300048925 Bacteria 3573
452 Ga0496123_0000181 3300048926 Bacteria 127092
453 Ga0496123_0016077 3300048926 Bacteria 6097
454 Ga0496123_0048155 3300048926 Bacteria 2870
455 Ga0496124_0004968 3300048927 Bacteria 15213
456 Ga0496124_0044465 3300048927 Bacteria 3810
457 Ga0496124_0115714 3300048927 Bacteria 2151
458 Ga0496124_0637679 3300048927 Bacteria 686
459 Ga0496125_0001710 3300048928 Bacteria 30576
460 Ga0496125_0002173 3300048928 Bacteria 26201
461 Ga0496125_0004639 3300048928 Bacteria 15696
462 Ga0496125_0006853 3300048928 Bacteria 12216
463 Ga0496125_0015028 3300048928 Bacteria 7518
464 Ga0496125_0019153 3300048928 Bacteria 6469
465 Ga0496126_0000184 3300048929 Bacteria 140502
466 Ga0496126_0000865 3300048929 Bacteria 53248
467 Ga0496126_0007686 3300048929 Bacteria 11767
468 Ga0496126_0013589 3300048929 Bacteria 8266
469 Ga0496126_0082324 3300048929 Bacteria 2844
470 Ga0496126_0288949 3300048929 Bacteria 1356
471 Ga0495678_000569 3300049459 Bacteria 35204
472 Ga0495678_011163 3300049459 Bacteria 4317
473 Ga0495682_0000064 3300049460 Bacteria 98866
474 Ga0495682_0000651 3300049460 Bacteria 23215
475 Ga0501294_003487 3300049517 Bacteria 1484
476 Ga0501300_004212 3300049523 Bacteria 2134
477 Ga0501031_0001212 3300049568 Bacteria 15757
478 Ga0501031_0035188 3300049568 Bacteria 3266
479 Ga0501032_0000170 3300049569 Bacteria 53079
480 Ga0501032_0286253 3300049569 Bacteria 1066
481 Ga0501033_0001496 3300049570 Bacteria 20692
482 Ga0501033_0012221 3300049570 Bacteria 6554
483 Ga0501034_0003948 3300049571 Bacteria 16663
484 Ga0501036_0003504 3300049572 Bacteria 12547
485 Ga0501036_0011422 3300049572 Bacteria 7352
486 Ga0501036_0014236 3300049572 Bacteria 6619
487 Ga0501036_0088114 3300049572 Bacteria 2623
488 Ga0501037_0000691 3300049573 Bacteria 25695
489 Ga0501037_0202712 3300049573 Bacteria 1401
490 Ga0501037_0236489 3300049573 Bacteria 1281
491 Ga0501038_0001058 3300049574 Bacteria 24822
492 Ga0501038_0002695 3300049574 Bacteria 16551
493 Ga0501038_0645004 3300049574 Bacteria 798
494 Ga0501039_0015846 3300049575 Bacteria 5771
495 Ga0501039_0056179 3300049575 Bacteria 3049
496 Ga0501040_0002856 3300049576 Bacteria 11153
497 Ga0501041_0129272 3300049577 Bacteria 1573
498 Ga0501042_0002804 3300049578 Bacteria 10785
499 Ga0501043_0002328 3300049579 Bacteria 16092
500 Ga0501043_0060611 3300049579 Bacteria 2970
501 Ga0501046_0000547 3300049580 Bacteria 37402
502 Ga0501046_0189853 3300049580 Bacteria 1533
503 Ga0501047_0055318 3300049581 Bacteria 3837
504 Ga0501048_0000431 3300049582 Bacteria 29465
505 Ga0501069_0443651 3300049585 Unclassified 771
506 Ga0501073_0432436 3300049589 Bacteria 910
507 Ga0501075_0143883 3300049591 Bacteria 1817
508 Ga0501198_000001 3300049649 Bacteria 234552
509 Ga0501209_000471 3300049656 Bacteria 4947
510 Ga0501222_000004 3300049662 Bacteria 136139
511 Ga0501235_021690 3300049669 Bacteria 1428
512 Ga0501238_020097 3300049671 Bacteria 941
513 Ga0501251_015523 3300049681 Bacteria 958
514 Ga0501253_130982 3300049683 Bacteria 616
515 Ga0501079_0154573 3300049741 Bacteria 1788
516 Ga0501265_004690 3300049762 Bacteria 1564
517 Ga0501280_000360 3300049776 Bacteria 11275
518 Ga0501282_000253 3300049778 Bacteria 6472
519 Ga0501035_0000444 3300049822 Bacteria 46207
520 Ga0501035_0016947 3300049822 Bacteria 6715
521 Ga0501035_0023282 3300049822 Bacteria 5680
522 Ga0501035_0034102 3300049822 Bacteria 4626
523 Ga0501044_0000699 3300049823 Bacteria 40459
524 Ga0501044_0001119 3300049823 Bacteria 31854
525 Ga0501044_0013984 3300049823 Bacteria 8670
526 Ga0501045_0000835 3300049824 Bacteria 19938
527 Ga0501226_002279 3300049853 Bacteria 2356
528 nmdc:mga03n38_20185_c1 3300050490 Bacteria 2661
529 nmdc:mga0k408_33773_c1 3300050493 Bacteria 2927
530 nmdc:mga0k408_4058_c1 3300050493 Bacteria 7766
531 nmdc:mga0k408_67455_c2 3300050493 Bacteria 1288
532 nmdc:mga06z11_56688_c1 3300050494 Bacteria 2027
533 nmdc:mga04h51_23007_c1 3300050495 Bacteria 1892
534 nmdc:mga07m45_314819_c1 3300050496 Bacteria 910
535 nmdc:mga07m45_5447_c1 3300050496 Bacteria 6337
536 nmdc:mga05p37_11514_c1 3300050507 Bacteria 10536
537 nmdc:mga09592_18245_c1 3300050508 Bacteria 5754
538 nmdc:mga06r32_466683_c1 3300050510 Unclassified 1241
539 Ga0500610_0000065 3300053079 Bacteria 33047
540 Ga0500610_0000109 3300053079 Bacteria 24958
541 Ga0500610_0019685 3300053079 Bacteria 3284
542 Ga0495619_0034199 3300053085 Bacteria 3304
543 Ga0500643_003277 3300053087 Bacteria 7873
544 Ga0500644_0002709 3300053088 Bacteria 4425
545 Ga0500562_005723 3300053108 Bacteria 3128
546 Ga0500569_056177 3300053109 Bacteria 1203
547 Ga0500572_031369 3300053111 Bacteria 1485
548 Ga0500592_026969 3300053116 Bacteria 926
549 Ga0500593_000117 3300053117 Bacteria 30894
550 Ga0500593_003708 3300053117 Bacteria 5824
551 Ga0500594_0010088 3300053118 Bacteria 2185
552 Ga0500607_000706 3300053121 Bacteria 32099
553 Ga0500608_000716 3300053122 Bacteria 12173
554 Ga0500655_000071 3300053133 Bacteria 27208
555 Ga0500559_0092765 3300053136 Bacteria 1384
556 Ga0500568_0110561 3300053139 Bacteria 1027
557 Ga0500574_000131 3300053141 Bacteria 8322
558 Ga0500616_0070045 3300053153 Bacteria 1791
559 Ga0500627_0000163 3300053158 Bacteria 19693
560 Ga0500634_0000678 3300053161 Bacteria 11644
561 Ga0500634_0002525 3300053161 Bacteria 7755
562 Ga0500638_013878 3300053162 Bacteria 3660
563 Ga0500636_0273281 3300053177 Bacteria 848
564 Ga0500645_000521 3300053730 Bacteria 25747
565 Ga0500645_007029 3300053730 Bacteria 3957
566 Ga0501084_0202181 3300054114 Bacteria 1676
567 Ga0501082_1292214 3300060353 Bacteria 637
568 Ga0530510_0957834 3300061734 Bacteria 654

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049683 Ga0501253_130982 Ga0501253_130982_133_606 156
2 3300042138 Ga0450903_025012 Ga0450903_025012_205_750 166
3 3300042439 Ga0439464_0132897 Ga0439464_0132897_75_620 166
4 3300003320 rootH2_10023139 rootH2_100231392 168
5 3300044693 Ga0466961_0005151 Ga0466961_0005151_5266_5820 168
6 3300048920 Ga0496117_0430097 Ga0496117_0430097_29_544 169
7 iso_pu_bacteria 2684622997 2686354017 170
8 3300027876 Ga0209974_10010539 Ga0209974_100105393 171
9 3300049574 Ga0501038_0645004 Ga0501038_0645004_11_526 171
10 3300005459 Ga0068867_100625151 Ga0068867_1006251512 172
11 3300026089 Ga0207648_10555571 Ga0207648_105555712 172
12 3300017792 Ga0163161_10285717 Ga0163161_102857172 174
13 3300021361 Ga0213872_10000216 Ga0213872_100002167 174
14 3300039447 Ga0436361_0206950 Ga0436361_0206950_220691_221233 174
15 3300046460 Ga0495638_0125577 Ga0495638_0125577_529_1074 174
16 3300046512 Ga0495610_0029144 Ga0495610_0029144_1796_2341 174
17 3300046513 Ga0495616_0004920 Ga0495616_0004920_65_610 174
18 3300046518 Ga0495631_0003744 Ga0495631_0003744_7350_7895 174
19 3300046520 Ga0495637_0101538 Ga0495637_0101538_16_561 174
20 3300046539 Ga0495621_0015922 Ga0495621_0015922_128_673 174
21 3300046557 Ga0495622_0123543 Ga0495622_0123543_542_1087 174
22 3300046660 Ga0495625_0178991 Ga0495625_0178991_744_1289 174
23 3300046810 Ga0495660_0184525 Ga0495660_0184525_111_656 174
24 3300048923 Ga0496120_0093605 Ga0496120_0093605_260_835 174
25 3300053108 Ga0500562_005723 Ga0500562_005723_2106_2651 174
26 3300053116 Ga0500592_026969 Ga0500592_026969_339_884 174
27 3300053118 Ga0500594_0010088 Ga0500594_0010088_674_1219 174
28 3300053153 Ga0500616_0070045 Ga0500616_0070045_300_845 174
29 3300006028 Ga0070717_10108261 Ga0070717_101082612 175
30 iso_pu_bacteria 2765235841 2765586525 175
31 iso_pu_bacteria 2952252522 2952254403 175
32 iso_pu_bacteria 8054929484 8054934110 175
33 iso_pu_bacteria 2511231024 2511377233 176
34 iso_pu_bacteria 2599185324 2600071493 176
35 iso_pu_bacteria 2842854478 2842858804 176
36 iso_pu_bacteria 2945874760 2945877053 176
37 iso_pu_bacteria 651053060 651173957 176
38 iso_pu_bacteria 8056143049 8056143564 176
39 3300005335 Ga0070666_10197286 Ga0070666_101972862 177
40 3300005345 Ga0070692_10073725 Ga0070692_100737252 177
41 3300006358 Ga0068871_100176619 Ga0068871_1001766193 177
42 3300025931 Ga0207644_10405968 Ga0207644_104059682 177
43 3300026121 Ga0207683_10107436 Ga0207683_101074363 177
44 3300030500 Ga0268256_1040518 Ga0268256_10405182 177
45 3300031548 Ga0307408_100221213 Ga0307408_1002212131 177
46 3300048913 Ga0496110_0442389 Ga0496110_0442389_268_837 177
47 3300049585 Ga0501069_0443651 Ga0501069_0443651_190_744 177
48 iso_pu_bacteria 2894023352 2894023916 177
49 iso_pu_bacteria 2974320154 2974320701 177
50 iso_pu_bacteria 3007872151 3007872552 177
51 iso_pu_bacteria 8056115690 8056116067 177
52 iso_pu_bacteria 8056137416 8056142730 177
53 3300037418 Ga0395900_0057726 Ga0395900_0057726_2607_3164 178
54 3300037466 Ga0395898_1230002 Ga0395898_1230002_92_649 178
55 3300037471 Ga0395905_0172333 Ga0395905_0172333_274_831 178
56 3300046462 Ga0495651_0399450 Ga0495651_0399450_183_743 178
57 3300048909 Ga0496106_0156761 Ga0496106_0156761_1193_1732 178
58 3300048929 Ga0496126_0082324 Ga0496126_0082324_726_1265 178
59 3300049656 Ga0501209_000471 Ga0501209_000471_209_748 178
60 3300053085 Ga0495619_0034199 Ga0495619_0034199_1538_2113 178
61 iso_pu_bacteria 2511231002 2511246735 178
62 iso_pu_bacteria 2599185299 2599926366 178
63 iso_pu_bacteria 2643221658 2644325710 178
64 iso_pu_bacteria 2643221672 2644400905 178
65 iso_pu_bacteria 2808606414 2809125573 178
66 iso_pu_bacteria 2838054893 2838054985 178
67 iso_pu_bacteria 2855730933 2855735474 178
68 iso_pu_bacteria 2855767633 2855771257 178
69 iso_pu_bacteria 2881412998 2881416878 178
70 iso_pu_bacteria 2885192300 2885196516 178
71 iso_pu_bacteria 2899924645 2899927050 178
72 iso_pu_bacteria 2904541872 2904545924 178
73 iso_pu_bacteria 2928037797 2928043911 178
74 iso_pu_bacteria 2928044640 2928048559 178
75 iso_pu_bacteria 2928064002 2928068314 178
76 iso_pu_bacteria 2939631187 2939634171 178
77 iso_pu_bacteria 2945909444 2945914412 178
78 iso_pu_bacteria 2954767861 2954770467 178
79 3300003771 Ga0055526_1023702 Ga0055526_10237022 179
80 3300003856 Ga0058692_1001916 Ga0058692_10019163 179
81 3300005327 Ga0070658_10231535 Ga0070658_102315352 179
82 3300005327 Ga0070658_11098751 Ga0070658_110987511 179
83 3300005336 Ga0070680_100673583 Ga0070680_1006735832 179
84 3300005366 Ga0070659_100169343 Ga0070659_1001693432 179
85 3300005366 Ga0070659_100496837 Ga0070659_1004968372 179
86 3300005563 Ga0068855_100308763 Ga0068855_1003087632 179
87 3300005564 Ga0070664_100036216 Ga0070664_1000362163 179
88 3300006946 Ga0079104_1015671 Ga0079104_10156712 179
89 3300009093 Ga0105240_10281846 Ga0105240_102818462 179
90 3300009545 Ga0105237_10844684 Ga0105237_108446842 179
91 3300025256 Ga0209759_1000443 Ga0209759_100044341 179
92 3300025295 Ga0209564_1000211 Ga0209564_100021182 179
93 3300025299 Ga0209256_1031276 Ga0209256_10312762 179
94 3300025909 Ga0207705_10009877 Ga0207705_100098772 179
95 3300025909 Ga0207705_10433426 Ga0207705_104334261 179
96 3300025919 Ga0207657_10031595 Ga0207657_100315954 179
97 3300025932 Ga0207690_10016600 Ga0207690_100166002 179
98 3300025945 Ga0207679_10019330 Ga0207679_100193304 179
99 3300026089 Ga0207648_11003199 Ga0207648_110031992 179
100 3300027111 Ga0209281_1017093 Ga0209281_10170932 179
101 3300027312 Ga0209371_1002065 Ga0209371_10020655 179
102 3300027682 Ga0209971_1036256 Ga0209971_10362562 179
103 3300030500 Ga0268256_1001820 Ga0268256_10018208 179
104 3300031456 Ga0307513_10000090 Ga0307513_10000090107 179
105 3300031548 Ga0307408_100004769 Ga0307408_1000047696 179
106 3300031901 Ga0307406_10023076 Ga0307406_100230763 179
107 3300044673 Ga0453683_0031032 Ga0453683_0031032_998_1540 179
108 3300045051 Ga0451576_0000006 Ga0451576_0000006_666411_666953 179
109 3300047319 Ga0495674_0046206 Ga0495674_0046206_2054_2596 179
110 3300048913 Ga0496110_0017273 Ga0496110_0017273_944_1486 179
111 3300048919 Ga0496116_0003742 Ga0496116_0003742_10554_11096 179
112 3300048925 Ga0496122_0027806 Ga0496122_0027806_2026_2568 179
113 3300048925 Ga0496122_0042526 Ga0496122_0042526_174_716 179
114 3300048926 Ga0496123_0048155 Ga0496123_0048155_1532_2074 179
115 3300048927 Ga0496124_0004968 Ga0496124_0004968_4014_4556 179
116 3300048927 Ga0496124_0044465 Ga0496124_0044465_3154_3696 179
117 3300048928 Ga0496125_0019153 Ga0496125_0019153_1397_1939 179
118 3300048929 Ga0496126_0007686 Ga0496126_0007686_10323_10865 179
119 3300048929 Ga0496126_0013589 Ga0496126_0013589_2359_2901 179
120 3300049523 Ga0501300_004212 Ga0501300_004212_720_1271 179
121 3300049776 Ga0501280_000360 Ga0501280_000360_6828_7379 179
122 3300049778 Ga0501282_000253 Ga0501282_000253_2349_2900 179
123 iso_pu_bacteria 2791355137 2792839625 179
124 iso_pu_bacteria 8003400568 8003400990 179
125 3300005327 Ga0070658_10084195 Ga0070658_100841953 180
126 3300005331 Ga0070670_100199097 Ga0070670_1001990972 180
127 3300005338 Ga0068868_100063332 Ga0068868_1000633324 180
128 3300005347 Ga0070668_100004017 Ga0070668_1000040177 180
129 3300005353 Ga0070669_100021996 Ga0070669_1000219962 180
130 3300005355 Ga0070671_100104464 Ga0070671_1001044641 180
131 3300005364 Ga0070673_100430724 Ga0070673_1004307242 180
132 3300005459 Ga0068867_100536851 Ga0068867_1005368512 180
133 3300005548 Ga0070665_100717328 Ga0070665_1007173282 180
134 3300005617 Ga0068859_100027883 Ga0068859_1000278835 180
135 3300005618 Ga0068864_100511018 Ga0068864_1005110181 180
136 3300005841 Ga0068863_100041190 Ga0068863_1000411903 180
137 3300006195 Ga0075366_10004140 Ga0075366_100041408 180
138 3300006931 Ga0097620_100027883 Ga0097620_1000278835 180
139 3300009098 Ga0105245_10024461 Ga0105245_100244615 180
140 3300013104 Ga0157370_10721703 Ga0157370_107217032 180
141 3300013306 Ga0163162_11382568 Ga0163162_113825682 180
142 3300014326 Ga0157380_10046775 Ga0157380_100467753 180
143 3300014968 Ga0157379_10317750 Ga0157379_103177502 180
144 3300015261 Ga0182006_1046930 Ga0182006_10469302 180
145 3300025728 Ga0207655_1014470 Ga0207655_10144703 180
146 3300025728 Ga0207655_1015600 Ga0207655_10156002 180
147 3300025728 Ga0207655_1042654 Ga0207655_10426542 180
148 3300025735 Ga0207713_1044200 Ga0207713_10442002 180
149 3300025939 Ga0207665_10127675 Ga0207665_101276752 180
150 3300025960 Ga0207651_10254335 Ga0207651_102543352 180
151 3300026035 Ga0207703_10272505 Ga0207703_102725052 180
152 3300026088 Ga0207641_11020022 Ga0207641_110200222 180
153 3300026089 Ga0207648_10387506 Ga0207648_103875062 180
154 3300027312 Ga0209371_1011923 Ga0209371_10119233 180
155 3300028379 Ga0268266_10431861 Ga0268266_104318612 180
156 3300028381 Ga0268264_10181511 Ga0268264_101815112 180
157 3300030500 Ga0268256_1008847 Ga0268256_10088473 180
158 3300031548 Ga0307408_100001094 Ga0307408_10000109419 180
159 3300031730 Ga0307516_10000845 Ga0307516_100008457 180
160 3300031731 Ga0307405_10023166 Ga0307405_100231663 180
161 3300031824 Ga0307413_10029678 Ga0307413_100296782 180
162 3300031901 Ga0307406_10029447 Ga0307406_100294473 180
163 3300031903 Ga0307407_10723770 Ga0307407_107237701 180
164 3300031911 Ga0307412_10001117 Ga0307412_100011174 180
165 3300031995 Ga0307409_101112514 Ga0307409_1011125142 180
166 3300032002 Ga0307416_100317622 Ga0307416_1003176222 180
167 3300032004 Ga0307414_10025459 Ga0307414_100254592 180
168 3300032005 Ga0307411_10078563 Ga0307411_100785632 180
169 3300042013 Ga0439456_000183 Ga0439456_000183_14874_15419 180
170 3300042016 Ga0439463_127403 Ga0439463_127403_28_573 180
171 3300042876 Ga0451577_0001405 Ga0451577_0001405_797_1342 180
172 3300042876 Ga0451577_0006621 Ga0451577_0006621_8312_8857 180
173 3300044673 Ga0453683_0365171 Ga0453683_0365171_109_654 180
174 3300044712 Ga0453684_0361908 Ga0453684_0361908_687_1232 180
175 3300044712 Ga0453684_0482073 Ga0453684_0482073_195_740 180
176 3300045051 Ga0451576_0009603 Ga0451576_0009603_1397_1942 180
177 3300046460 Ga0495638_0030235 Ga0495638_0030235_194_736 180
178 3300046474 Ga0495605_0044460 Ga0495605_0044460_187_732 180
179 3300046474 Ga0495605_0084553 Ga0495605_0084553_371_913 180
180 3300046501 Ga0495607_0007590 Ga0495607_0007590_186_728 180
181 3300046506 Ga0495583_0005479 Ga0495583_0005479_1943_2485 180
182 3300046513 Ga0495616_0001520 Ga0495616_0001520_15212_15754 180
183 3300046523 Ga0495644_0000166 Ga0495644_0000166_17733_18275 180
184 3300046524 Ga0495648_0001988 Ga0495648_0001988_17953_18495 180
185 3300046538 Ga0495609_0004055 Ga0495609_0004055_250_792 180
186 3300046616 Ga0495668_0035448 Ga0495668_0035448_1289_1834 180
187 3300046648 Ga0495611_0000500 Ga0495611_0000500_15180_15722 180
188 3300046664 Ga0495659_0006855 Ga0495659_0006855_1320_1862 180
189 3300046665 Ga0495661_0062473 Ga0495661_0062473_1067_1609 180
190 3300046691 Ga0495670_0024030 Ga0495670_0024030_1532_2074 180
191 3300046692 Ga0495671_0006377 Ga0495671_0006377_186_728 180
192 3300046794 Ga0495589_0183731 Ga0495589_0183731_267_809 180
193 3300047318 Ga0495636_0000545 Ga0495636_0000545_6755_7297 180
194 3300047320 Ga0495672_0010237 Ga0495672_0010237_193_735 180
195 3300047323 Ga0495683_0002902 Ga0495683_0002902_9348_9890 180
196 3300047443 Ga0495687_001895 Ga0495687_001895_197_739 180
197 3300047445 Ga0495677_0031483 Ga0495677_0031483_232_774 180
198 3300047447 Ga0495685_000008 Ga0495685_000008_11464_12006 180
199 3300047472 Ga0495686_0281098 Ga0495686_0281098_85_627 180
200 3300048923 Ga0496120_0027735 Ga0496120_0027735_2171_2719 180
201 3300048927 Ga0496124_0115714 Ga0496124_0115714_1560_2108 180
202 3300048929 Ga0496126_0000865 Ga0496126_0000865_35976_36524 180
203 3300049459 Ga0495678_011163 Ga0495678_011163_3003_3545 180
204 3300049460 Ga0495682_0000064 Ga0495682_0000064_11726_12268 180
205 3300049589 Ga0501073_0432436 Ga0501073_0432436_200_742 180
206 3300049681 Ga0501251_015523 Ga0501251_015523_246_791 180
207 3300049853 Ga0501226_002279 Ga0501226_002279_1622_2167 180
208 3300050493 nmdc:mga0k408_4058_c1 nmdc:mga0k408_4058_c1_6643_7191 180
209 3300003187 JGI25151J46595_10000935 JGI25151J46595_1000093522 181
210 3300003781 Ga0055536_1000022 Ga0055536_100002252 181
211 3300003792 Ga0055540_1007554 Ga0055540_10075542 181
212 3300003794 Ga0055531_10000257 Ga0055531_100002577 181
213 3300005445 Ga0070708_101022127 Ga0070708_1010221271 181
214 3300006844 Ga0075428_100028212 Ga0075428_1000282122 181
215 3300006847 Ga0075431_100502114 Ga0075431_1005021141 181
216 3300006880 Ga0075429_100018939 Ga0075429_1000189396 181
217 3300009147 Ga0114129_10023178 Ga0114129_100231785 181
218 3300009174 Ga0105241_10033513 Ga0105241_100335135 181
219 3300009545 Ga0105237_10265310 Ga0105237_102653103 181
220 3300009551 Ga0105238_10416484 Ga0105238_104164842 181
221 3300013104 Ga0157370_10002225 Ga0157370_100022252 181
222 3300014497 Ga0182008_10088916 Ga0182008_100889162 181
223 3300015262 Ga0182007_10168897 Ga0182007_101688971 181
224 3300025273 Ga0209673_1005958 Ga0209673_10059582 181
225 3300025292 Ga0209676_1000012 Ga0209676_1000012623 181
226 3300025294 Ga0209025_1000124 Ga0209025_100012489 181
227 3300025303 Ga0209051_1000025 Ga0209051_100002551 181
228 3300025303 Ga0209051_1066091 Ga0209051_10660912 181
229 3300025304 Ga0209257_1000039 Ga0209257_1000039557 181
230 3300025924 Ga0207694_10259581 Ga0207694_102595812 181
231 3300026041 Ga0207639_10163482 Ga0207639_101634822 181
232 3300031456 Ga0307513_10000008 Ga0307513_1000000829 181
233 3300032002 Ga0307416_100519975 Ga0307416_1005199752 181
234 3300037312 Ga0395899_0001811 Ga0395899_0001811_4131_4676 181
235 3300037418 Ga0395900_0164753 Ga0395900_0164753_719_1264 181
236 3300037466 Ga0395898_0049874 Ga0395898_0049874_2836_3381 181
237 3300037471 Ga0395905_0600124 Ga0395905_0600124_140_697 181
238 3300037853 Ga0436364_1233550 Ga0436364_1233550_1501_2052 181
239 3300038443 Ga0395901_0064008 Ga0395901_0064008_3148_3693 181
240 3300041486 Ga0451807_1110695 Ga0451807_1110695_33_578 181
241 3300041511 Ga0451855_1957971 Ga0451855_1957971_28_576 181
242 3300042007 Ga0439449_0001237 Ga0439449_0001237_2495_3040 181
243 3300042015 Ga0439462_0007797 Ga0439462_0007797_796_1341 181
244 3300042115 Ga0450911_000126 Ga0450911_000126_19467_20012 181
245 3300044656 Ga0466969_0189416 Ga0466969_0189416_100_657 181
246 3300044658 Ga0466972_0002243 Ga0466972_0002243_939_1571 181
247 3300044712 Ga0453684_0079806 Ga0453684_0079806_803_1390 181
248 3300044712 Ga0453684_0338235 Ga0453684_0338235_1063_1611 181
249 3300044735 Ga0466968_0061422 Ga0466968_0061422_277_909 181
250 3300044842 Ga0466957_0000568 Ga0466957_0000568_2685_3317 181
251 3300044842 Ga0466957_0606387 Ga0466957_0606387_85_660 181
252 3300044842 Ga0466957_0796295 Ga0466957_0796295_46_603 181
253 3300045049 Ga0466959_0001298 Ga0466959_0001298_8930_9562 181
254 3300045051 Ga0451576_0290057 Ga0451576_0290057_610_1155 181
255 3300045836 Ga0466958_0787304 Ga0466958_0787304_31_588 181
256 3300045976 Ga0466967_0002897 Ga0466967_0002897_2982_3614 181
257 3300045976 Ga0466967_0135637 Ga0466967_0135637_1364_1939 181
258 3300046457 Ga0495590_0013419 Ga0495590_0013419_663_1214 181
259 3300046474 Ga0495605_0000747 Ga0495605_0000747_3542_4093 181
260 3300046491 Ga0495584_0000285 Ga0495584_0000285_23666_24217 181
261 3300046519 Ga0495632_0000527 Ga0495632_0000527_23648_24199 181
262 3300046522 Ga0495643_0001350 Ga0495643_0001350_19010_19561 181
263 3300046528 Ga0495642_0000096 Ga0495642_0000096_30201_30752 181
264 3300046538 Ga0495609_0000396 Ga0495609_0000396_23511_24062 181
265 3300046542 Ga0495597_0041376 Ga0495597_0041376_890_1441 181
266 3300046694 Ga0495649_0000432 Ga0495649_0000432_12019_12570 181
267 3300046794 Ga0495589_0003288 Ga0495589_0003288_6840_7391 181
268 3300047318 Ga0495636_0000191 Ga0495636_0000191_19642_20193 181
269 3300047320 Ga0495672_0001359 Ga0495672_0001359_19843_20394 181
270 3300047445 Ga0495677_0291999 Ga0495677_0291999_37_582 181
271 3300048090 Ga0495615_0013776 Ga0495615_0013776_125_670 181
272 3300048091 Ga0495626_0000699 Ga0495626_0000699_19768_20319 181
273 3300048909 Ga0496106_0000058 Ga0496106_0000058_48300_48851 181
274 3300048914 Ga0496111_0181455 Ga0496111_0181455_336_884 181
275 3300048920 Ga0496117_0044240 Ga0496117_0044240_2232_2783 181
276 3300048921 Ga0496118_0045814 Ga0496118_0045814_2308_2859 181
277 3300048921 Ga0496118_0104155 Ga0496118_0104155_1131_1682 181
278 3300048924 Ga0496121_0001067 Ga0496121_0001067_4615_5166 181
279 3300048924 Ga0496121_0007659 Ga0496121_0007659_2384_2929 181
280 3300048924 Ga0496121_0039261 Ga0496121_0039261_2353_2898 181
281 3300048928 Ga0496125_0001710 Ga0496125_0001710_13072_13617 181
282 3300048928 Ga0496125_0006853 Ga0496125_0006853_3217_3768 181
283 3300048929 Ga0496126_0288949 Ga0496126_0288949_222_773 181
284 3300049459 Ga0495678_000569 Ga0495678_000569_22726_23277 181
285 3300049460 Ga0495682_0000651 Ga0495682_0000651_19262_19813 181
286 3300049572 Ga0501036_0088114 Ga0501036_0088114_567_1130 181
287 3300049573 Ga0501037_0236489 Ga0501037_0236489_658_1203 181
288 3300049577 Ga0501041_0129272 Ga0501041_0129272_704_1267 181
289 3300049591 Ga0501075_0143883 Ga0501075_0143883_711_1274 181
290 3300049741 Ga0501079_0154573 Ga0501079_0154573_1191_1754 181
291 3300050507 nmdc:mga05p37_11514_c1 nmdc:mga05p37_11514_c1_1941_2489 181
292 3300050508 nmdc:mga09592_18245_c1 nmdc:mga09592_18245_c1_3451_3999 181
293 3300050510 nmdc:mga06r32_466683_c1 nmdc:mga06r32_466683_c1_95_640 181
294 3300053079 Ga0500610_0000065 Ga0500610_0000065_25810_26355 181
295 3300053079 Ga0500610_0019685 Ga0500610_0019685_711_1256 181
296 3300053109 Ga0500569_056177 Ga0500569_056177_466_1011 181
297 3300053117 Ga0500593_000117 Ga0500593_000117_10101_10646 181
298 3300053117 Ga0500593_003708 Ga0500593_003708_2325_2873 181
299 3300053161 Ga0500634_0002525 Ga0500634_0002525_2365_2910 181
300 3300054114 Ga0501084_0202181 Ga0501084_0202181_1077_1640 181
301 3300060353 Ga0501082_1292214 Ga0501082_1292214_41_604 181
302 3300061734 Ga0530510_0957834 Ga0530510_0957834_23_586 181
303 3300002987 JGI25159J45721_1000074 JGI25159J45721_100007441 182
304 3300002987 JGI25159J45721_1000713 JGI25159J45721_10007132 182
305 3300002987 JGI25159J45721_1011365 JGI25159J45721_10113652 182
306 3300003187 JGI25151J46595_10000281 JGI25151J46595_1000028147 182
307 3300003187 JGI25151J46595_10001155 JGI25151J46595_1000115516 182
308 3300003187 JGI25151J46595_10001333 JGI25151J46595_100013333 182
309 3300003187 JGI25151J46595_10005180 JGI25151J46595_100051806 182
310 3300003187 JGI25151J46595_10010457 JGI25151J46595_100104575 182
311 3300003215 JGI25153J46596_10000994 JGI25153J46596_1000099412 182
312 3300003308 Ga0006777J48905_1115107 Ga0006777J48905_11151072 182
313 3300003316 rootH1_10052883 rootH1_100528832 182
314 3300003322 rootL2_10001457 rootL2_1000145799 182
315 3300003323 rootH1_10016403 rootH1_100164033 182
316 3300003354 JGI25160J50197_1000106 JGI25160J50197_100010671 182
317 3300003354 JGI25160J50197_1000677 JGI25160J50197_10006774 182
318 3300003374 JGI25161J50226_1000041 JGI25161J50226_1000041111 182
319 3300003374 JGI25161J50226_1002438 JGI25161J50226_10024382 182
320 3300003759 Ga0055525_1000004 Ga0055525_1000004524 182
321 3300003771 Ga0055526_1000857 Ga0055526_10008574 182
322 3300003771 Ga0055526_1059064 Ga0055526_10590641 182
323 3300003773 Ga0055537_1000740 Ga0055537_10007402 182
324 3300003773 Ga0055537_1000906 Ga0055537_10009062 182
325 3300003775 Ga0055524_1000915 Ga0055524_10009152 182
326 3300003775 Ga0055524_1031142 Ga0055524_10311422 182
327 3300003784 Ga0055534_1000554 Ga0055534_10005543 182
328 3300003784 Ga0055534_1000687 Ga0055534_10006872 182
329 3300003784 Ga0055534_1002035 Ga0055534_10020355 182
330 3300003784 Ga0055534_1010398 Ga0055534_10103982 182
331 3300003790 Ga0055528_1001217 Ga0055528_10012172 182
332 3300003791 Ga0055530_10003228 Ga0055530_100032288 182
333 3300003792 Ga0055540_1000821 Ga0055540_10008214 182
334 3300003794 Ga0055531_10001061 Ga0055531_1000106115 182
335 3300004625 Ga0055543_1000092 Ga0055543_100009262 182
336 3300004625 Ga0055543_1000801 Ga0055543_10008012 182
337 3300004625 Ga0055543_1016654 Ga0055543_10166542 182
338 3300005262 Ga0065165_1000492 Ga0065165_10004923 182
339 3300005262 Ga0065165_1002142 Ga0065165_10021425 182
340 3300005262 Ga0065165_1002576 Ga0065165_10025763 182
341 3300005327 Ga0070658_10191418 Ga0070658_101914182 182
342 3300005327 Ga0070658_10392212 Ga0070658_103922122 182
343 3300005331 Ga0070670_100228166 Ga0070670_1002281662 182
344 3300005334 Ga0068869_100176384 Ga0068869_1001763842 182
345 3300005338 Ga0068868_100107535 Ga0068868_1001075352 182
346 3300005353 Ga0070669_100390838 Ga0070669_1003908382 182
347 3300005355 Ga0070671_100104920 Ga0070671_1001049202 182
348 3300005457 Ga0070662_100180304 Ga0070662_1001803042 182
349 3300005459 Ga0068867_100062241 Ga0068867_1000622412 182
350 3300005543 Ga0070672_100471152 Ga0070672_1004711522 182
351 3300005563 Ga0068855_100248217 Ga0068855_1002482172 182
352 3300005564 Ga0070664_100286439 Ga0070664_1002864392 182
353 3300005618 Ga0068864_100027620 Ga0068864_1000276202 182
354 3300005834 Ga0068851_10002637 Ga0068851_100026373 182
355 3300005841 Ga0068863_100048910 Ga0068863_1000489105 182
356 3300006038 Ga0075365_10542694 Ga0075365_105426941 182
357 3300006042 Ga0075368_10115599 Ga0075368_101155992 182
358 3300006048 Ga0075363_100009562 Ga0075363_1000095623 182
359 3300006353 Ga0075370_10183896 Ga0075370_101838962 182
360 3300006353 Ga0075370_10301827 Ga0075370_103018272 182
361 3300006881 Ga0068865_100575783 Ga0068865_1005757832 182
362 3300006946 Ga0079104_1028083 Ga0079104_10280831 182
363 3300009011 Ga0105251_10001421 Ga0105251_100014212 182
364 3300009036 Ga0105244_10003335 Ga0105244_100033359 182
365 3300009036 Ga0105244_10314278 Ga0105244_103142781 182
366 3300009093 Ga0105240_10147889 Ga0105240_101478893 182
367 3300009094 Ga0111539_10620344 Ga0111539_106203441 182
368 3300009148 Ga0105243_10004984 Ga0105243_100049842 182
369 3300009176 Ga0105242_10022682 Ga0105242_100226826 182
370 3300009177 Ga0105248_10995055 Ga0105248_109950552 182
371 3300009177 Ga0105248_11304130 Ga0105248_113041301 182
372 3300009545 Ga0105237_10026158 Ga0105237_100261586 182
373 3300009551 Ga0105238_10263704 Ga0105238_102637043 182
374 3300009551 Ga0105238_10398196 Ga0105238_103981961 182
375 3300011119 Ga0105246_10030410 Ga0105246_100304102 182
376 3300012502 Ga0157347_1000148 Ga0157347_10001483 182
377 3300013100 Ga0157373_10011431 Ga0157373_100114316 182
378 3300013100 Ga0157373_10048731 Ga0157373_100487312 182
379 3300013104 Ga0157370_10307509 Ga0157370_103075092 182
380 3300013104 Ga0157370_10370343 Ga0157370_103703432 182
381 3300013105 Ga0157369_10000138 Ga0157369_1000013858 182
382 3300013105 Ga0157369_10001085 Ga0157369_100010855 182
383 3300013296 Ga0157374_10112840 Ga0157374_101128403 182
384 3300013297 Ga0157378_10208955 Ga0157378_102089552 182
385 3300013306 Ga0163162_10471239 Ga0163162_104712392 182
386 3300013307 Ga0157372_10036646 Ga0157372_100366462 182
387 3300013308 Ga0157375_10061000 Ga0157375_100610002 182
388 3300014325 Ga0163163_10484298 Ga0163163_104842982 182
389 3300014326 Ga0157380_10513522 Ga0157380_105135222 182
390 3300014497 Ga0182008_10000156 Ga0182008_1000015618 182
391 3300014497 Ga0182008_10000188 Ga0182008_1000018834 182
392 3300014497 Ga0182008_10220422 Ga0182008_102204222 182
393 3300014969 Ga0157376_10457054 Ga0157376_104570542 182
394 3300015261 Ga0182006_1000014 Ga0182006_100001488 182
395 3300015261 Ga0182006_1014460 Ga0182006_10144603 182
396 3300015262 Ga0182007_10072352 Ga0182007_100723521 182
397 3300015683 Ga0183362_10005 Ga0183362_1000556 182
398 3300017792 Ga0163161_10082801 Ga0163161_100828013 182
399 3300017792 Ga0163161_10263690 Ga0163161_102636902 182
400 3300021361 Ga0213872_10000036 Ga0213872_100000367 182
401 3300025208 Ga0209436_100453 Ga0209436_1004533 182
402 3300025258 Ga0209129_1000954 Ga0209129_100095412 182
403 3300025263 Ga0209565_1000752 Ga0209565_100075212 182
404 3300025263 Ga0209565_1000869 Ga0209565_10008695 182
405 3300025273 Ga0209673_1000578 Ga0209673_100057825 182
406 3300025273 Ga0209673_1006531 Ga0209673_10065312 182
407 3300025284 Ga0209130_1000099 Ga0209130_100009925 182
408 3300025284 Ga0209130_1000551 Ga0209130_100055129 182
409 3300025284 Ga0209130_1001244 Ga0209130_100124410 182
410 3300025284 Ga0209130_1036408 Ga0209130_10364082 182
411 3300025291 Ga0209675_1000546 Ga0209675_100054616 182
412 3300025291 Ga0209675_1000720 Ga0209675_100072015 182
413 3300025291 Ga0209675_1000990 Ga0209675_100099011 182
414 3300025291 Ga0209675_1001398 Ga0209675_10013982 182
415 3300025292 Ga0209676_1001174 Ga0209676_100117414 182
416 3300025292 Ga0209676_1001483 Ga0209676_10014834 182
417 3300025292 Ga0209676_1009702 Ga0209676_10097022 182
418 3300025292 Ga0209676_1013029 Ga0209676_10130293 182
419 3300025294 Ga0209025_1000039 Ga0209025_1000039111 182
420 3300025294 Ga0209025_1001144 Ga0209025_100114420 182
421 3300025294 Ga0209025_1001306 Ga0209025_100130614 182
422 3300025294 Ga0209025_1002293 Ga0209025_100229314 182
423 3300025294 Ga0209025_1008688 Ga0209025_10086886 182
424 3300025295 Ga0209564_1000108 Ga0209564_100010872 182
425 3300025295 Ga0209564_1002628 Ga0209564_10026289 182
426 3300025297 Ga0209758_1002709 Ga0209758_100270912 182
427 3300025298 Ga0209050_1000366 Ga0209050_100036662 182
428 3300025298 Ga0209050_1000662 Ga0209050_100066233 182
429 3300025298 Ga0209050_1044661 Ga0209050_10446612 182
430 3300025298 Ga0209050_1057919 Ga0209050_10579192 182
431 3300025299 Ga0209256_1000101 Ga0209256_100010186 182
432 3300025299 Ga0209256_1004481 Ga0209256_10044812 182
433 3300025302 Ga0207426_1000062 Ga0207426_1000062190 182
434 3300025302 Ga0207426_1000086 Ga0207426_1000086216 182
435 3300025302 Ga0207426_1000351 Ga0207426_100035153 182
436 3300025303 Ga0209051_1000186 Ga0209051_100018698 182
437 3300025303 Ga0209051_1000537 Ga0209051_100053710 182
438 3300025303 Ga0209051_1000924 Ga0209051_100092415 182
439 3300025303 Ga0209051_1021493 Ga0209051_10214932 182
440 3300025303 Ga0209051_1044351 Ga0209051_10443512 182
441 3300025303 Ga0209051_1084691 Ga0209051_10846912 182
442 3300025304 Ga0209257_1000516 Ga0209257_100051645 182
443 3300025304 Ga0209257_1017312 Ga0209257_10173122 182
444 3300025304 Ga0209257_1040014 Ga0209257_10400142 182
445 3300025321 Ga0207656_10004263 Ga0207656_100042636 182
446 3300025728 Ga0207655_1002241 Ga0207655_10022419 182
447 3300025735 Ga0207713_1024387 Ga0207713_10243873 182
448 3300025907 Ga0207645_10367545 Ga0207645_103675452 182
449 3300025909 Ga0207705_10163856 Ga0207705_101638562 182
450 3300025911 Ga0207654_10878730 Ga0207654_108787301 182
451 3300025913 Ga0207695_10555858 Ga0207695_105558581 182
452 3300025914 Ga0207671_10080650 Ga0207671_100806502 182
453 3300025920 Ga0207649_10813483 Ga0207649_108134831 182
454 3300025923 Ga0207681_10758591 Ga0207681_107585912 182
455 3300025925 Ga0207650_10268693 Ga0207650_102686932 182
456 3300025931 Ga0207644_10197118 Ga0207644_101971182 182
457 3300025934 Ga0207686_10004128 Ga0207686_100041282 182
458 3300025935 Ga0207709_10000395 Ga0207709_1000039517 182
459 3300025935 Ga0207709_10009049 Ga0207709_100090492 182
460 3300025938 Ga0207704_10193823 Ga0207704_101938232 182
461 3300025940 Ga0207691_10207211 Ga0207691_102072112 182
462 3300025940 Ga0207691_10323881 Ga0207691_103238812 182
463 3300025941 Ga0207711_10022681 Ga0207711_100226813 182
464 3300025941 Ga0207711_10172764 Ga0207711_101727641 182
465 3300025941 Ga0207711_10241784 Ga0207711_102417842 182
466 3300025942 Ga0207689_10473594 Ga0207689_104735942 182
467 3300025945 Ga0207679_10064896 Ga0207679_100648963 182
468 3300025949 Ga0207667_10137473 Ga0207667_101374732 182
469 3300025986 Ga0207658_10334963 Ga0207658_103349632 182
470 3300026089 Ga0207648_10024407 Ga0207648_100244072 182
471 3300026095 Ga0207676_10186965 Ga0207676_101869652 182
472 3300026142 Ga0207698_10689675 Ga0207698_106896752 182
473 3300027666 Ga0209282_1000064 Ga0209282_100006451 182
474 3300027866 Ga0209813_10103584 Ga0209813_101035842 182
475 3300028379 Ga0268266_10302476 Ga0268266_103024762 182
476 3300028794 Ga0307515_10007523 Ga0307515_100075233 182
477 3300028794 Ga0307515_10352587 Ga0307515_103525872 182
478 3300030742 Ga0316183_1105275 Ga0316183_11052752 182
479 3300031238 Ga0265332_10032458 Ga0265332_100324583 182
480 3300031251 Ga0265327_10002512 Ga0265327_100025123 182
481 3300031251 Ga0265327_10003400 Ga0265327_100034003 182
482 3300031456 Ga0307513_10024220 Ga0307513_100242207 182
483 3300031456 Ga0307513_10042159 Ga0307513_100421592 182
484 3300031548 Ga0307408_100488092 Ga0307408_1004880921 182
485 3300031548 Ga0307408_101444294 Ga0307408_1014442941 182
486 3300031712 Ga0265342_10261243 Ga0265342_102612432 182
487 3300031731 Ga0307405_10000696 Ga0307405_1000069611 182
488 3300031731 Ga0307405_10071753 Ga0307405_100717532 182
489 3300031731 Ga0307405_10205519 Ga0307405_102055191 182
490 3300031731 Ga0307405_10665360 Ga0307405_106653601 182
491 3300031911 Ga0307412_10036686 Ga0307412_100366863 182
492 3300031911 Ga0307412_10128660 Ga0307412_101286602 182
493 3300031911 Ga0307412_10516872 Ga0307412_105168722 182
494 3300032002 Ga0307416_100164655 Ga0307416_1001646553 182
495 3300032002 Ga0307416_100890514 Ga0307416_1008905142 182
496 3300032005 Ga0307411_10931186 Ga0307411_109311862 182
497 3300039447 Ga0436361_0931379 Ga0436361_0931379_1017_1571 182
498 3300041443 Ga0451789_1326119 Ga0451789_1326119_53_625 182
499 3300041498 Ga0451841_0879473 Ga0451841_0879473_61_633 182
500 3300041509 Ga0451843_1664536 Ga0451843_1664536_168_740 182
501 3300042007 Ga0439449_0011518 Ga0439449_0011518_641_1189 182
502 3300042010 Ga0439452_000001 Ga0439452_000001_1564056_1564619 182
503 3300042876 Ga0451577_0483823 Ga0451577_0483823_438_989 182
504 3300042876 Ga0451577_0686074 Ga0451577_0686074_179_739 182
505 3300042876 Ga0451577_0946058 Ga0451577_0946058_76_636 182
506 3300044673 Ga0453683_0007367 Ga0453683_0007367_1018_1584 182
507 3300044712 Ga0453684_0000066 Ga0453684_0000066_300666_301232 182
508 3300044712 Ga0453684_0425841 Ga0453684_0425841_550_1101 182
509 3300044712 Ga0453684_0653086 Ga0453684_0653086_218_778 182
510 3300044901 Ga0466960_0133327 Ga0466960_0133327_104_661 182
511 3300045051 Ga0451576_0017861 Ga0451576_0017861_5978_6544 182
512 3300045051 Ga0451576_0033048 Ga0451576_0033048_3738_4298 182
513 3300046453 Ga0495627_007933 Ga0495627_007933_2541_3089 182
514 3300046515 Ga0495620_0001167 Ga0495620_0001167_6874_7422 182
515 3300046524 Ga0495648_0216978 Ga0495648_0216978_82_630 182
516 3300046528 Ga0495642_0036878 Ga0495642_0036878_133_687 182
517 3300046539 Ga0495621_0037044 Ga0495621_0037044_794_1363 182
518 3300046660 Ga0495625_0172357 Ga0495625_0172357_145_693 182
519 3300046660 Ga0495625_0410639 Ga0495625_0410639_241_792 182
520 3300046674 Ga0495588_0027358 Ga0495588_0027358_1384_1932 182
521 3300046692 Ga0495671_0017797 Ga0495671_0017797_1149_1697 182
522 3300046694 Ga0495649_0250976 Ga0495649_0250976_233_787 182
523 3300047321 Ga0495676_0173611 Ga0495676_0173611_774_1322 182
524 3300048911 Ga0496108_0643426 Ga0496108_0643426_110_679 182
525 3300048914 Ga0496111_0147102 Ga0496111_0147102_38_589 182
526 3300048919 Ga0496116_0102357 Ga0496116_0102357_89_637 182
527 3300048919 Ga0496116_0108568 Ga0496116_0108568_1067_1618 182
528 3300048921 Ga0496118_0029317 Ga0496118_0029317_1043_1591 182
529 3300048921 Ga0496118_0319932 Ga0496118_0319932_46_600 182
530 3300048924 Ga0496121_0001565 Ga0496121_0001565_24174_24725 182
531 3300048924 Ga0496121_0002670 Ga0496121_0002670_25499_26047 182
532 3300048924 Ga0496121_0010210 Ga0496121_0010210_1197_1745 182
533 3300048924 Ga0496121_0022497 Ga0496121_0022497_3827_4375 182
534 3300048925 Ga0496122_0000184 Ga0496122_0000184_115837_116385 182
535 3300048925 Ga0496122_0024605 Ga0496122_0024605_3953_4507 182
536 3300048926 Ga0496123_0000181 Ga0496123_0000181_52784_53332 182
537 3300048926 Ga0496123_0016077 Ga0496123_0016077_3310_3864 182
538 3300048927 Ga0496124_0637679 Ga0496124_0637679_41_589 182
539 3300048928 Ga0496125_0002173 Ga0496125_0002173_21397_21951 182
540 3300048928 Ga0496125_0004639 Ga0496125_0004639_4965_5516 182
541 3300048928 Ga0496125_0015028 Ga0496125_0015028_6455_7003 182
542 3300048929 Ga0496126_0000184 Ga0496126_0000184_137620_138174 182
543 3300049517 Ga0501294_003487 Ga0501294_003487_40_591 182
544 3300049568 Ga0501031_0001212 Ga0501031_0001212_4184_4732 182
545 3300049568 Ga0501031_0035188 Ga0501031_0035188_866_1414 182
546 3300049569 Ga0501032_0000170 Ga0501032_0000170_20238_20786 182
547 3300049569 Ga0501032_0286253 Ga0501032_0286253_77_625 182
548 3300049570 Ga0501033_0001496 Ga0501033_0001496_15166_15714 182
549 3300049570 Ga0501033_0012221 Ga0501033_0012221_926_1474 182
550 3300049571 Ga0501034_0003948 Ga0501034_0003948_9427_9975 182
551 3300049572 Ga0501036_0003504 Ga0501036_0003504_11353_11901 182
552 3300049572 Ga0501036_0011422 Ga0501036_0011422_2615_3163 182
553 3300049572 Ga0501036_0014236 Ga0501036_0014236_4091_4639 182
554 3300049573 Ga0501037_0000691 Ga0501037_0000691_17515_18063 182
555 3300049573 Ga0501037_0202712 Ga0501037_0202712_518_1066 182
556 3300049574 Ga0501038_0001058 Ga0501038_0001058_18848_19396 182
557 3300049574 Ga0501038_0002695 Ga0501038_0002695_6190_6738 182
558 3300049575 Ga0501039_0015846 Ga0501039_0015846_270_818 182
559 3300049575 Ga0501039_0056179 Ga0501039_0056179_1315_1863 182
560 3300049576 Ga0501040_0002856 Ga0501040_0002856_9961_10509 182
561 3300049578 Ga0501042_0002804 Ga0501042_0002804_2290_2838 182
562 3300049579 Ga0501043_0002328 Ga0501043_0002328_8984_9532 182
563 3300049579 Ga0501043_0060611 Ga0501043_0060611_242_790 182
564 3300049580 Ga0501046_0000547 Ga0501046_0000547_9500_10048 182
565 3300049580 Ga0501046_0189853 Ga0501046_0189853_232_780 182
566 3300049581 Ga0501047_0055318 Ga0501047_0055318_2106_2654 182
567 3300049582 Ga0501048_0000431 Ga0501048_0000431_22728_23276 182
568 3300049649 Ga0501198_000001 Ga0501198_000001_125922_126473 182
569 3300049662 Ga0501222_000004 Ga0501222_000004_114898_115449 182
570 3300049669 Ga0501235_021690 Ga0501235_021690_289_837 182
571 3300049671 Ga0501238_020097 Ga0501238_020097_194_742 182
572 3300049762 Ga0501265_004690 Ga0501265_004690_258_821 182
573 3300049822 Ga0501035_0000444 Ga0501035_0000444_4125_4673 182
574 3300049822 Ga0501035_0016947 Ga0501035_0016947_4811_5359 182
575 3300049822 Ga0501035_0023282 Ga0501035_0023282_2362_2910 182
576 3300049822 Ga0501035_0034102 Ga0501035_0034102_1531_2079 182
577 3300049823 Ga0501044_0000699 Ga0501044_0000699_4367_4915 182
578 3300049823 Ga0501044_0001119 Ga0501044_0001119_26225_26773 182
579 3300049823 Ga0501044_0013984 Ga0501044_0013984_6977_7525 182
580 3300049824 Ga0501045_0000835 Ga0501045_0000835_9814_10362 182
581 3300050490 nmdc:mga03n38_20185_c1 nmdc:mga03n38_20185_c1_714_1262 182
582 3300050493 nmdc:mga0k408_33773_c1 nmdc:mga0k408_33773_c1_310_861 182
583 3300050493 nmdc:mga0k408_67455_c2 nmdc:mga0k408_67455_c2_469_1020 182
584 3300050494 nmdc:mga06z11_56688_c1 nmdc:mga06z11_56688_c1_256_804 182
585 3300050495 nmdc:mga04h51_23007_c1 nmdc:mga04h51_23007_c1_182_730 182
586 3300050496 nmdc:mga07m45_314819_c1 nmdc:mga07m45_314819_c1_101_649 182
587 3300050496 nmdc:mga07m45_5447_c1 nmdc:mga07m45_5447_c1_4131_4682 182
588 3300053079 Ga0500610_0000109 Ga0500610_0000109_23419_23967 182
589 3300053087 Ga0500643_003277 Ga0500643_003277_811_1359 182
590 3300053088 Ga0500644_0002709 Ga0500644_0002709_3522_4070 182
591 3300053111 Ga0500572_031369 Ga0500572_031369_875_1423 182
592 3300053121 Ga0500607_000706 Ga0500607_000706_21863_22411 182
593 3300053122 Ga0500608_000716 Ga0500608_000716_8206_8754 182
594 3300053133 Ga0500655_000071 Ga0500655_000071_597_1145 182
595 3300053136 Ga0500559_0092765 Ga0500559_0092765_200_748 182
596 3300053139 Ga0500568_0110561 Ga0500568_0110561_100_648 182
597 3300053141 Ga0500574_000131 Ga0500574_000131_816_1364 182
598 3300053158 Ga0500627_0000163 Ga0500627_0000163_3795_4343 182
599 3300053161 Ga0500634_0000678 Ga0500634_0000678_10473_11021 182
600 3300053162 Ga0500638_013878 Ga0500638_013878_488_1036 182
601 3300053177 Ga0500636_0273281 Ga0500636_0273281_104_652 182
602 3300053730 Ga0500645_000521 Ga0500645_000521_22941_23489 182
603 3300053730 Ga0500645_007029 Ga0500645_007029_617_1165 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

17

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.987 2 176
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.976 1 182
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9758 1 182
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9733 2 182
1ep0-assembly1.cif.gz_A high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum 0.9638 2 178
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9756 2 182 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9638 2 178 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9602 1 178 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9577 1 178 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9459 2 175 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A432R1U7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9997 45 176 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7C8XNS0-F1-model_v4 deleted 0.9977 44 168
AF-A0A0F8Z5C9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9955 40 176 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1F3TT77-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9951 1 177 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A5C7VRA9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.995 1 150 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Feature Viewer

pLDDT pTM Quality
96.41 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map