F468266
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 603 | 362 | 568 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10147889|Ga0105240_101478893 |
| Length | 196 |
| Sequence | LVCRVVFSEINAVQTFPTLIPDVLVIEPKVFGDARGFFLESFNQQAFSQALGFSVEFKQDNHSRSTKGVLRGLHYQVKQPQGKLVRVVRGAVFDVAVDIRPSSATFGKWVGVELNEDNHRQLWIPAGLAHGFLVLSETADFLYKTTDYYAPAYERSIAWNDPAIGIEWPLAGATPALSAKDAAALSLAESIAGEVF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 3 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 4 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 5 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 6 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 7 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 8 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 9 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 10 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 11 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 12 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 13 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 14 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 15 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 16 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 17 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 18 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 19 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 20 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 21 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 22 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 23 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 24 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 25 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 26 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 27 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 28 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 29 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 30 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 51 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 203 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 206 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 207 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 208 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 209 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 210 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 211 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 212 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 213 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 214 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 215 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 283 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 290 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 310 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 311 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 312 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 318 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 337 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 338 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 341 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 343 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 344 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 347 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 348 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 352 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 357 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 358 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 359 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 360 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 361 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 362 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.03 |
| Metatranscriptomes | 0.17 |
| Isolates | 5.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.89 |
| Nodule | 1.49 |
| Rhizoplane | 1.99 |
| Rhizosphere | 63.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1000074 | 3300002987 | Bacteria | 48266 |
| 2 | JGI25159J45721_1000713 | 3300002987 | Bacteria | 14514 |
| 3 | JGI25159J45721_1011365 | 3300002987 | Bacteria | 2188 |
| 4 | JGI25151J46595_10000281 | 3300003187 | Bacteria | 58019 |
| 5 | JGI25151J46595_10000935 | 3300003187 | Bacteria | 22615 |
| 6 | JGI25151J46595_10001155 | 3300003187 | Bacteria | 19111 |
| 7 | JGI25151J46595_10001333 | 3300003187 | Bacteria | 17247 |
| 8 | JGI25151J46595_10005180 | 3300003187 | Bacteria | 6765 |
| 9 | JGI25151J46595_10010457 | 3300003187 | Bacteria | 4312 |
| 10 | JGI25153J46596_10000994 | 3300003215 | Bacteria | 17227 |
| 11 | Ga0006777J48905_1115107 | 3300003308 | Bacteria | 1133 |
| 12 | rootH1_10052883 | 3300003316 | Bacteria | 6876 |
| 13 | rootH2_10023139 | 3300003320 | Bacteria | 3016 |
| 14 | rootL2_10001457 | 3300003322 | Bacteria | 117785 |
| 15 | rootH1_10016403 | 3300003323 | Bacteria | 11335 |
| 16 | JGI25160J50197_1000106 | 3300003354 | Bacteria | 80449 |
| 17 | JGI25160J50197_1000677 | 3300003354 | Bacteria | 18888 |
| 18 | JGI25161J50226_1000041 | 3300003374 | Bacteria | 124485 |
| 19 | JGI25161J50226_1002438 | 3300003374 | Bacteria | 4774 |
| 20 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 21 | Ga0055526_1000857 | 3300003771 | Bacteria | 22645 |
| 22 | Ga0055526_1023702 | 3300003771 | Bacteria | 2039 |
| 23 | Ga0055526_1059064 | 3300003771 | Bacteria | 827 |
| 24 | Ga0055537_1000740 | 3300003773 | Bacteria | 16735 |
| 25 | Ga0055537_1000906 | 3300003773 | Bacteria | 13986 |
| 26 | Ga0055524_1000915 | 3300003775 | Bacteria | 19046 |
| 27 | Ga0055524_1031142 | 3300003775 | Bacteria | 1539 |
| 28 | Ga0055536_1000022 | 3300003781 | Bacteria | 198244 |
| 29 | Ga0055534_1000554 | 3300003784 | Bacteria | 19780 |
| 30 | Ga0055534_1000687 | 3300003784 | Bacteria | 16711 |
| 31 | Ga0055534_1002035 | 3300003784 | Bacteria | 7328 |
| 32 | Ga0055534_1010398 | 3300003784 | Bacteria | 1952 |
| 33 | Ga0055528_1001217 | 3300003790 | Bacteria | 16493 |
| 34 | Ga0055530_10003228 | 3300003791 | Bacteria | 9525 |
| 35 | Ga0055540_1000821 | 3300003792 | Bacteria | 20906 |
| 36 | Ga0055540_1007554 | 3300003792 | Bacteria | 4072 |
| 37 | Ga0055531_10000257 | 3300003794 | Bacteria | 56547 |
| 38 | Ga0055531_10001061 | 3300003794 | Bacteria | 21644 |
| 39 | Ga0058692_1001916 | 3300003856 | Bacteria | 7271 |
| 40 | Ga0055543_1000092 | 3300004625 | Bacteria | 78538 |
| 41 | Ga0055543_1000801 | 3300004625 | Bacteria | 15548 |
| 42 | Ga0055543_1016654 | 3300004625 | Bacteria | 1395 |
| 43 | Ga0065165_1000492 | 3300005262 | Bacteria | 61002 |
| 44 | Ga0065165_1002142 | 3300005262 | Bacteria | 17905 |
| 45 | Ga0065165_1002576 | 3300005262 | Bacteria | 14961 |
| 46 | Ga0070658_10084195 | 3300005327 | Bacteria | 2615 |
| 47 | Ga0070658_10191418 | 3300005327 | Bacteria | 1724 |
| 48 | Ga0070658_10231535 | 3300005327 | Bacteria | 1564 |
| 49 | Ga0070658_10392212 | 3300005327 | Bacteria | 1192 |
| 50 | Ga0070658_11098751 | 3300005327 | Bacteria | 692 |
| 51 | Ga0070670_100199097 | 3300005331 | Bacteria | 1740 |
| 52 | Ga0070670_100228166 | 3300005331 | Bacteria | 1620 |
| 53 | Ga0068869_100176384 | 3300005334 | Bacteria | 1673 |
| 54 | Ga0070666_10197286 | 3300005335 | Bacteria | 1416 |
| 55 | Ga0070680_100673583 | 3300005336 | Bacteria | 890 |
| 56 | Ga0068868_100063332 | 3300005338 | Bacteria | 2933 |
| 57 | Ga0068868_100107535 | 3300005338 | Bacteria | 2263 |
| 58 | Ga0070692_10073725 | 3300005345 | Bacteria | 1824 |
| 59 | Ga0070668_100004017 | 3300005347 | Bacteria | 10879 |
| 60 | Ga0070669_100021996 | 3300005353 | Bacteria | 4561 |
| 61 | Ga0070669_100390838 | 3300005353 | Bacteria | 1136 |
| 62 | Ga0070671_100104464 | 3300005355 | Bacteria | 2377 |
| 63 | Ga0070671_100104920 | 3300005355 | Bacteria | 2372 |
| 64 | Ga0070673_100430724 | 3300005364 | Bacteria | 1184 |
| 65 | Ga0070659_100169343 | 3300005366 | Bacteria | 1788 |
| 66 | Ga0070659_100496837 | 3300005366 | Bacteria | 1039 |
| 67 | Ga0070708_101022127 | 3300005445 | Bacteria | 775 |
| 68 | Ga0070662_100180304 | 3300005457 | Bacteria | 1664 |
| 69 | Ga0068867_100062241 | 3300005459 | Bacteria | 2772 |
| 70 | Ga0068867_100536851 | 3300005459 | Bacteria | 1011 |
| 71 | Ga0068867_100625151 | 3300005459 | Bacteria | 942 |
| 72 | Ga0070672_100471152 | 3300005543 | Bacteria | 1084 |
| 73 | Ga0070665_100717328 | 3300005548 | Bacteria | 1013 |
| 74 | Ga0068855_100248217 | 3300005563 | Bacteria | 1986 |
| 75 | Ga0068855_100308763 | 3300005563 | Bacteria | 1750 |
| 76 | Ga0070664_100036216 | 3300005564 | Bacteria | 4146 |
| 77 | Ga0070664_100286439 | 3300005564 | Bacteria | 1486 |
| 78 | Ga0068859_100027883 | 3300005617 | Bacteria | 5663 |
| 79 | Ga0068864_100027620 | 3300005618 | Bacteria | 4795 |
| 80 | Ga0068864_100511018 | 3300005618 | Bacteria | 1157 |
| 81 | Ga0068851_10002637 | 3300005834 | Bacteria | 7904 |
| 82 | Ga0068863_100041190 | 3300005841 | Bacteria | 4391 |
| 83 | Ga0068863_100048910 | 3300005841 | Bacteria | 4009 |
| 84 | Ga0070717_10108261 | 3300006028 | Bacteria | 2367 |
| 85 | Ga0075365_10542694 | 3300006038 | Bacteria | 822 |
| 86 | Ga0075368_10115599 | 3300006042 | Bacteria | 1108 |
| 87 | Ga0075363_100009562 | 3300006048 | Bacteria | 4562 |
| 88 | Ga0075366_10004140 | 3300006195 | Bacteria | 7766 |
| 89 | Ga0075370_10183896 | 3300006353 | Bacteria | 1230 |
| 90 | Ga0075370_10301827 | 3300006353 | Bacteria | 952 |
| 91 | Ga0068871_100176619 | 3300006358 | Bacteria | 1833 |
| 92 | Ga0075428_100028212 | 3300006844 | Bacteria | 6208 |
| 93 | Ga0075431_100502114 | 3300006847 | Unclassified | 1204 |
| 94 | Ga0075429_100018939 | 3300006880 | Bacteria | 5963 |
| 95 | Ga0068865_100575783 | 3300006881 | Bacteria | 949 |
| 96 | Ga0097620_100027883 | 3300006931 | Bacteria | 5663 |
| 97 | Ga0079104_1015671 | 3300006946 | Bacteria | 2239 |
| 98 | Ga0079104_1028083 | 3300006946 | Bacteria | 1434 |
| 99 | Ga0105251_10001421 | 3300009011 | Bacteria | 20627 |
| 100 | Ga0105244_10003335 | 3300009036 | Bacteria | 11539 |
| 101 | Ga0105244_10314278 | 3300009036 | Bacteria | 724 |
| 102 | Ga0105240_10147889 | 3300009093 | Bacteria | 2801 |
| 103 | Ga0105240_10281846 | 3300009093 | Bacteria | 1909 |
| 104 | Ga0111539_10620344 | 3300009094 | Bacteria | 1259 |
| 105 | Ga0105245_10024461 | 3300009098 | Bacteria | 5304 |
| 106 | Ga0114129_10023178 | 3300009147 | Bacteria | 8805 |
| 107 | Ga0105243_10004984 | 3300009148 | Bacteria | 10408 |
| 108 | Ga0105241_10033513 | 3300009174 | Bacteria | 3855 |
| 109 | Ga0105242_10022682 | 3300009176 | Bacteria | 4941 |
| 110 | Ga0105248_10995055 | 3300009177 | Bacteria | 947 |
| 111 | Ga0105248_11304130 | 3300009177 | Bacteria | 821 |
| 112 | Ga0105237_10026158 | 3300009545 | Bacteria | 5964 |
| 113 | Ga0105237_10265310 | 3300009545 | Bacteria | 1720 |
| 114 | Ga0105237_10844684 | 3300009545 | Bacteria | 922 |
| 115 | Ga0105238_10263704 | 3300009551 | Bacteria | 1703 |
| 116 | Ga0105238_10398196 | 3300009551 | Bacteria | 1370 |
| 117 | Ga0105238_10416484 | 3300009551 | Bacteria | 1338 |
| 118 | Ga0105246_10030410 | 3300011119 | Bacteria | 3566 |
| 119 | Ga0157347_1000148 | 3300012502 | Bacteria | 3652 |
| 120 | Ga0157373_10011431 | 3300013100 | Bacteria | 6529 |
| 121 | Ga0157373_10048731 | 3300013100 | Bacteria | 3020 |
| 122 | Ga0157370_10002225 | 3300013104 | Bacteria | 23625 |
| 123 | Ga0157370_10307509 | 3300013104 | Bacteria | 1463 |
| 124 | Ga0157370_10370343 | 3300013104 | Bacteria | 1320 |
| 125 | Ga0157370_10721703 | 3300013104 | Bacteria | 909 |
| 126 | Ga0157369_10000138 | 3300013105 | Bacteria | 102776 |
| 127 | Ga0157369_10001085 | 3300013105 | Bacteria | 34008 |
| 128 | Ga0157374_10112840 | 3300013296 | Bacteria | 2616 |
| 129 | Ga0157378_10208955 | 3300013297 | Bacteria | 1850 |
| 130 | Ga0163162_10471239 | 3300013306 | Bacteria | 1387 |
| 131 | Ga0163162_11382568 | 3300013306 | Bacteria | 801 |
| 132 | Ga0157372_10036646 | 3300013307 | Bacteria | 5407 |
| 133 | Ga0157375_10061000 | 3300013308 | Bacteria | 3742 |
| 134 | Ga0163163_10484298 | 3300014325 | Bacteria | 1298 |
| 135 | Ga0157380_10046775 | 3300014326 | Bacteria | 3400 |
| 136 | Ga0157380_10513522 | 3300014326 | Bacteria | 1167 |
| 137 | Ga0182008_10000156 | 3300014497 | Bacteria | 53866 |
| 138 | Ga0182008_10000188 | 3300014497 | Bacteria | 48848 |
| 139 | Ga0182008_10088916 | 3300014497 | Bacteria | 1522 |
| 140 | Ga0182008_10220422 | 3300014497 | Bacteria | 970 |
| 141 | Ga0157379_10317750 | 3300014968 | Bacteria | 1421 |
| 142 | Ga0157376_10457054 | 3300014969 | Bacteria | 1247 |
| 143 | Ga0182006_1000014 | 3300015261 | Bacteria | 340159 |
| 144 | Ga0182006_1014460 | 3300015261 | Bacteria | 3403 |
| 145 | Ga0182006_1046930 | 3300015261 | Bacteria | 1677 |
| 146 | Ga0182007_10072352 | 3300015262 | Bacteria | 1129 |
| 147 | Ga0182007_10168897 | 3300015262 | Bacteria | 751 |
| 148 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 149 | Ga0163161_10082801 | 3300017792 | Bacteria | 2365 |
| 150 | Ga0163161_10263690 | 3300017792 | Bacteria | 1346 |
| 151 | Ga0163161_10285717 | 3300017792 | Bacteria | 1295 |
| 152 | Ga0213872_10000036 | 3300021361 | Bacteria | 129233 |
| 153 | Ga0213872_10000216 | 3300021361 | Bacteria | 50826 |
| 154 | Ga0209436_100453 | 3300025208 | Bacteria | 18317 |
| 155 | Ga0209759_1000443 | 3300025256 | Bacteria | 48263 |
| 156 | Ga0209129_1000954 | 3300025258 | Bacteria | 17410 |
| 157 | Ga0209565_1000752 | 3300025263 | Bacteria | 19073 |
| 158 | Ga0209565_1000869 | 3300025263 | Bacteria | 16699 |
| 159 | Ga0209673_1000578 | 3300025273 | Bacteria | 57974 |
| 160 | Ga0209673_1005958 | 3300025273 | Bacteria | 6009 |
| 161 | Ga0209673_1006531 | 3300025273 | Bacteria | 5605 |
| 162 | Ga0209130_1000099 | 3300025284 | Bacteria | 141717 |
| 163 | Ga0209130_1000551 | 3300025284 | Bacteria | 37431 |
| 164 | Ga0209130_1001244 | 3300025284 | Bacteria | 17857 |
| 165 | Ga0209130_1036408 | 3300025284 | Bacteria | 977 |
| 166 | Ga0209675_1000546 | 3300025291 | Bacteria | 27468 |
| 167 | Ga0209675_1000720 | 3300025291 | Bacteria | 22548 |
| 168 | Ga0209675_1000990 | 3300025291 | Bacteria | 17951 |
| 169 | Ga0209675_1001398 | 3300025291 | Bacteria | 14016 |
| 170 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 171 | Ga0209676_1001174 | 3300025292 | Bacteria | 28334 |
| 172 | Ga0209676_1001483 | 3300025292 | Bacteria | 21677 |
| 173 | Ga0209676_1009702 | 3300025292 | Bacteria | 4118 |
| 174 | Ga0209676_1013029 | 3300025292 | Bacteria | 3221 |
| 175 | Ga0209025_1000039 | 3300025294 | Bacteria | 377396 |
| 176 | Ga0209025_1000124 | 3300025294 | Bacteria | 201973 |
| 177 | Ga0209025_1001144 | 3300025294 | Bacteria | 37770 |
| 178 | Ga0209025_1001306 | 3300025294 | Bacteria | 34010 |
| 179 | Ga0209025_1002293 | 3300025294 | Bacteria | 20779 |
| 180 | Ga0209025_1008688 | 3300025294 | Bacteria | 7256 |
| 181 | Ga0209564_1000108 | 3300025295 | Bacteria | 213699 |
| 182 | Ga0209564_1000211 | 3300025295 | Bacteria | 133277 |
| 183 | Ga0209564_1002628 | 3300025295 | Bacteria | 13736 |
| 184 | Ga0209758_1002709 | 3300025297 | Bacteria | 17456 |
| 185 | Ga0209050_1000366 | 3300025298 | Bacteria | 86616 |
| 186 | Ga0209050_1000662 | 3300025298 | Bacteria | 53092 |
| 187 | Ga0209050_1044661 | 3300025298 | Bacteria | 1183 |
| 188 | Ga0209050_1057919 | 3300025298 | Bacteria | 934 |
| 189 | Ga0209256_1000101 | 3300025299 | Bacteria | 200246 |
| 190 | Ga0209256_1004481 | 3300025299 | Bacteria | 8732 |
| 191 | Ga0209256_1031276 | 3300025299 | Bacteria | 1457 |
| 192 | Ga0207426_1000062 | 3300025302 | Bacteria | 362040 |
| 193 | Ga0207426_1000086 | 3300025302 | Bacteria | 292089 |
| 194 | Ga0207426_1000351 | 3300025302 | Bacteria | 84439 |
| 195 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 196 | Ga0209051_1000186 | 3300025303 | Bacteria | 109900 |
| 197 | Ga0209051_1000537 | 3300025303 | Bacteria | 46665 |
| 198 | Ga0209051_1000924 | 3300025303 | Bacteria | 29157 |
| 199 | Ga0209051_1021493 | 3300025303 | Bacteria | 2745 |
| 200 | Ga0209051_1044351 | 3300025303 | Bacteria | 1550 |
| 201 | Ga0209051_1066091 | 3300025303 | Bacteria | 1112 |
| 202 | Ga0209051_1084691 | 3300025303 | Bacteria | 902 |
| 203 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 204 | Ga0209257_1000516 | 3300025304 | Bacteria | 67246 |
| 205 | Ga0209257_1017312 | 3300025304 | Bacteria | 2849 |
| 206 | Ga0209257_1040014 | 3300025304 | Bacteria | 1403 |
| 207 | Ga0207656_10004263 | 3300025321 | Bacteria | 4982 |
| 208 | Ga0207655_1002241 | 3300025728 | Bacteria | 15993 |
| 209 | Ga0207655_1014470 | 3300025728 | Bacteria | 4457 |
| 210 | Ga0207655_1015600 | 3300025728 | Bacteria | 4209 |
| 211 | Ga0207655_1042654 | 3300025728 | Bacteria | 1929 |
| 212 | Ga0207713_1024387 | 3300025735 | Bacteria | 2822 |
| 213 | Ga0207713_1044200 | 3300025735 | Bacteria | 1832 |
| 214 | Ga0207645_10367545 | 3300025907 | Bacteria | 964 |
| 215 | Ga0207705_10009877 | 3300025909 | Bacteria | 6950 |
| 216 | Ga0207705_10163856 | 3300025909 | Bacteria | 1671 |
| 217 | Ga0207705_10433426 | 3300025909 | Bacteria | 1018 |
| 218 | Ga0207654_10878730 | 3300025911 | Bacteria | 649 |
| 219 | Ga0207695_10555858 | 3300025913 | Bacteria | 1029 |
| 220 | Ga0207671_10080650 | 3300025914 | Bacteria | 2439 |
| 221 | Ga0207657_10031595 | 3300025919 | Bacteria | 4794 |
| 222 | Ga0207649_10813483 | 3300025920 | Bacteria | 730 |
| 223 | Ga0207681_10758591 | 3300025923 | Bacteria | 809 |
| 224 | Ga0207694_10259581 | 3300025924 | Bacteria | 1423 |
| 225 | Ga0207650_10268693 | 3300025925 | Bacteria | 1385 |
| 226 | Ga0207644_10197118 | 3300025931 | Bacteria | 1586 |
| 227 | Ga0207644_10405968 | 3300025931 | Bacteria | 1114 |
| 228 | Ga0207690_10016600 | 3300025932 | Bacteria | 4484 |
| 229 | Ga0207686_10004128 | 3300025934 | Bacteria | 7791 |
| 230 | Ga0207709_10000395 | 3300025935 | Bacteria | 42894 |
| 231 | Ga0207709_10009049 | 3300025935 | Bacteria | 5490 |
| 232 | Ga0207704_10193823 | 3300025938 | Bacteria | 1480 |
| 233 | Ga0207665_10127675 | 3300025939 | Bacteria | 1802 |
| 234 | Ga0207691_10207211 | 3300025940 | Bacteria | 1704 |
| 235 | Ga0207691_10323881 | 3300025940 | Bacteria | 1321 |
| 236 | Ga0207711_10022681 | 3300025941 | Bacteria | 5251 |
| 237 | Ga0207711_10172764 | 3300025941 | Bacteria | 1962 |
| 238 | Ga0207711_10241784 | 3300025941 | Bacteria | 1655 |
| 239 | Ga0207689_10473594 | 3300025942 | Bacteria | 1048 |
| 240 | Ga0207679_10019330 | 3300025945 | Bacteria | 4573 |
| 241 | Ga0207679_10064896 | 3300025945 | Bacteria | 2731 |
| 242 | Ga0207667_10137473 | 3300025949 | Bacteria | 2516 |
| 243 | Ga0207651_10254335 | 3300025960 | Bacteria | 1439 |
| 244 | Ga0207658_10334963 | 3300025986 | Bacteria | 1314 |
| 245 | Ga0207703_10272505 | 3300026035 | Bacteria | 1534 |
| 246 | Ga0207639_10163482 | 3300026041 | Bacteria | 1878 |
| 247 | Ga0207641_11020022 | 3300026088 | Bacteria | 824 |
| 248 | Ga0207648_10024407 | 3300026089 | Bacteria | 5397 |
| 249 | Ga0207648_10387506 | 3300026089 | Bacteria | 1264 |
| 250 | Ga0207648_10555571 | 3300026089 | Bacteria | 1055 |
| 251 | Ga0207648_11003199 | 3300026089 | Bacteria | 782 |
| 252 | Ga0207676_10186965 | 3300026095 | Bacteria | 1819 |
| 253 | Ga0207683_10107436 | 3300026121 | Bacteria | 2496 |
| 254 | Ga0207698_10689675 | 3300026142 | Bacteria | 1015 |
| 255 | Ga0209281_1017093 | 3300027111 | Bacteria | 1478 |
| 256 | Ga0209371_1002065 | 3300027312 | Bacteria | 11976 |
| 257 | Ga0209371_1011923 | 3300027312 | Bacteria | 2549 |
| 258 | Ga0209282_1000064 | 3300027666 | Bacteria | 91973 |
| 259 | Ga0209971_1036256 | 3300027682 | Bacteria | 1187 |
| 260 | Ga0209813_10103584 | 3300027866 | Bacteria | 971 |
| 261 | Ga0209974_10010539 | 3300027876 | Bacteria | 3117 |
| 262 | Ga0268266_10302476 | 3300028379 | Bacteria | 1492 |
| 263 | Ga0268266_10431861 | 3300028379 | Bacteria | 1250 |
| 264 | Ga0268264_10181511 | 3300028381 | Bacteria | 1912 |
| 265 | Ga0307515_10007523 | 3300028794 | Bacteria | 21519 |
| 266 | Ga0307515_10352587 | 3300028794 | Bacteria | 1117 |
| 267 | Ga0268256_1001820 | 3300030500 | Bacteria | 11990 |
| 268 | Ga0268256_1008847 | 3300030500 | Bacteria | 3409 |
| 269 | Ga0268256_1040518 | 3300030500 | Bacteria | 1046 |
| 270 | Ga0316183_1105275 | 3300030742 | Bacteria | 2738 |
| 271 | Ga0265332_10032458 | 3300031238 | Bacteria | 2275 |
| 272 | Ga0265327_10002512 | 3300031251 | Bacteria | 19153 |
| 273 | Ga0265327_10003400 | 3300031251 | Bacteria | 15268 |
| 274 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 275 | Ga0307513_10000090 | 3300031456 | Bacteria | 129750 |
| 276 | Ga0307513_10024220 | 3300031456 | Bacteria | 7067 |
| 277 | Ga0307513_10042159 | 3300031456 | Bacteria | 5029 |
| 278 | Ga0307408_100001094 | 3300031548 | Bacteria | 20723 |
| 279 | Ga0307408_100004769 | 3300031548 | Bacteria | 9142 |
| 280 | Ga0307408_100221213 | 3300031548 | Bacteria | 1545 |
| 281 | Ga0307408_100488092 | 3300031548 | Bacteria | 1076 |
| 282 | Ga0307408_101444294 | 3300031548 | Bacteria | 649 |
| 283 | Ga0265342_10261243 | 3300031712 | Bacteria | 921 |
| 284 | Ga0307516_10000845 | 3300031730 | Bacteria | 42008 |
| 285 | Ga0307405_10000696 | 3300031731 | Bacteria | 13019 |
| 286 | Ga0307405_10023166 | 3300031731 | Bacteria | 3524 |
| 287 | Ga0307405_10071753 | 3300031731 | Bacteria | 2229 |
| 288 | Ga0307405_10205519 | 3300031731 | Bacteria | 1434 |
| 289 | Ga0307405_10665360 | 3300031731 | Bacteria | 858 |
| 290 | Ga0307413_10029678 | 3300031824 | Bacteria | 3063 |
| 291 | Ga0307406_10023076 | 3300031901 | Bacteria | 3699 |
| 292 | Ga0307406_10029447 | 3300031901 | Bacteria | 3325 |
| 293 | Ga0307407_10723770 | 3300031903 | Bacteria | 751 |
| 294 | Ga0307412_10001117 | 3300031911 | Bacteria | 15389 |
| 295 | Ga0307412_10036686 | 3300031911 | Bacteria | 3143 |
| 296 | Ga0307412_10128660 | 3300031911 | Bacteria | 1836 |
| 297 | Ga0307412_10516872 | 3300031911 | Bacteria | 997 |
| 298 | Ga0307409_101112514 | 3300031995 | Bacteria | 811 |
| 299 | Ga0307416_100164655 | 3300032002 | Bacteria | 2055 |
| 300 | Ga0307416_100317622 | 3300032002 | Bacteria | 1558 |
| 301 | Ga0307416_100519975 | 3300032002 | Bacteria | 1258 |
| 302 | Ga0307416_100890514 | 3300032002 | Bacteria | 990 |
| 303 | Ga0307414_10025459 | 3300032004 | Bacteria | 3791 |
| 304 | Ga0307411_10078563 | 3300032005 | Bacteria | 2262 |
| 305 | Ga0307411_10931186 | 3300032005 | Bacteria | 774 |
| 306 | Ga0395899_0001811 | 3300037312 | Bacteria | 17695 |
| 307 | Ga0395900_0057726 | 3300037418 | Bacteria | 3996 |
| 308 | Ga0395900_0164753 | 3300037418 | Bacteria | 2259 |
| 309 | Ga0395898_0049874 | 3300037466 | Bacteria | 4099 |
| 310 | Ga0395898_1230002 | 3300037466 | Bacteria | 679 |
| 311 | Ga0395905_0172333 | 3300037471 | Bacteria | 2032 |
| 312 | Ga0395905_0600124 | 3300037471 | Bacteria | 1003 |
| 313 | Ga0436364_1233550 | 3300037853 | Bacteria | 2175 |
| 314 | Ga0395901_0064008 | 3300038443 | Bacteria | 3827 |
| 315 | Ga0436361_0206950 | 3300039447 | Bacteria | 229672 |
| 316 | Ga0436361_0931379 | 3300039447 | Bacteria | 1756 |
| 317 | Ga0451789_1326119 | 3300041443 | Bacteria | 1927 |
| 318 | Ga0451807_1110695 | 3300041486 | Bacteria | 959 |
| 319 | Ga0451841_0879473 | 3300041498 | Bacteria | 1210 |
| 320 | Ga0451843_1664536 | 3300041509 | Bacteria | 850 |
| 321 | Ga0451855_1957971 | 3300041511 | Bacteria | 669 |
| 322 | Ga0439449_0001237 | 3300042007 | Bacteria | 10011 |
| 323 | Ga0439449_0011518 | 3300042007 | Bacteria | 3327 |
| 324 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 325 | Ga0439456_000183 | 3300042013 | Bacteria | 18256 |
| 326 | Ga0439462_0007797 | 3300042015 | Bacteria | 2686 |
| 327 | Ga0439463_127403 | 3300042016 | Bacteria | 658 |
| 328 | Ga0450911_000126 | 3300042115 | Bacteria | 30361 |
| 329 | Ga0450903_025012 | 3300042138 | Bacteria | 914 |
| 330 | Ga0439464_0132897 | 3300042439 | Bacteria | 771 |
| 331 | Ga0451577_0001405 | 3300042876 | Bacteria | 32181 |
| 332 | Ga0451577_0006621 | 3300042876 | Bacteria | 11511 |
| 333 | Ga0451577_0483823 | 3300042876 | Bacteria | 1124 |
| 334 | Ga0451577_0686074 | 3300042876 | Unclassified | 928 |
| 335 | Ga0451577_0946058 | 3300042876 | Bacteria | 775 |
| 336 | Ga0466969_0189416 | 3300044656 | Bacteria | 940 |
| 337 | Ga0466972_0002243 | 3300044658 | Bacteria | 9494 |
| 338 | Ga0453683_0007367 | 3300044673 | Bacteria | 7472 |
| 339 | Ga0453683_0031032 | 3300044673 | Bacteria | 3377 |
| 340 | Ga0453683_0365171 | 3300044673 | Bacteria | 928 |
| 341 | Ga0466961_0005151 | 3300044693 | Bacteria | 8223 |
| 342 | Ga0453684_0000066 | 3300044712 | Bacteria | 465545 |
| 343 | Ga0453684_0079806 | 3300044712 | Bacteria | 4089 |
| 344 | Ga0453684_0338235 | 3300044712 | Bacteria | 1700 |
| 345 | Ga0453684_0361908 | 3300044712 | Bacteria | 1633 |
| 346 | Ga0453684_0425841 | 3300044712 | Bacteria | 1482 |
| 347 | Ga0453684_0482073 | 3300044712 | Bacteria | 1376 |
| 348 | Ga0453684_0653086 | 3300044712 | Bacteria | 1147 |
| 349 | Ga0466968_0061422 | 3300044735 | Unclassified | 1621 |
| 350 | Ga0466957_0000568 | 3300044842 | Bacteria | 18608 |
| 351 | Ga0466957_0606387 | 3300044842 | Bacteria | 767 |
| 352 | Ga0466957_0796295 | 3300044842 | Bacteria | 671 |
| 353 | Ga0466960_0133327 | 3300044901 | Bacteria | 1313 |
| 354 | Ga0466959_0001298 | 3300045049 | Bacteria | 15133 |
| 355 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 356 | Ga0451576_0009603 | 3300045051 | Bacteria | 11194 |
| 357 | Ga0451576_0017861 | 3300045051 | Bacteria | 7792 |
| 358 | Ga0451576_0033048 | 3300045051 | Bacteria | 5500 |
| 359 | Ga0451576_0290057 | 3300045051 | Bacteria | 1711 |
| 360 | Ga0466958_0787304 | 3300045836 | Bacteria | 620 |
| 361 | Ga0466967_0002897 | 3300045976 | Bacteria | 10925 |
| 362 | Ga0466967_0135637 | 3300045976 | Bacteria | 2289 |
| 363 | Ga0495627_007933 | 3300046453 | Bacteria | 4022 |
| 364 | Ga0495590_0013419 | 3300046457 | Bacteria | 3013 |
| 365 | Ga0495638_0030235 | 3300046460 | Bacteria | 3488 |
| 366 | Ga0495638_0125577 | 3300046460 | Bacteria | 1512 |
| 367 | Ga0495651_0399450 | 3300046462 | Unclassified | 898 |
| 368 | Ga0495605_0000747 | 3300046474 | Bacteria | 23843 |
| 369 | Ga0495605_0044460 | 3300046474 | Bacteria | 2196 |
| 370 | Ga0495605_0084553 | 3300046474 | Bacteria | 1479 |
| 371 | Ga0495584_0000285 | 3300046491 | Bacteria | 35720 |
| 372 | Ga0495607_0007590 | 3300046501 | Bacteria | 7483 |
| 373 | Ga0495583_0005479 | 3300046506 | Bacteria | 8609 |
| 374 | Ga0495610_0029144 | 3300046512 | Bacteria | 2911 |
| 375 | Ga0495616_0001520 | 3300046513 | Bacteria | 15995 |
| 376 | Ga0495616_0004920 | 3300046513 | Bacteria | 8346 |
| 377 | Ga0495620_0001167 | 3300046515 | Bacteria | 16094 |
| 378 | Ga0495631_0003744 | 3300046518 | Bacteria | 8284 |
| 379 | Ga0495632_0000527 | 3300046519 | Bacteria | 36131 |
| 380 | Ga0495637_0101538 | 3300046520 | Bacteria | 1123 |
| 381 | Ga0495643_0001350 | 3300046522 | Bacteria | 23094 |
| 382 | Ga0495644_0000166 | 3300046523 | Bacteria | 31051 |
| 383 | Ga0495648_0001988 | 3300046524 | Bacteria | 19429 |
| 384 | Ga0495648_0216978 | 3300046524 | Bacteria | 946 |
| 385 | Ga0495642_0000096 | 3300046528 | Bacteria | 50386 |
| 386 | Ga0495642_0036878 | 3300046528 | Bacteria | 1977 |
| 387 | Ga0495609_0000396 | 3300046538 | Bacteria | 36617 |
| 388 | Ga0495609_0004055 | 3300046538 | Bacteria | 8165 |
| 389 | Ga0495621_0015922 | 3300046539 | Bacteria | 2405 |
| 390 | Ga0495621_0037044 | 3300046539 | Bacteria | 1695 |
| 391 | Ga0495597_0041376 | 3300046542 | Bacteria | 2059 |
| 392 | Ga0495622_0123543 | 3300046557 | Bacteria | 1181 |
| 393 | Ga0495668_0035448 | 3300046616 | Bacteria | 2797 |
| 394 | Ga0495611_0000500 | 3300046648 | Bacteria | 23344 |
| 395 | Ga0495625_0172357 | 3300046660 | Bacteria | 1444 |
| 396 | Ga0495625_0178991 | 3300046660 | Bacteria | 1411 |
| 397 | Ga0495625_0410639 | 3300046660 | Bacteria | 844 |
| 398 | Ga0495659_0006855 | 3300046664 | Bacteria | 3602 |
| 399 | Ga0495661_0062473 | 3300046665 | Bacteria | 2206 |
| 400 | Ga0495588_0027358 | 3300046674 | Bacteria | 2850 |
| 401 | Ga0495670_0024030 | 3300046691 | Bacteria | 3009 |
| 402 | Ga0495671_0006377 | 3300046692 | Bacteria | 6817 |
| 403 | Ga0495671_0017797 | 3300046692 | Bacteria | 3780 |
| 404 | Ga0495649_0000432 | 3300046694 | Bacteria | 36223 |
| 405 | Ga0495649_0250976 | 3300046694 | Bacteria | 909 |
| 406 | Ga0495589_0003288 | 3300046794 | Bacteria | 8775 |
| 407 | Ga0495589_0183731 | 3300046794 | Bacteria | 991 |
| 408 | Ga0495660_0184525 | 3300046810 | Bacteria | 1007 |
| 409 | Ga0495636_0000191 | 3300047318 | Bacteria | 24040 |
| 410 | Ga0495636_0000545 | 3300047318 | Bacteria | 13844 |
| 411 | Ga0495674_0046206 | 3300047319 | Bacteria | 3865 |
| 412 | Ga0495672_0001359 | 3300047320 | Bacteria | 24241 |
| 413 | Ga0495672_0010237 | 3300047320 | Bacteria | 6700 |
| 414 | Ga0495676_0173611 | 3300047321 | Bacteria | 1515 |
| 415 | Ga0495683_0002902 | 3300047323 | Bacteria | 10139 |
| 416 | Ga0495687_001895 | 3300047443 | Bacteria | 18025 |
| 417 | Ga0495677_0031483 | 3300047445 | Bacteria | 1930 |
| 418 | Ga0495677_0291999 | 3300047445 | Bacteria | 640 |
| 419 | Ga0495685_000008 | 3300047447 | Bacteria | 95629 |
| 420 | Ga0495686_0281098 | 3300047472 | Bacteria | 925 |
| 421 | Ga0495615_0013776 | 3300048090 | Bacteria | 1696 |
| 422 | Ga0495626_0000699 | 3300048091 | Bacteria | 31942 |
| 423 | Ga0496106_0000058 | 3300048909 | Bacteria | 88804 |
| 424 | Ga0496106_0156761 | 3300048909 | Bacteria | 1799 |
| 425 | Ga0496108_0643426 | 3300048911 | Bacteria | 922 |
| 426 | Ga0496110_0017273 | 3300048913 | Bacteria | 6035 |
| 427 | Ga0496110_0442389 | 3300048913 | Bacteria | 1185 |
| 428 | Ga0496111_0147102 | 3300048914 | Bacteria | 1747 |
| 429 | Ga0496111_0181455 | 3300048914 | Bacteria | 1565 |
| 430 | Ga0496116_0003742 | 3300048919 | Bacteria | 14874 |
| 431 | Ga0496116_0102357 | 3300048919 | Bacteria | 1708 |
| 432 | Ga0496116_0108568 | 3300048919 | Bacteria | 1638 |
| 433 | Ga0496117_0044240 | 3300048920 | Bacteria | 3227 |
| 434 | Ga0496117_0430097 | 3300048920 | Bacteria | 658 |
| 435 | Ga0496118_0029317 | 3300048921 | Bacteria | 4617 |
| 436 | Ga0496118_0045814 | 3300048921 | Bacteria | 3408 |
| 437 | Ga0496118_0104155 | 3300048921 | Bacteria | 1905 |
| 438 | Ga0496118_0319932 | 3300048921 | Bacteria | 842 |
| 439 | Ga0496120_0027735 | 3300048923 | Bacteria | 3478 |
| 440 | Ga0496120_0093605 | 3300048923 | Bacteria | 1601 |
| 441 | Ga0496121_0001067 | 3300048924 | Bacteria | 48503 |
| 442 | Ga0496121_0001565 | 3300048924 | Bacteria | 38210 |
| 443 | Ga0496121_0002670 | 3300048924 | Bacteria | 26700 |
| 444 | Ga0496121_0007659 | 3300048924 | Bacteria | 12968 |
| 445 | Ga0496121_0010210 | 3300048924 | Bacteria | 10630 |
| 446 | Ga0496121_0022497 | 3300048924 | Bacteria | 6116 |
| 447 | Ga0496121_0039261 | 3300048924 | Bacteria | 4176 |
| 448 | Ga0496122_0000184 | 3300048925 | Bacteria | 144437 |
| 449 | Ga0496122_0024605 | 3300048925 | Bacteria | 5263 |
| 450 | Ga0496122_0027806 | 3300048925 | Bacteria | 4822 |
| 451 | Ga0496122_0042526 | 3300048925 | Bacteria | 3573 |
| 452 | Ga0496123_0000181 | 3300048926 | Bacteria | 127092 |
| 453 | Ga0496123_0016077 | 3300048926 | Bacteria | 6097 |
| 454 | Ga0496123_0048155 | 3300048926 | Bacteria | 2870 |
| 455 | Ga0496124_0004968 | 3300048927 | Bacteria | 15213 |
| 456 | Ga0496124_0044465 | 3300048927 | Bacteria | 3810 |
| 457 | Ga0496124_0115714 | 3300048927 | Bacteria | 2151 |
| 458 | Ga0496124_0637679 | 3300048927 | Bacteria | 686 |
| 459 | Ga0496125_0001710 | 3300048928 | Bacteria | 30576 |
| 460 | Ga0496125_0002173 | 3300048928 | Bacteria | 26201 |
| 461 | Ga0496125_0004639 | 3300048928 | Bacteria | 15696 |
| 462 | Ga0496125_0006853 | 3300048928 | Bacteria | 12216 |
| 463 | Ga0496125_0015028 | 3300048928 | Bacteria | 7518 |
| 464 | Ga0496125_0019153 | 3300048928 | Bacteria | 6469 |
| 465 | Ga0496126_0000184 | 3300048929 | Bacteria | 140502 |
| 466 | Ga0496126_0000865 | 3300048929 | Bacteria | 53248 |
| 467 | Ga0496126_0007686 | 3300048929 | Bacteria | 11767 |
| 468 | Ga0496126_0013589 | 3300048929 | Bacteria | 8266 |
| 469 | Ga0496126_0082324 | 3300048929 | Bacteria | 2844 |
| 470 | Ga0496126_0288949 | 3300048929 | Bacteria | 1356 |
| 471 | Ga0495678_000569 | 3300049459 | Bacteria | 35204 |
| 472 | Ga0495678_011163 | 3300049459 | Bacteria | 4317 |
| 473 | Ga0495682_0000064 | 3300049460 | Bacteria | 98866 |
| 474 | Ga0495682_0000651 | 3300049460 | Bacteria | 23215 |
| 475 | Ga0501294_003487 | 3300049517 | Bacteria | 1484 |
| 476 | Ga0501300_004212 | 3300049523 | Bacteria | 2134 |
| 477 | Ga0501031_0001212 | 3300049568 | Bacteria | 15757 |
| 478 | Ga0501031_0035188 | 3300049568 | Bacteria | 3266 |
| 479 | Ga0501032_0000170 | 3300049569 | Bacteria | 53079 |
| 480 | Ga0501032_0286253 | 3300049569 | Bacteria | 1066 |
| 481 | Ga0501033_0001496 | 3300049570 | Bacteria | 20692 |
| 482 | Ga0501033_0012221 | 3300049570 | Bacteria | 6554 |
| 483 | Ga0501034_0003948 | 3300049571 | Bacteria | 16663 |
| 484 | Ga0501036_0003504 | 3300049572 | Bacteria | 12547 |
| 485 | Ga0501036_0011422 | 3300049572 | Bacteria | 7352 |
| 486 | Ga0501036_0014236 | 3300049572 | Bacteria | 6619 |
| 487 | Ga0501036_0088114 | 3300049572 | Bacteria | 2623 |
| 488 | Ga0501037_0000691 | 3300049573 | Bacteria | 25695 |
| 489 | Ga0501037_0202712 | 3300049573 | Bacteria | 1401 |
| 490 | Ga0501037_0236489 | 3300049573 | Bacteria | 1281 |
| 491 | Ga0501038_0001058 | 3300049574 | Bacteria | 24822 |
| 492 | Ga0501038_0002695 | 3300049574 | Bacteria | 16551 |
| 493 | Ga0501038_0645004 | 3300049574 | Bacteria | 798 |
| 494 | Ga0501039_0015846 | 3300049575 | Bacteria | 5771 |
| 495 | Ga0501039_0056179 | 3300049575 | Bacteria | 3049 |
| 496 | Ga0501040_0002856 | 3300049576 | Bacteria | 11153 |
| 497 | Ga0501041_0129272 | 3300049577 | Bacteria | 1573 |
| 498 | Ga0501042_0002804 | 3300049578 | Bacteria | 10785 |
| 499 | Ga0501043_0002328 | 3300049579 | Bacteria | 16092 |
| 500 | Ga0501043_0060611 | 3300049579 | Bacteria | 2970 |
| 501 | Ga0501046_0000547 | 3300049580 | Bacteria | 37402 |
| 502 | Ga0501046_0189853 | 3300049580 | Bacteria | 1533 |
| 503 | Ga0501047_0055318 | 3300049581 | Bacteria | 3837 |
| 504 | Ga0501048_0000431 | 3300049582 | Bacteria | 29465 |
| 505 | Ga0501069_0443651 | 3300049585 | Unclassified | 771 |
| 506 | Ga0501073_0432436 | 3300049589 | Bacteria | 910 |
| 507 | Ga0501075_0143883 | 3300049591 | Bacteria | 1817 |
| 508 | Ga0501198_000001 | 3300049649 | Bacteria | 234552 |
| 509 | Ga0501209_000471 | 3300049656 | Bacteria | 4947 |
| 510 | Ga0501222_000004 | 3300049662 | Bacteria | 136139 |
| 511 | Ga0501235_021690 | 3300049669 | Bacteria | 1428 |
| 512 | Ga0501238_020097 | 3300049671 | Bacteria | 941 |
| 513 | Ga0501251_015523 | 3300049681 | Bacteria | 958 |
| 514 | Ga0501253_130982 | 3300049683 | Bacteria | 616 |
| 515 | Ga0501079_0154573 | 3300049741 | Bacteria | 1788 |
| 516 | Ga0501265_004690 | 3300049762 | Bacteria | 1564 |
| 517 | Ga0501280_000360 | 3300049776 | Bacteria | 11275 |
| 518 | Ga0501282_000253 | 3300049778 | Bacteria | 6472 |
| 519 | Ga0501035_0000444 | 3300049822 | Bacteria | 46207 |
| 520 | Ga0501035_0016947 | 3300049822 | Bacteria | 6715 |
| 521 | Ga0501035_0023282 | 3300049822 | Bacteria | 5680 |
| 522 | Ga0501035_0034102 | 3300049822 | Bacteria | 4626 |
| 523 | Ga0501044_0000699 | 3300049823 | Bacteria | 40459 |
| 524 | Ga0501044_0001119 | 3300049823 | Bacteria | 31854 |
| 525 | Ga0501044_0013984 | 3300049823 | Bacteria | 8670 |
| 526 | Ga0501045_0000835 | 3300049824 | Bacteria | 19938 |
| 527 | Ga0501226_002279 | 3300049853 | Bacteria | 2356 |
| 528 | nmdc:mga03n38_20185_c1 | 3300050490 | Bacteria | 2661 |
| 529 | nmdc:mga0k408_33773_c1 | 3300050493 | Bacteria | 2927 |
| 530 | nmdc:mga0k408_4058_c1 | 3300050493 | Bacteria | 7766 |
| 531 | nmdc:mga0k408_67455_c2 | 3300050493 | Bacteria | 1288 |
| 532 | nmdc:mga06z11_56688_c1 | 3300050494 | Bacteria | 2027 |
| 533 | nmdc:mga04h51_23007_c1 | 3300050495 | Bacteria | 1892 |
| 534 | nmdc:mga07m45_314819_c1 | 3300050496 | Bacteria | 910 |
| 535 | nmdc:mga07m45_5447_c1 | 3300050496 | Bacteria | 6337 |
| 536 | nmdc:mga05p37_11514_c1 | 3300050507 | Bacteria | 10536 |
| 537 | nmdc:mga09592_18245_c1 | 3300050508 | Bacteria | 5754 |
| 538 | nmdc:mga06r32_466683_c1 | 3300050510 | Unclassified | 1241 |
| 539 | Ga0500610_0000065 | 3300053079 | Bacteria | 33047 |
| 540 | Ga0500610_0000109 | 3300053079 | Bacteria | 24958 |
| 541 | Ga0500610_0019685 | 3300053079 | Bacteria | 3284 |
| 542 | Ga0495619_0034199 | 3300053085 | Bacteria | 3304 |
| 543 | Ga0500643_003277 | 3300053087 | Bacteria | 7873 |
| 544 | Ga0500644_0002709 | 3300053088 | Bacteria | 4425 |
| 545 | Ga0500562_005723 | 3300053108 | Bacteria | 3128 |
| 546 | Ga0500569_056177 | 3300053109 | Bacteria | 1203 |
| 547 | Ga0500572_031369 | 3300053111 | Bacteria | 1485 |
| 548 | Ga0500592_026969 | 3300053116 | Bacteria | 926 |
| 549 | Ga0500593_000117 | 3300053117 | Bacteria | 30894 |
| 550 | Ga0500593_003708 | 3300053117 | Bacteria | 5824 |
| 551 | Ga0500594_0010088 | 3300053118 | Bacteria | 2185 |
| 552 | Ga0500607_000706 | 3300053121 | Bacteria | 32099 |
| 553 | Ga0500608_000716 | 3300053122 | Bacteria | 12173 |
| 554 | Ga0500655_000071 | 3300053133 | Bacteria | 27208 |
| 555 | Ga0500559_0092765 | 3300053136 | Bacteria | 1384 |
| 556 | Ga0500568_0110561 | 3300053139 | Bacteria | 1027 |
| 557 | Ga0500574_000131 | 3300053141 | Bacteria | 8322 |
| 558 | Ga0500616_0070045 | 3300053153 | Bacteria | 1791 |
| 559 | Ga0500627_0000163 | 3300053158 | Bacteria | 19693 |
| 560 | Ga0500634_0000678 | 3300053161 | Bacteria | 11644 |
| 561 | Ga0500634_0002525 | 3300053161 | Bacteria | 7755 |
| 562 | Ga0500638_013878 | 3300053162 | Bacteria | 3660 |
| 563 | Ga0500636_0273281 | 3300053177 | Bacteria | 848 |
| 564 | Ga0500645_000521 | 3300053730 | Bacteria | 25747 |
| 565 | Ga0500645_007029 | 3300053730 | Bacteria | 3957 |
| 566 | Ga0501084_0202181 | 3300054114 | Bacteria | 1676 |
| 567 | Ga0501082_1292214 | 3300060353 | Bacteria | 637 |
| 568 | Ga0530510_0957834 | 3300061734 | Bacteria | 654 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049683 | Ga0501253_130982 | Ga0501253_130982_133_606 | 156 |
| 2 | 3300042138 | Ga0450903_025012 | Ga0450903_025012_205_750 | 166 |
| 3 | 3300042439 | Ga0439464_0132897 | Ga0439464_0132897_75_620 | 166 |
| 4 | 3300003320 | rootH2_10023139 | rootH2_100231392 | 168 |
| 5 | 3300044693 | Ga0466961_0005151 | Ga0466961_0005151_5266_5820 | 168 |
| 6 | 3300048920 | Ga0496117_0430097 | Ga0496117_0430097_29_544 | 169 |
| 7 | iso_pu_bacteria | 2684622997 | 2686354017 | 170 |
| 8 | 3300027876 | Ga0209974_10010539 | Ga0209974_100105393 | 171 |
| 9 | 3300049574 | Ga0501038_0645004 | Ga0501038_0645004_11_526 | 171 |
| 10 | 3300005459 | Ga0068867_100625151 | Ga0068867_1006251512 | 172 |
| 11 | 3300026089 | Ga0207648_10555571 | Ga0207648_105555712 | 172 |
| 12 | 3300017792 | Ga0163161_10285717 | Ga0163161_102857172 | 174 |
| 13 | 3300021361 | Ga0213872_10000216 | Ga0213872_100002167 | 174 |
| 14 | 3300039447 | Ga0436361_0206950 | Ga0436361_0206950_220691_221233 | 174 |
| 15 | 3300046460 | Ga0495638_0125577 | Ga0495638_0125577_529_1074 | 174 |
| 16 | 3300046512 | Ga0495610_0029144 | Ga0495610_0029144_1796_2341 | 174 |
| 17 | 3300046513 | Ga0495616_0004920 | Ga0495616_0004920_65_610 | 174 |
| 18 | 3300046518 | Ga0495631_0003744 | Ga0495631_0003744_7350_7895 | 174 |
| 19 | 3300046520 | Ga0495637_0101538 | Ga0495637_0101538_16_561 | 174 |
| 20 | 3300046539 | Ga0495621_0015922 | Ga0495621_0015922_128_673 | 174 |
| 21 | 3300046557 | Ga0495622_0123543 | Ga0495622_0123543_542_1087 | 174 |
| 22 | 3300046660 | Ga0495625_0178991 | Ga0495625_0178991_744_1289 | 174 |
| 23 | 3300046810 | Ga0495660_0184525 | Ga0495660_0184525_111_656 | 174 |
| 24 | 3300048923 | Ga0496120_0093605 | Ga0496120_0093605_260_835 | 174 |
| 25 | 3300053108 | Ga0500562_005723 | Ga0500562_005723_2106_2651 | 174 |
| 26 | 3300053116 | Ga0500592_026969 | Ga0500592_026969_339_884 | 174 |
| 27 | 3300053118 | Ga0500594_0010088 | Ga0500594_0010088_674_1219 | 174 |
| 28 | 3300053153 | Ga0500616_0070045 | Ga0500616_0070045_300_845 | 174 |
| 29 | 3300006028 | Ga0070717_10108261 | Ga0070717_101082612 | 175 |
| 30 | iso_pu_bacteria | 2765235841 | 2765586525 | 175 |
| 31 | iso_pu_bacteria | 2952252522 | 2952254403 | 175 |
| 32 | iso_pu_bacteria | 8054929484 | 8054934110 | 175 |
| 33 | iso_pu_bacteria | 2511231024 | 2511377233 | 176 |
| 34 | iso_pu_bacteria | 2599185324 | 2600071493 | 176 |
| 35 | iso_pu_bacteria | 2842854478 | 2842858804 | 176 |
| 36 | iso_pu_bacteria | 2945874760 | 2945877053 | 176 |
| 37 | iso_pu_bacteria | 651053060 | 651173957 | 176 |
| 38 | iso_pu_bacteria | 8056143049 | 8056143564 | 176 |
| 39 | 3300005335 | Ga0070666_10197286 | Ga0070666_101972862 | 177 |
| 40 | 3300005345 | Ga0070692_10073725 | Ga0070692_100737252 | 177 |
| 41 | 3300006358 | Ga0068871_100176619 | Ga0068871_1001766193 | 177 |
| 42 | 3300025931 | Ga0207644_10405968 | Ga0207644_104059682 | 177 |
| 43 | 3300026121 | Ga0207683_10107436 | Ga0207683_101074363 | 177 |
| 44 | 3300030500 | Ga0268256_1040518 | Ga0268256_10405182 | 177 |
| 45 | 3300031548 | Ga0307408_100221213 | Ga0307408_1002212131 | 177 |
| 46 | 3300048913 | Ga0496110_0442389 | Ga0496110_0442389_268_837 | 177 |
| 47 | 3300049585 | Ga0501069_0443651 | Ga0501069_0443651_190_744 | 177 |
| 48 | iso_pu_bacteria | 2894023352 | 2894023916 | 177 |
| 49 | iso_pu_bacteria | 2974320154 | 2974320701 | 177 |
| 50 | iso_pu_bacteria | 3007872151 | 3007872552 | 177 |
| 51 | iso_pu_bacteria | 8056115690 | 8056116067 | 177 |
| 52 | iso_pu_bacteria | 8056137416 | 8056142730 | 177 |
| 53 | 3300037418 | Ga0395900_0057726 | Ga0395900_0057726_2607_3164 | 178 |
| 54 | 3300037466 | Ga0395898_1230002 | Ga0395898_1230002_92_649 | 178 |
| 55 | 3300037471 | Ga0395905_0172333 | Ga0395905_0172333_274_831 | 178 |
| 56 | 3300046462 | Ga0495651_0399450 | Ga0495651_0399450_183_743 | 178 |
| 57 | 3300048909 | Ga0496106_0156761 | Ga0496106_0156761_1193_1732 | 178 |
| 58 | 3300048929 | Ga0496126_0082324 | Ga0496126_0082324_726_1265 | 178 |
| 59 | 3300049656 | Ga0501209_000471 | Ga0501209_000471_209_748 | 178 |
| 60 | 3300053085 | Ga0495619_0034199 | Ga0495619_0034199_1538_2113 | 178 |
| 61 | iso_pu_bacteria | 2511231002 | 2511246735 | 178 |
| 62 | iso_pu_bacteria | 2599185299 | 2599926366 | 178 |
| 63 | iso_pu_bacteria | 2643221658 | 2644325710 | 178 |
| 64 | iso_pu_bacteria | 2643221672 | 2644400905 | 178 |
| 65 | iso_pu_bacteria | 2808606414 | 2809125573 | 178 |
| 66 | iso_pu_bacteria | 2838054893 | 2838054985 | 178 |
| 67 | iso_pu_bacteria | 2855730933 | 2855735474 | 178 |
| 68 | iso_pu_bacteria | 2855767633 | 2855771257 | 178 |
| 69 | iso_pu_bacteria | 2881412998 | 2881416878 | 178 |
| 70 | iso_pu_bacteria | 2885192300 | 2885196516 | 178 |
| 71 | iso_pu_bacteria | 2899924645 | 2899927050 | 178 |
| 72 | iso_pu_bacteria | 2904541872 | 2904545924 | 178 |
| 73 | iso_pu_bacteria | 2928037797 | 2928043911 | 178 |
| 74 | iso_pu_bacteria | 2928044640 | 2928048559 | 178 |
| 75 | iso_pu_bacteria | 2928064002 | 2928068314 | 178 |
| 76 | iso_pu_bacteria | 2939631187 | 2939634171 | 178 |
| 77 | iso_pu_bacteria | 2945909444 | 2945914412 | 178 |
| 78 | iso_pu_bacteria | 2954767861 | 2954770467 | 178 |
| 79 | 3300003771 | Ga0055526_1023702 | Ga0055526_10237022 | 179 |
| 80 | 3300003856 | Ga0058692_1001916 | Ga0058692_10019163 | 179 |
| 81 | 3300005327 | Ga0070658_10231535 | Ga0070658_102315352 | 179 |
| 82 | 3300005327 | Ga0070658_11098751 | Ga0070658_110987511 | 179 |
| 83 | 3300005336 | Ga0070680_100673583 | Ga0070680_1006735832 | 179 |
| 84 | 3300005366 | Ga0070659_100169343 | Ga0070659_1001693432 | 179 |
| 85 | 3300005366 | Ga0070659_100496837 | Ga0070659_1004968372 | 179 |
| 86 | 3300005563 | Ga0068855_100308763 | Ga0068855_1003087632 | 179 |
| 87 | 3300005564 | Ga0070664_100036216 | Ga0070664_1000362163 | 179 |
| 88 | 3300006946 | Ga0079104_1015671 | Ga0079104_10156712 | 179 |
| 89 | 3300009093 | Ga0105240_10281846 | Ga0105240_102818462 | 179 |
| 90 | 3300009545 | Ga0105237_10844684 | Ga0105237_108446842 | 179 |
| 91 | 3300025256 | Ga0209759_1000443 | Ga0209759_100044341 | 179 |
| 92 | 3300025295 | Ga0209564_1000211 | Ga0209564_100021182 | 179 |
| 93 | 3300025299 | Ga0209256_1031276 | Ga0209256_10312762 | 179 |
| 94 | 3300025909 | Ga0207705_10009877 | Ga0207705_100098772 | 179 |
| 95 | 3300025909 | Ga0207705_10433426 | Ga0207705_104334261 | 179 |
| 96 | 3300025919 | Ga0207657_10031595 | Ga0207657_100315954 | 179 |
| 97 | 3300025932 | Ga0207690_10016600 | Ga0207690_100166002 | 179 |
| 98 | 3300025945 | Ga0207679_10019330 | Ga0207679_100193304 | 179 |
| 99 | 3300026089 | Ga0207648_11003199 | Ga0207648_110031992 | 179 |
| 100 | 3300027111 | Ga0209281_1017093 | Ga0209281_10170932 | 179 |
| 101 | 3300027312 | Ga0209371_1002065 | Ga0209371_10020655 | 179 |
| 102 | 3300027682 | Ga0209971_1036256 | Ga0209971_10362562 | 179 |
| 103 | 3300030500 | Ga0268256_1001820 | Ga0268256_10018208 | 179 |
| 104 | 3300031456 | Ga0307513_10000090 | Ga0307513_10000090107 | 179 |
| 105 | 3300031548 | Ga0307408_100004769 | Ga0307408_1000047696 | 179 |
| 106 | 3300031901 | Ga0307406_10023076 | Ga0307406_100230763 | 179 |
| 107 | 3300044673 | Ga0453683_0031032 | Ga0453683_0031032_998_1540 | 179 |
| 108 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_666411_666953 | 179 |
| 109 | 3300047319 | Ga0495674_0046206 | Ga0495674_0046206_2054_2596 | 179 |
| 110 | 3300048913 | Ga0496110_0017273 | Ga0496110_0017273_944_1486 | 179 |
| 111 | 3300048919 | Ga0496116_0003742 | Ga0496116_0003742_10554_11096 | 179 |
| 112 | 3300048925 | Ga0496122_0027806 | Ga0496122_0027806_2026_2568 | 179 |
| 113 | 3300048925 | Ga0496122_0042526 | Ga0496122_0042526_174_716 | 179 |
| 114 | 3300048926 | Ga0496123_0048155 | Ga0496123_0048155_1532_2074 | 179 |
| 115 | 3300048927 | Ga0496124_0004968 | Ga0496124_0004968_4014_4556 | 179 |
| 116 | 3300048927 | Ga0496124_0044465 | Ga0496124_0044465_3154_3696 | 179 |
| 117 | 3300048928 | Ga0496125_0019153 | Ga0496125_0019153_1397_1939 | 179 |
| 118 | 3300048929 | Ga0496126_0007686 | Ga0496126_0007686_10323_10865 | 179 |
| 119 | 3300048929 | Ga0496126_0013589 | Ga0496126_0013589_2359_2901 | 179 |
| 120 | 3300049523 | Ga0501300_004212 | Ga0501300_004212_720_1271 | 179 |
| 121 | 3300049776 | Ga0501280_000360 | Ga0501280_000360_6828_7379 | 179 |
| 122 | 3300049778 | Ga0501282_000253 | Ga0501282_000253_2349_2900 | 179 |
| 123 | iso_pu_bacteria | 2791355137 | 2792839625 | 179 |
| 124 | iso_pu_bacteria | 8003400568 | 8003400990 | 179 |
| 125 | 3300005327 | Ga0070658_10084195 | Ga0070658_100841953 | 180 |
| 126 | 3300005331 | Ga0070670_100199097 | Ga0070670_1001990972 | 180 |
| 127 | 3300005338 | Ga0068868_100063332 | Ga0068868_1000633324 | 180 |
| 128 | 3300005347 | Ga0070668_100004017 | Ga0070668_1000040177 | 180 |
| 129 | 3300005353 | Ga0070669_100021996 | Ga0070669_1000219962 | 180 |
| 130 | 3300005355 | Ga0070671_100104464 | Ga0070671_1001044641 | 180 |
| 131 | 3300005364 | Ga0070673_100430724 | Ga0070673_1004307242 | 180 |
| 132 | 3300005459 | Ga0068867_100536851 | Ga0068867_1005368512 | 180 |
| 133 | 3300005548 | Ga0070665_100717328 | Ga0070665_1007173282 | 180 |
| 134 | 3300005617 | Ga0068859_100027883 | Ga0068859_1000278835 | 180 |
| 135 | 3300005618 | Ga0068864_100511018 | Ga0068864_1005110181 | 180 |
| 136 | 3300005841 | Ga0068863_100041190 | Ga0068863_1000411903 | 180 |
| 137 | 3300006195 | Ga0075366_10004140 | Ga0075366_100041408 | 180 |
| 138 | 3300006931 | Ga0097620_100027883 | Ga0097620_1000278835 | 180 |
| 139 | 3300009098 | Ga0105245_10024461 | Ga0105245_100244615 | 180 |
| 140 | 3300013104 | Ga0157370_10721703 | Ga0157370_107217032 | 180 |
| 141 | 3300013306 | Ga0163162_11382568 | Ga0163162_113825682 | 180 |
| 142 | 3300014326 | Ga0157380_10046775 | Ga0157380_100467753 | 180 |
| 143 | 3300014968 | Ga0157379_10317750 | Ga0157379_103177502 | 180 |
| 144 | 3300015261 | Ga0182006_1046930 | Ga0182006_10469302 | 180 |
| 145 | 3300025728 | Ga0207655_1014470 | Ga0207655_10144703 | 180 |
| 146 | 3300025728 | Ga0207655_1015600 | Ga0207655_10156002 | 180 |
| 147 | 3300025728 | Ga0207655_1042654 | Ga0207655_10426542 | 180 |
| 148 | 3300025735 | Ga0207713_1044200 | Ga0207713_10442002 | 180 |
| 149 | 3300025939 | Ga0207665_10127675 | Ga0207665_101276752 | 180 |
| 150 | 3300025960 | Ga0207651_10254335 | Ga0207651_102543352 | 180 |
| 151 | 3300026035 | Ga0207703_10272505 | Ga0207703_102725052 | 180 |
| 152 | 3300026088 | Ga0207641_11020022 | Ga0207641_110200222 | 180 |
| 153 | 3300026089 | Ga0207648_10387506 | Ga0207648_103875062 | 180 |
| 154 | 3300027312 | Ga0209371_1011923 | Ga0209371_10119233 | 180 |
| 155 | 3300028379 | Ga0268266_10431861 | Ga0268266_104318612 | 180 |
| 156 | 3300028381 | Ga0268264_10181511 | Ga0268264_101815112 | 180 |
| 157 | 3300030500 | Ga0268256_1008847 | Ga0268256_10088473 | 180 |
| 158 | 3300031548 | Ga0307408_100001094 | Ga0307408_10000109419 | 180 |
| 159 | 3300031730 | Ga0307516_10000845 | Ga0307516_100008457 | 180 |
| 160 | 3300031731 | Ga0307405_10023166 | Ga0307405_100231663 | 180 |
| 161 | 3300031824 | Ga0307413_10029678 | Ga0307413_100296782 | 180 |
| 162 | 3300031901 | Ga0307406_10029447 | Ga0307406_100294473 | 180 |
| 163 | 3300031903 | Ga0307407_10723770 | Ga0307407_107237701 | 180 |
| 164 | 3300031911 | Ga0307412_10001117 | Ga0307412_100011174 | 180 |
| 165 | 3300031995 | Ga0307409_101112514 | Ga0307409_1011125142 | 180 |
| 166 | 3300032002 | Ga0307416_100317622 | Ga0307416_1003176222 | 180 |
| 167 | 3300032004 | Ga0307414_10025459 | Ga0307414_100254592 | 180 |
| 168 | 3300032005 | Ga0307411_10078563 | Ga0307411_100785632 | 180 |
| 169 | 3300042013 | Ga0439456_000183 | Ga0439456_000183_14874_15419 | 180 |
| 170 | 3300042016 | Ga0439463_127403 | Ga0439463_127403_28_573 | 180 |
| 171 | 3300042876 | Ga0451577_0001405 | Ga0451577_0001405_797_1342 | 180 |
| 172 | 3300042876 | Ga0451577_0006621 | Ga0451577_0006621_8312_8857 | 180 |
| 173 | 3300044673 | Ga0453683_0365171 | Ga0453683_0365171_109_654 | 180 |
| 174 | 3300044712 | Ga0453684_0361908 | Ga0453684_0361908_687_1232 | 180 |
| 175 | 3300044712 | Ga0453684_0482073 | Ga0453684_0482073_195_740 | 180 |
| 176 | 3300045051 | Ga0451576_0009603 | Ga0451576_0009603_1397_1942 | 180 |
| 177 | 3300046460 | Ga0495638_0030235 | Ga0495638_0030235_194_736 | 180 |
| 178 | 3300046474 | Ga0495605_0044460 | Ga0495605_0044460_187_732 | 180 |
| 179 | 3300046474 | Ga0495605_0084553 | Ga0495605_0084553_371_913 | 180 |
| 180 | 3300046501 | Ga0495607_0007590 | Ga0495607_0007590_186_728 | 180 |
| 181 | 3300046506 | Ga0495583_0005479 | Ga0495583_0005479_1943_2485 | 180 |
| 182 | 3300046513 | Ga0495616_0001520 | Ga0495616_0001520_15212_15754 | 180 |
| 183 | 3300046523 | Ga0495644_0000166 | Ga0495644_0000166_17733_18275 | 180 |
| 184 | 3300046524 | Ga0495648_0001988 | Ga0495648_0001988_17953_18495 | 180 |
| 185 | 3300046538 | Ga0495609_0004055 | Ga0495609_0004055_250_792 | 180 |
| 186 | 3300046616 | Ga0495668_0035448 | Ga0495668_0035448_1289_1834 | 180 |
| 187 | 3300046648 | Ga0495611_0000500 | Ga0495611_0000500_15180_15722 | 180 |
| 188 | 3300046664 | Ga0495659_0006855 | Ga0495659_0006855_1320_1862 | 180 |
| 189 | 3300046665 | Ga0495661_0062473 | Ga0495661_0062473_1067_1609 | 180 |
| 190 | 3300046691 | Ga0495670_0024030 | Ga0495670_0024030_1532_2074 | 180 |
| 191 | 3300046692 | Ga0495671_0006377 | Ga0495671_0006377_186_728 | 180 |
| 192 | 3300046794 | Ga0495589_0183731 | Ga0495589_0183731_267_809 | 180 |
| 193 | 3300047318 | Ga0495636_0000545 | Ga0495636_0000545_6755_7297 | 180 |
| 194 | 3300047320 | Ga0495672_0010237 | Ga0495672_0010237_193_735 | 180 |
| 195 | 3300047323 | Ga0495683_0002902 | Ga0495683_0002902_9348_9890 | 180 |
| 196 | 3300047443 | Ga0495687_001895 | Ga0495687_001895_197_739 | 180 |
| 197 | 3300047445 | Ga0495677_0031483 | Ga0495677_0031483_232_774 | 180 |
| 198 | 3300047447 | Ga0495685_000008 | Ga0495685_000008_11464_12006 | 180 |
| 199 | 3300047472 | Ga0495686_0281098 | Ga0495686_0281098_85_627 | 180 |
| 200 | 3300048923 | Ga0496120_0027735 | Ga0496120_0027735_2171_2719 | 180 |
| 201 | 3300048927 | Ga0496124_0115714 | Ga0496124_0115714_1560_2108 | 180 |
| 202 | 3300048929 | Ga0496126_0000865 | Ga0496126_0000865_35976_36524 | 180 |
| 203 | 3300049459 | Ga0495678_011163 | Ga0495678_011163_3003_3545 | 180 |
| 204 | 3300049460 | Ga0495682_0000064 | Ga0495682_0000064_11726_12268 | 180 |
| 205 | 3300049589 | Ga0501073_0432436 | Ga0501073_0432436_200_742 | 180 |
| 206 | 3300049681 | Ga0501251_015523 | Ga0501251_015523_246_791 | 180 |
| 207 | 3300049853 | Ga0501226_002279 | Ga0501226_002279_1622_2167 | 180 |
| 208 | 3300050493 | nmdc:mga0k408_4058_c1 | nmdc:mga0k408_4058_c1_6643_7191 | 180 |
| 209 | 3300003187 | JGI25151J46595_10000935 | JGI25151J46595_1000093522 | 181 |
| 210 | 3300003781 | Ga0055536_1000022 | Ga0055536_100002252 | 181 |
| 211 | 3300003792 | Ga0055540_1007554 | Ga0055540_10075542 | 181 |
| 212 | 3300003794 | Ga0055531_10000257 | Ga0055531_100002577 | 181 |
| 213 | 3300005445 | Ga0070708_101022127 | Ga0070708_1010221271 | 181 |
| 214 | 3300006844 | Ga0075428_100028212 | Ga0075428_1000282122 | 181 |
| 215 | 3300006847 | Ga0075431_100502114 | Ga0075431_1005021141 | 181 |
| 216 | 3300006880 | Ga0075429_100018939 | Ga0075429_1000189396 | 181 |
| 217 | 3300009147 | Ga0114129_10023178 | Ga0114129_100231785 | 181 |
| 218 | 3300009174 | Ga0105241_10033513 | Ga0105241_100335135 | 181 |
| 219 | 3300009545 | Ga0105237_10265310 | Ga0105237_102653103 | 181 |
| 220 | 3300009551 | Ga0105238_10416484 | Ga0105238_104164842 | 181 |
| 221 | 3300013104 | Ga0157370_10002225 | Ga0157370_100022252 | 181 |
| 222 | 3300014497 | Ga0182008_10088916 | Ga0182008_100889162 | 181 |
| 223 | 3300015262 | Ga0182007_10168897 | Ga0182007_101688971 | 181 |
| 224 | 3300025273 | Ga0209673_1005958 | Ga0209673_10059582 | 181 |
| 225 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012623 | 181 |
| 226 | 3300025294 | Ga0209025_1000124 | Ga0209025_100012489 | 181 |
| 227 | 3300025303 | Ga0209051_1000025 | Ga0209051_100002551 | 181 |
| 228 | 3300025303 | Ga0209051_1066091 | Ga0209051_10660912 | 181 |
| 229 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039557 | 181 |
| 230 | 3300025924 | Ga0207694_10259581 | Ga0207694_102595812 | 181 |
| 231 | 3300026041 | Ga0207639_10163482 | Ga0207639_101634822 | 181 |
| 232 | 3300031456 | Ga0307513_10000008 | Ga0307513_1000000829 | 181 |
| 233 | 3300032002 | Ga0307416_100519975 | Ga0307416_1005199752 | 181 |
| 234 | 3300037312 | Ga0395899_0001811 | Ga0395899_0001811_4131_4676 | 181 |
| 235 | 3300037418 | Ga0395900_0164753 | Ga0395900_0164753_719_1264 | 181 |
| 236 | 3300037466 | Ga0395898_0049874 | Ga0395898_0049874_2836_3381 | 181 |
| 237 | 3300037471 | Ga0395905_0600124 | Ga0395905_0600124_140_697 | 181 |
| 238 | 3300037853 | Ga0436364_1233550 | Ga0436364_1233550_1501_2052 | 181 |
| 239 | 3300038443 | Ga0395901_0064008 | Ga0395901_0064008_3148_3693 | 181 |
| 240 | 3300041486 | Ga0451807_1110695 | Ga0451807_1110695_33_578 | 181 |
| 241 | 3300041511 | Ga0451855_1957971 | Ga0451855_1957971_28_576 | 181 |
| 242 | 3300042007 | Ga0439449_0001237 | Ga0439449_0001237_2495_3040 | 181 |
| 243 | 3300042015 | Ga0439462_0007797 | Ga0439462_0007797_796_1341 | 181 |
| 244 | 3300042115 | Ga0450911_000126 | Ga0450911_000126_19467_20012 | 181 |
| 245 | 3300044656 | Ga0466969_0189416 | Ga0466969_0189416_100_657 | 181 |
| 246 | 3300044658 | Ga0466972_0002243 | Ga0466972_0002243_939_1571 | 181 |
| 247 | 3300044712 | Ga0453684_0079806 | Ga0453684_0079806_803_1390 | 181 |
| 248 | 3300044712 | Ga0453684_0338235 | Ga0453684_0338235_1063_1611 | 181 |
| 249 | 3300044735 | Ga0466968_0061422 | Ga0466968_0061422_277_909 | 181 |
| 250 | 3300044842 | Ga0466957_0000568 | Ga0466957_0000568_2685_3317 | 181 |
| 251 | 3300044842 | Ga0466957_0606387 | Ga0466957_0606387_85_660 | 181 |
| 252 | 3300044842 | Ga0466957_0796295 | Ga0466957_0796295_46_603 | 181 |
| 253 | 3300045049 | Ga0466959_0001298 | Ga0466959_0001298_8930_9562 | 181 |
| 254 | 3300045051 | Ga0451576_0290057 | Ga0451576_0290057_610_1155 | 181 |
| 255 | 3300045836 | Ga0466958_0787304 | Ga0466958_0787304_31_588 | 181 |
| 256 | 3300045976 | Ga0466967_0002897 | Ga0466967_0002897_2982_3614 | 181 |
| 257 | 3300045976 | Ga0466967_0135637 | Ga0466967_0135637_1364_1939 | 181 |
| 258 | 3300046457 | Ga0495590_0013419 | Ga0495590_0013419_663_1214 | 181 |
| 259 | 3300046474 | Ga0495605_0000747 | Ga0495605_0000747_3542_4093 | 181 |
| 260 | 3300046491 | Ga0495584_0000285 | Ga0495584_0000285_23666_24217 | 181 |
| 261 | 3300046519 | Ga0495632_0000527 | Ga0495632_0000527_23648_24199 | 181 |
| 262 | 3300046522 | Ga0495643_0001350 | Ga0495643_0001350_19010_19561 | 181 |
| 263 | 3300046528 | Ga0495642_0000096 | Ga0495642_0000096_30201_30752 | 181 |
| 264 | 3300046538 | Ga0495609_0000396 | Ga0495609_0000396_23511_24062 | 181 |
| 265 | 3300046542 | Ga0495597_0041376 | Ga0495597_0041376_890_1441 | 181 |
| 266 | 3300046694 | Ga0495649_0000432 | Ga0495649_0000432_12019_12570 | 181 |
| 267 | 3300046794 | Ga0495589_0003288 | Ga0495589_0003288_6840_7391 | 181 |
| 268 | 3300047318 | Ga0495636_0000191 | Ga0495636_0000191_19642_20193 | 181 |
| 269 | 3300047320 | Ga0495672_0001359 | Ga0495672_0001359_19843_20394 | 181 |
| 270 | 3300047445 | Ga0495677_0291999 | Ga0495677_0291999_37_582 | 181 |
| 271 | 3300048090 | Ga0495615_0013776 | Ga0495615_0013776_125_670 | 181 |
| 272 | 3300048091 | Ga0495626_0000699 | Ga0495626_0000699_19768_20319 | 181 |
| 273 | 3300048909 | Ga0496106_0000058 | Ga0496106_0000058_48300_48851 | 181 |
| 274 | 3300048914 | Ga0496111_0181455 | Ga0496111_0181455_336_884 | 181 |
| 275 | 3300048920 | Ga0496117_0044240 | Ga0496117_0044240_2232_2783 | 181 |
| 276 | 3300048921 | Ga0496118_0045814 | Ga0496118_0045814_2308_2859 | 181 |
| 277 | 3300048921 | Ga0496118_0104155 | Ga0496118_0104155_1131_1682 | 181 |
| 278 | 3300048924 | Ga0496121_0001067 | Ga0496121_0001067_4615_5166 | 181 |
| 279 | 3300048924 | Ga0496121_0007659 | Ga0496121_0007659_2384_2929 | 181 |
| 280 | 3300048924 | Ga0496121_0039261 | Ga0496121_0039261_2353_2898 | 181 |
| 281 | 3300048928 | Ga0496125_0001710 | Ga0496125_0001710_13072_13617 | 181 |
| 282 | 3300048928 | Ga0496125_0006853 | Ga0496125_0006853_3217_3768 | 181 |
| 283 | 3300048929 | Ga0496126_0288949 | Ga0496126_0288949_222_773 | 181 |
| 284 | 3300049459 | Ga0495678_000569 | Ga0495678_000569_22726_23277 | 181 |
| 285 | 3300049460 | Ga0495682_0000651 | Ga0495682_0000651_19262_19813 | 181 |
| 286 | 3300049572 | Ga0501036_0088114 | Ga0501036_0088114_567_1130 | 181 |
| 287 | 3300049573 | Ga0501037_0236489 | Ga0501037_0236489_658_1203 | 181 |
| 288 | 3300049577 | Ga0501041_0129272 | Ga0501041_0129272_704_1267 | 181 |
| 289 | 3300049591 | Ga0501075_0143883 | Ga0501075_0143883_711_1274 | 181 |
| 290 | 3300049741 | Ga0501079_0154573 | Ga0501079_0154573_1191_1754 | 181 |
| 291 | 3300050507 | nmdc:mga05p37_11514_c1 | nmdc:mga05p37_11514_c1_1941_2489 | 181 |
| 292 | 3300050508 | nmdc:mga09592_18245_c1 | nmdc:mga09592_18245_c1_3451_3999 | 181 |
| 293 | 3300050510 | nmdc:mga06r32_466683_c1 | nmdc:mga06r32_466683_c1_95_640 | 181 |
| 294 | 3300053079 | Ga0500610_0000065 | Ga0500610_0000065_25810_26355 | 181 |
| 295 | 3300053079 | Ga0500610_0019685 | Ga0500610_0019685_711_1256 | 181 |
| 296 | 3300053109 | Ga0500569_056177 | Ga0500569_056177_466_1011 | 181 |
| 297 | 3300053117 | Ga0500593_000117 | Ga0500593_000117_10101_10646 | 181 |
| 298 | 3300053117 | Ga0500593_003708 | Ga0500593_003708_2325_2873 | 181 |
| 299 | 3300053161 | Ga0500634_0002525 | Ga0500634_0002525_2365_2910 | 181 |
| 300 | 3300054114 | Ga0501084_0202181 | Ga0501084_0202181_1077_1640 | 181 |
| 301 | 3300060353 | Ga0501082_1292214 | Ga0501082_1292214_41_604 | 181 |
| 302 | 3300061734 | Ga0530510_0957834 | Ga0530510_0957834_23_586 | 181 |
| 303 | 3300002987 | JGI25159J45721_1000074 | JGI25159J45721_100007441 | 182 |
| 304 | 3300002987 | JGI25159J45721_1000713 | JGI25159J45721_10007132 | 182 |
| 305 | 3300002987 | JGI25159J45721_1011365 | JGI25159J45721_10113652 | 182 |
| 306 | 3300003187 | JGI25151J46595_10000281 | JGI25151J46595_1000028147 | 182 |
| 307 | 3300003187 | JGI25151J46595_10001155 | JGI25151J46595_1000115516 | 182 |
| 308 | 3300003187 | JGI25151J46595_10001333 | JGI25151J46595_100013333 | 182 |
| 309 | 3300003187 | JGI25151J46595_10005180 | JGI25151J46595_100051806 | 182 |
| 310 | 3300003187 | JGI25151J46595_10010457 | JGI25151J46595_100104575 | 182 |
| 311 | 3300003215 | JGI25153J46596_10000994 | JGI25153J46596_1000099412 | 182 |
| 312 | 3300003308 | Ga0006777J48905_1115107 | Ga0006777J48905_11151072 | 182 |
| 313 | 3300003316 | rootH1_10052883 | rootH1_100528832 | 182 |
| 314 | 3300003322 | rootL2_10001457 | rootL2_1000145799 | 182 |
| 315 | 3300003323 | rootH1_10016403 | rootH1_100164033 | 182 |
| 316 | 3300003354 | JGI25160J50197_1000106 | JGI25160J50197_100010671 | 182 |
| 317 | 3300003354 | JGI25160J50197_1000677 | JGI25160J50197_10006774 | 182 |
| 318 | 3300003374 | JGI25161J50226_1000041 | JGI25161J50226_1000041111 | 182 |
| 319 | 3300003374 | JGI25161J50226_1002438 | JGI25161J50226_10024382 | 182 |
| 320 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004524 | 182 |
| 321 | 3300003771 | Ga0055526_1000857 | Ga0055526_10008574 | 182 |
| 322 | 3300003771 | Ga0055526_1059064 | Ga0055526_10590641 | 182 |
| 323 | 3300003773 | Ga0055537_1000740 | Ga0055537_10007402 | 182 |
| 324 | 3300003773 | Ga0055537_1000906 | Ga0055537_10009062 | 182 |
| 325 | 3300003775 | Ga0055524_1000915 | Ga0055524_10009152 | 182 |
| 326 | 3300003775 | Ga0055524_1031142 | Ga0055524_10311422 | 182 |
| 327 | 3300003784 | Ga0055534_1000554 | Ga0055534_10005543 | 182 |
| 328 | 3300003784 | Ga0055534_1000687 | Ga0055534_10006872 | 182 |
| 329 | 3300003784 | Ga0055534_1002035 | Ga0055534_10020355 | 182 |
| 330 | 3300003784 | Ga0055534_1010398 | Ga0055534_10103982 | 182 |
| 331 | 3300003790 | Ga0055528_1001217 | Ga0055528_10012172 | 182 |
| 332 | 3300003791 | Ga0055530_10003228 | Ga0055530_100032288 | 182 |
| 333 | 3300003792 | Ga0055540_1000821 | Ga0055540_10008214 | 182 |
| 334 | 3300003794 | Ga0055531_10001061 | Ga0055531_1000106115 | 182 |
| 335 | 3300004625 | Ga0055543_1000092 | Ga0055543_100009262 | 182 |
| 336 | 3300004625 | Ga0055543_1000801 | Ga0055543_10008012 | 182 |
| 337 | 3300004625 | Ga0055543_1016654 | Ga0055543_10166542 | 182 |
| 338 | 3300005262 | Ga0065165_1000492 | Ga0065165_10004923 | 182 |
| 339 | 3300005262 | Ga0065165_1002142 | Ga0065165_10021425 | 182 |
| 340 | 3300005262 | Ga0065165_1002576 | Ga0065165_10025763 | 182 |
| 341 | 3300005327 | Ga0070658_10191418 | Ga0070658_101914182 | 182 |
| 342 | 3300005327 | Ga0070658_10392212 | Ga0070658_103922122 | 182 |
| 343 | 3300005331 | Ga0070670_100228166 | Ga0070670_1002281662 | 182 |
| 344 | 3300005334 | Ga0068869_100176384 | Ga0068869_1001763842 | 182 |
| 345 | 3300005338 | Ga0068868_100107535 | Ga0068868_1001075352 | 182 |
| 346 | 3300005353 | Ga0070669_100390838 | Ga0070669_1003908382 | 182 |
| 347 | 3300005355 | Ga0070671_100104920 | Ga0070671_1001049202 | 182 |
| 348 | 3300005457 | Ga0070662_100180304 | Ga0070662_1001803042 | 182 |
| 349 | 3300005459 | Ga0068867_100062241 | Ga0068867_1000622412 | 182 |
| 350 | 3300005543 | Ga0070672_100471152 | Ga0070672_1004711522 | 182 |
| 351 | 3300005563 | Ga0068855_100248217 | Ga0068855_1002482172 | 182 |
| 352 | 3300005564 | Ga0070664_100286439 | Ga0070664_1002864392 | 182 |
| 353 | 3300005618 | Ga0068864_100027620 | Ga0068864_1000276202 | 182 |
| 354 | 3300005834 | Ga0068851_10002637 | Ga0068851_100026373 | 182 |
| 355 | 3300005841 | Ga0068863_100048910 | Ga0068863_1000489105 | 182 |
| 356 | 3300006038 | Ga0075365_10542694 | Ga0075365_105426941 | 182 |
| 357 | 3300006042 | Ga0075368_10115599 | Ga0075368_101155992 | 182 |
| 358 | 3300006048 | Ga0075363_100009562 | Ga0075363_1000095623 | 182 |
| 359 | 3300006353 | Ga0075370_10183896 | Ga0075370_101838962 | 182 |
| 360 | 3300006353 | Ga0075370_10301827 | Ga0075370_103018272 | 182 |
| 361 | 3300006881 | Ga0068865_100575783 | Ga0068865_1005757832 | 182 |
| 362 | 3300006946 | Ga0079104_1028083 | Ga0079104_10280831 | 182 |
| 363 | 3300009011 | Ga0105251_10001421 | Ga0105251_100014212 | 182 |
| 364 | 3300009036 | Ga0105244_10003335 | Ga0105244_100033359 | 182 |
| 365 | 3300009036 | Ga0105244_10314278 | Ga0105244_103142781 | 182 |
| 366 | 3300009093 | Ga0105240_10147889 | Ga0105240_101478893 | 182 |
| 367 | 3300009094 | Ga0111539_10620344 | Ga0111539_106203441 | 182 |
| 368 | 3300009148 | Ga0105243_10004984 | Ga0105243_100049842 | 182 |
| 369 | 3300009176 | Ga0105242_10022682 | Ga0105242_100226826 | 182 |
| 370 | 3300009177 | Ga0105248_10995055 | Ga0105248_109950552 | 182 |
| 371 | 3300009177 | Ga0105248_11304130 | Ga0105248_113041301 | 182 |
| 372 | 3300009545 | Ga0105237_10026158 | Ga0105237_100261586 | 182 |
| 373 | 3300009551 | Ga0105238_10263704 | Ga0105238_102637043 | 182 |
| 374 | 3300009551 | Ga0105238_10398196 | Ga0105238_103981961 | 182 |
| 375 | 3300011119 | Ga0105246_10030410 | Ga0105246_100304102 | 182 |
| 376 | 3300012502 | Ga0157347_1000148 | Ga0157347_10001483 | 182 |
| 377 | 3300013100 | Ga0157373_10011431 | Ga0157373_100114316 | 182 |
| 378 | 3300013100 | Ga0157373_10048731 | Ga0157373_100487312 | 182 |
| 379 | 3300013104 | Ga0157370_10307509 | Ga0157370_103075092 | 182 |
| 380 | 3300013104 | Ga0157370_10370343 | Ga0157370_103703432 | 182 |
| 381 | 3300013105 | Ga0157369_10000138 | Ga0157369_1000013858 | 182 |
| 382 | 3300013105 | Ga0157369_10001085 | Ga0157369_100010855 | 182 |
| 383 | 3300013296 | Ga0157374_10112840 | Ga0157374_101128403 | 182 |
| 384 | 3300013297 | Ga0157378_10208955 | Ga0157378_102089552 | 182 |
| 385 | 3300013306 | Ga0163162_10471239 | Ga0163162_104712392 | 182 |
| 386 | 3300013307 | Ga0157372_10036646 | Ga0157372_100366462 | 182 |
| 387 | 3300013308 | Ga0157375_10061000 | Ga0157375_100610002 | 182 |
| 388 | 3300014325 | Ga0163163_10484298 | Ga0163163_104842982 | 182 |
| 389 | 3300014326 | Ga0157380_10513522 | Ga0157380_105135222 | 182 |
| 390 | 3300014497 | Ga0182008_10000156 | Ga0182008_1000015618 | 182 |
| 391 | 3300014497 | Ga0182008_10000188 | Ga0182008_1000018834 | 182 |
| 392 | 3300014497 | Ga0182008_10220422 | Ga0182008_102204222 | 182 |
| 393 | 3300014969 | Ga0157376_10457054 | Ga0157376_104570542 | 182 |
| 394 | 3300015261 | Ga0182006_1000014 | Ga0182006_100001488 | 182 |
| 395 | 3300015261 | Ga0182006_1014460 | Ga0182006_10144603 | 182 |
| 396 | 3300015262 | Ga0182007_10072352 | Ga0182007_100723521 | 182 |
| 397 | 3300015683 | Ga0183362_10005 | Ga0183362_1000556 | 182 |
| 398 | 3300017792 | Ga0163161_10082801 | Ga0163161_100828013 | 182 |
| 399 | 3300017792 | Ga0163161_10263690 | Ga0163161_102636902 | 182 |
| 400 | 3300021361 | Ga0213872_10000036 | Ga0213872_100000367 | 182 |
| 401 | 3300025208 | Ga0209436_100453 | Ga0209436_1004533 | 182 |
| 402 | 3300025258 | Ga0209129_1000954 | Ga0209129_100095412 | 182 |
| 403 | 3300025263 | Ga0209565_1000752 | Ga0209565_100075212 | 182 |
| 404 | 3300025263 | Ga0209565_1000869 | Ga0209565_10008695 | 182 |
| 405 | 3300025273 | Ga0209673_1000578 | Ga0209673_100057825 | 182 |
| 406 | 3300025273 | Ga0209673_1006531 | Ga0209673_10065312 | 182 |
| 407 | 3300025284 | Ga0209130_1000099 | Ga0209130_100009925 | 182 |
| 408 | 3300025284 | Ga0209130_1000551 | Ga0209130_100055129 | 182 |
| 409 | 3300025284 | Ga0209130_1001244 | Ga0209130_100124410 | 182 |
| 410 | 3300025284 | Ga0209130_1036408 | Ga0209130_10364082 | 182 |
| 411 | 3300025291 | Ga0209675_1000546 | Ga0209675_100054616 | 182 |
| 412 | 3300025291 | Ga0209675_1000720 | Ga0209675_100072015 | 182 |
| 413 | 3300025291 | Ga0209675_1000990 | Ga0209675_100099011 | 182 |
| 414 | 3300025291 | Ga0209675_1001398 | Ga0209675_10013982 | 182 |
| 415 | 3300025292 | Ga0209676_1001174 | Ga0209676_100117414 | 182 |
| 416 | 3300025292 | Ga0209676_1001483 | Ga0209676_10014834 | 182 |
| 417 | 3300025292 | Ga0209676_1009702 | Ga0209676_10097022 | 182 |
| 418 | 3300025292 | Ga0209676_1013029 | Ga0209676_10130293 | 182 |
| 419 | 3300025294 | Ga0209025_1000039 | Ga0209025_1000039111 | 182 |
| 420 | 3300025294 | Ga0209025_1001144 | Ga0209025_100114420 | 182 |
| 421 | 3300025294 | Ga0209025_1001306 | Ga0209025_100130614 | 182 |
| 422 | 3300025294 | Ga0209025_1002293 | Ga0209025_100229314 | 182 |
| 423 | 3300025294 | Ga0209025_1008688 | Ga0209025_10086886 | 182 |
| 424 | 3300025295 | Ga0209564_1000108 | Ga0209564_100010872 | 182 |
| 425 | 3300025295 | Ga0209564_1002628 | Ga0209564_10026289 | 182 |
| 426 | 3300025297 | Ga0209758_1002709 | Ga0209758_100270912 | 182 |
| 427 | 3300025298 | Ga0209050_1000366 | Ga0209050_100036662 | 182 |
| 428 | 3300025298 | Ga0209050_1000662 | Ga0209050_100066233 | 182 |
| 429 | 3300025298 | Ga0209050_1044661 | Ga0209050_10446612 | 182 |
| 430 | 3300025298 | Ga0209050_1057919 | Ga0209050_10579192 | 182 |
| 431 | 3300025299 | Ga0209256_1000101 | Ga0209256_100010186 | 182 |
| 432 | 3300025299 | Ga0209256_1004481 | Ga0209256_10044812 | 182 |
| 433 | 3300025302 | Ga0207426_1000062 | Ga0207426_1000062190 | 182 |
| 434 | 3300025302 | Ga0207426_1000086 | Ga0207426_1000086216 | 182 |
| 435 | 3300025302 | Ga0207426_1000351 | Ga0207426_100035153 | 182 |
| 436 | 3300025303 | Ga0209051_1000186 | Ga0209051_100018698 | 182 |
| 437 | 3300025303 | Ga0209051_1000537 | Ga0209051_100053710 | 182 |
| 438 | 3300025303 | Ga0209051_1000924 | Ga0209051_100092415 | 182 |
| 439 | 3300025303 | Ga0209051_1021493 | Ga0209051_10214932 | 182 |
| 440 | 3300025303 | Ga0209051_1044351 | Ga0209051_10443512 | 182 |
| 441 | 3300025303 | Ga0209051_1084691 | Ga0209051_10846912 | 182 |
| 442 | 3300025304 | Ga0209257_1000516 | Ga0209257_100051645 | 182 |
| 443 | 3300025304 | Ga0209257_1017312 | Ga0209257_10173122 | 182 |
| 444 | 3300025304 | Ga0209257_1040014 | Ga0209257_10400142 | 182 |
| 445 | 3300025321 | Ga0207656_10004263 | Ga0207656_100042636 | 182 |
| 446 | 3300025728 | Ga0207655_1002241 | Ga0207655_10022419 | 182 |
| 447 | 3300025735 | Ga0207713_1024387 | Ga0207713_10243873 | 182 |
| 448 | 3300025907 | Ga0207645_10367545 | Ga0207645_103675452 | 182 |
| 449 | 3300025909 | Ga0207705_10163856 | Ga0207705_101638562 | 182 |
| 450 | 3300025911 | Ga0207654_10878730 | Ga0207654_108787301 | 182 |
| 451 | 3300025913 | Ga0207695_10555858 | Ga0207695_105558581 | 182 |
| 452 | 3300025914 | Ga0207671_10080650 | Ga0207671_100806502 | 182 |
| 453 | 3300025920 | Ga0207649_10813483 | Ga0207649_108134831 | 182 |
| 454 | 3300025923 | Ga0207681_10758591 | Ga0207681_107585912 | 182 |
| 455 | 3300025925 | Ga0207650_10268693 | Ga0207650_102686932 | 182 |
| 456 | 3300025931 | Ga0207644_10197118 | Ga0207644_101971182 | 182 |
| 457 | 3300025934 | Ga0207686_10004128 | Ga0207686_100041282 | 182 |
| 458 | 3300025935 | Ga0207709_10000395 | Ga0207709_1000039517 | 182 |
| 459 | 3300025935 | Ga0207709_10009049 | Ga0207709_100090492 | 182 |
| 460 | 3300025938 | Ga0207704_10193823 | Ga0207704_101938232 | 182 |
| 461 | 3300025940 | Ga0207691_10207211 | Ga0207691_102072112 | 182 |
| 462 | 3300025940 | Ga0207691_10323881 | Ga0207691_103238812 | 182 |
| 463 | 3300025941 | Ga0207711_10022681 | Ga0207711_100226813 | 182 |
| 464 | 3300025941 | Ga0207711_10172764 | Ga0207711_101727641 | 182 |
| 465 | 3300025941 | Ga0207711_10241784 | Ga0207711_102417842 | 182 |
| 466 | 3300025942 | Ga0207689_10473594 | Ga0207689_104735942 | 182 |
| 467 | 3300025945 | Ga0207679_10064896 | Ga0207679_100648963 | 182 |
| 468 | 3300025949 | Ga0207667_10137473 | Ga0207667_101374732 | 182 |
| 469 | 3300025986 | Ga0207658_10334963 | Ga0207658_103349632 | 182 |
| 470 | 3300026089 | Ga0207648_10024407 | Ga0207648_100244072 | 182 |
| 471 | 3300026095 | Ga0207676_10186965 | Ga0207676_101869652 | 182 |
| 472 | 3300026142 | Ga0207698_10689675 | Ga0207698_106896752 | 182 |
| 473 | 3300027666 | Ga0209282_1000064 | Ga0209282_100006451 | 182 |
| 474 | 3300027866 | Ga0209813_10103584 | Ga0209813_101035842 | 182 |
| 475 | 3300028379 | Ga0268266_10302476 | Ga0268266_103024762 | 182 |
| 476 | 3300028794 | Ga0307515_10007523 | Ga0307515_100075233 | 182 |
| 477 | 3300028794 | Ga0307515_10352587 | Ga0307515_103525872 | 182 |
| 478 | 3300030742 | Ga0316183_1105275 | Ga0316183_11052752 | 182 |
| 479 | 3300031238 | Ga0265332_10032458 | Ga0265332_100324583 | 182 |
| 480 | 3300031251 | Ga0265327_10002512 | Ga0265327_100025123 | 182 |
| 481 | 3300031251 | Ga0265327_10003400 | Ga0265327_100034003 | 182 |
| 482 | 3300031456 | Ga0307513_10024220 | Ga0307513_100242207 | 182 |
| 483 | 3300031456 | Ga0307513_10042159 | Ga0307513_100421592 | 182 |
| 484 | 3300031548 | Ga0307408_100488092 | Ga0307408_1004880921 | 182 |
| 485 | 3300031548 | Ga0307408_101444294 | Ga0307408_1014442941 | 182 |
| 486 | 3300031712 | Ga0265342_10261243 | Ga0265342_102612432 | 182 |
| 487 | 3300031731 | Ga0307405_10000696 | Ga0307405_1000069611 | 182 |
| 488 | 3300031731 | Ga0307405_10071753 | Ga0307405_100717532 | 182 |
| 489 | 3300031731 | Ga0307405_10205519 | Ga0307405_102055191 | 182 |
| 490 | 3300031731 | Ga0307405_10665360 | Ga0307405_106653601 | 182 |
| 491 | 3300031911 | Ga0307412_10036686 | Ga0307412_100366863 | 182 |
| 492 | 3300031911 | Ga0307412_10128660 | Ga0307412_101286602 | 182 |
| 493 | 3300031911 | Ga0307412_10516872 | Ga0307412_105168722 | 182 |
| 494 | 3300032002 | Ga0307416_100164655 | Ga0307416_1001646553 | 182 |
| 495 | 3300032002 | Ga0307416_100890514 | Ga0307416_1008905142 | 182 |
| 496 | 3300032005 | Ga0307411_10931186 | Ga0307411_109311862 | 182 |
| 497 | 3300039447 | Ga0436361_0931379 | Ga0436361_0931379_1017_1571 | 182 |
| 498 | 3300041443 | Ga0451789_1326119 | Ga0451789_1326119_53_625 | 182 |
| 499 | 3300041498 | Ga0451841_0879473 | Ga0451841_0879473_61_633 | 182 |
| 500 | 3300041509 | Ga0451843_1664536 | Ga0451843_1664536_168_740 | 182 |
| 501 | 3300042007 | Ga0439449_0011518 | Ga0439449_0011518_641_1189 | 182 |
| 502 | 3300042010 | Ga0439452_000001 | Ga0439452_000001_1564056_1564619 | 182 |
| 503 | 3300042876 | Ga0451577_0483823 | Ga0451577_0483823_438_989 | 182 |
| 504 | 3300042876 | Ga0451577_0686074 | Ga0451577_0686074_179_739 | 182 |
| 505 | 3300042876 | Ga0451577_0946058 | Ga0451577_0946058_76_636 | 182 |
| 506 | 3300044673 | Ga0453683_0007367 | Ga0453683_0007367_1018_1584 | 182 |
| 507 | 3300044712 | Ga0453684_0000066 | Ga0453684_0000066_300666_301232 | 182 |
| 508 | 3300044712 | Ga0453684_0425841 | Ga0453684_0425841_550_1101 | 182 |
| 509 | 3300044712 | Ga0453684_0653086 | Ga0453684_0653086_218_778 | 182 |
| 510 | 3300044901 | Ga0466960_0133327 | Ga0466960_0133327_104_661 | 182 |
| 511 | 3300045051 | Ga0451576_0017861 | Ga0451576_0017861_5978_6544 | 182 |
| 512 | 3300045051 | Ga0451576_0033048 | Ga0451576_0033048_3738_4298 | 182 |
| 513 | 3300046453 | Ga0495627_007933 | Ga0495627_007933_2541_3089 | 182 |
| 514 | 3300046515 | Ga0495620_0001167 | Ga0495620_0001167_6874_7422 | 182 |
| 515 | 3300046524 | Ga0495648_0216978 | Ga0495648_0216978_82_630 | 182 |
| 516 | 3300046528 | Ga0495642_0036878 | Ga0495642_0036878_133_687 | 182 |
| 517 | 3300046539 | Ga0495621_0037044 | Ga0495621_0037044_794_1363 | 182 |
| 518 | 3300046660 | Ga0495625_0172357 | Ga0495625_0172357_145_693 | 182 |
| 519 | 3300046660 | Ga0495625_0410639 | Ga0495625_0410639_241_792 | 182 |
| 520 | 3300046674 | Ga0495588_0027358 | Ga0495588_0027358_1384_1932 | 182 |
| 521 | 3300046692 | Ga0495671_0017797 | Ga0495671_0017797_1149_1697 | 182 |
| 522 | 3300046694 | Ga0495649_0250976 | Ga0495649_0250976_233_787 | 182 |
| 523 | 3300047321 | Ga0495676_0173611 | Ga0495676_0173611_774_1322 | 182 |
| 524 | 3300048911 | Ga0496108_0643426 | Ga0496108_0643426_110_679 | 182 |
| 525 | 3300048914 | Ga0496111_0147102 | Ga0496111_0147102_38_589 | 182 |
| 526 | 3300048919 | Ga0496116_0102357 | Ga0496116_0102357_89_637 | 182 |
| 527 | 3300048919 | Ga0496116_0108568 | Ga0496116_0108568_1067_1618 | 182 |
| 528 | 3300048921 | Ga0496118_0029317 | Ga0496118_0029317_1043_1591 | 182 |
| 529 | 3300048921 | Ga0496118_0319932 | Ga0496118_0319932_46_600 | 182 |
| 530 | 3300048924 | Ga0496121_0001565 | Ga0496121_0001565_24174_24725 | 182 |
| 531 | 3300048924 | Ga0496121_0002670 | Ga0496121_0002670_25499_26047 | 182 |
| 532 | 3300048924 | Ga0496121_0010210 | Ga0496121_0010210_1197_1745 | 182 |
| 533 | 3300048924 | Ga0496121_0022497 | Ga0496121_0022497_3827_4375 | 182 |
| 534 | 3300048925 | Ga0496122_0000184 | Ga0496122_0000184_115837_116385 | 182 |
| 535 | 3300048925 | Ga0496122_0024605 | Ga0496122_0024605_3953_4507 | 182 |
| 536 | 3300048926 | Ga0496123_0000181 | Ga0496123_0000181_52784_53332 | 182 |
| 537 | 3300048926 | Ga0496123_0016077 | Ga0496123_0016077_3310_3864 | 182 |
| 538 | 3300048927 | Ga0496124_0637679 | Ga0496124_0637679_41_589 | 182 |
| 539 | 3300048928 | Ga0496125_0002173 | Ga0496125_0002173_21397_21951 | 182 |
| 540 | 3300048928 | Ga0496125_0004639 | Ga0496125_0004639_4965_5516 | 182 |
| 541 | 3300048928 | Ga0496125_0015028 | Ga0496125_0015028_6455_7003 | 182 |
| 542 | 3300048929 | Ga0496126_0000184 | Ga0496126_0000184_137620_138174 | 182 |
| 543 | 3300049517 | Ga0501294_003487 | Ga0501294_003487_40_591 | 182 |
| 544 | 3300049568 | Ga0501031_0001212 | Ga0501031_0001212_4184_4732 | 182 |
| 545 | 3300049568 | Ga0501031_0035188 | Ga0501031_0035188_866_1414 | 182 |
| 546 | 3300049569 | Ga0501032_0000170 | Ga0501032_0000170_20238_20786 | 182 |
| 547 | 3300049569 | Ga0501032_0286253 | Ga0501032_0286253_77_625 | 182 |
| 548 | 3300049570 | Ga0501033_0001496 | Ga0501033_0001496_15166_15714 | 182 |
| 549 | 3300049570 | Ga0501033_0012221 | Ga0501033_0012221_926_1474 | 182 |
| 550 | 3300049571 | Ga0501034_0003948 | Ga0501034_0003948_9427_9975 | 182 |
| 551 | 3300049572 | Ga0501036_0003504 | Ga0501036_0003504_11353_11901 | 182 |
| 552 | 3300049572 | Ga0501036_0011422 | Ga0501036_0011422_2615_3163 | 182 |
| 553 | 3300049572 | Ga0501036_0014236 | Ga0501036_0014236_4091_4639 | 182 |
| 554 | 3300049573 | Ga0501037_0000691 | Ga0501037_0000691_17515_18063 | 182 |
| 555 | 3300049573 | Ga0501037_0202712 | Ga0501037_0202712_518_1066 | 182 |
| 556 | 3300049574 | Ga0501038_0001058 | Ga0501038_0001058_18848_19396 | 182 |
| 557 | 3300049574 | Ga0501038_0002695 | Ga0501038_0002695_6190_6738 | 182 |
| 558 | 3300049575 | Ga0501039_0015846 | Ga0501039_0015846_270_818 | 182 |
| 559 | 3300049575 | Ga0501039_0056179 | Ga0501039_0056179_1315_1863 | 182 |
| 560 | 3300049576 | Ga0501040_0002856 | Ga0501040_0002856_9961_10509 | 182 |
| 561 | 3300049578 | Ga0501042_0002804 | Ga0501042_0002804_2290_2838 | 182 |
| 562 | 3300049579 | Ga0501043_0002328 | Ga0501043_0002328_8984_9532 | 182 |
| 563 | 3300049579 | Ga0501043_0060611 | Ga0501043_0060611_242_790 | 182 |
| 564 | 3300049580 | Ga0501046_0000547 | Ga0501046_0000547_9500_10048 | 182 |
| 565 | 3300049580 | Ga0501046_0189853 | Ga0501046_0189853_232_780 | 182 |
| 566 | 3300049581 | Ga0501047_0055318 | Ga0501047_0055318_2106_2654 | 182 |
| 567 | 3300049582 | Ga0501048_0000431 | Ga0501048_0000431_22728_23276 | 182 |
| 568 | 3300049649 | Ga0501198_000001 | Ga0501198_000001_125922_126473 | 182 |
| 569 | 3300049662 | Ga0501222_000004 | Ga0501222_000004_114898_115449 | 182 |
| 570 | 3300049669 | Ga0501235_021690 | Ga0501235_021690_289_837 | 182 |
| 571 | 3300049671 | Ga0501238_020097 | Ga0501238_020097_194_742 | 182 |
| 572 | 3300049762 | Ga0501265_004690 | Ga0501265_004690_258_821 | 182 |
| 573 | 3300049822 | Ga0501035_0000444 | Ga0501035_0000444_4125_4673 | 182 |
| 574 | 3300049822 | Ga0501035_0016947 | Ga0501035_0016947_4811_5359 | 182 |
| 575 | 3300049822 | Ga0501035_0023282 | Ga0501035_0023282_2362_2910 | 182 |
| 576 | 3300049822 | Ga0501035_0034102 | Ga0501035_0034102_1531_2079 | 182 |
| 577 | 3300049823 | Ga0501044_0000699 | Ga0501044_0000699_4367_4915 | 182 |
| 578 | 3300049823 | Ga0501044_0001119 | Ga0501044_0001119_26225_26773 | 182 |
| 579 | 3300049823 | Ga0501044_0013984 | Ga0501044_0013984_6977_7525 | 182 |
| 580 | 3300049824 | Ga0501045_0000835 | Ga0501045_0000835_9814_10362 | 182 |
| 581 | 3300050490 | nmdc:mga03n38_20185_c1 | nmdc:mga03n38_20185_c1_714_1262 | 182 |
| 582 | 3300050493 | nmdc:mga0k408_33773_c1 | nmdc:mga0k408_33773_c1_310_861 | 182 |
| 583 | 3300050493 | nmdc:mga0k408_67455_c2 | nmdc:mga0k408_67455_c2_469_1020 | 182 |
| 584 | 3300050494 | nmdc:mga06z11_56688_c1 | nmdc:mga06z11_56688_c1_256_804 | 182 |
| 585 | 3300050495 | nmdc:mga04h51_23007_c1 | nmdc:mga04h51_23007_c1_182_730 | 182 |
| 586 | 3300050496 | nmdc:mga07m45_314819_c1 | nmdc:mga07m45_314819_c1_101_649 | 182 |
| 587 | 3300050496 | nmdc:mga07m45_5447_c1 | nmdc:mga07m45_5447_c1_4131_4682 | 182 |
| 588 | 3300053079 | Ga0500610_0000109 | Ga0500610_0000109_23419_23967 | 182 |
| 589 | 3300053087 | Ga0500643_003277 | Ga0500643_003277_811_1359 | 182 |
| 590 | 3300053088 | Ga0500644_0002709 | Ga0500644_0002709_3522_4070 | 182 |
| 591 | 3300053111 | Ga0500572_031369 | Ga0500572_031369_875_1423 | 182 |
| 592 | 3300053121 | Ga0500607_000706 | Ga0500607_000706_21863_22411 | 182 |
| 593 | 3300053122 | Ga0500608_000716 | Ga0500608_000716_8206_8754 | 182 |
| 594 | 3300053133 | Ga0500655_000071 | Ga0500655_000071_597_1145 | 182 |
| 595 | 3300053136 | Ga0500559_0092765 | Ga0500559_0092765_200_748 | 182 |
| 596 | 3300053139 | Ga0500568_0110561 | Ga0500568_0110561_100_648 | 182 |
| 597 | 3300053141 | Ga0500574_000131 | Ga0500574_000131_816_1364 | 182 |
| 598 | 3300053158 | Ga0500627_0000163 | Ga0500627_0000163_3795_4343 | 182 |
| 599 | 3300053161 | Ga0500634_0000678 | Ga0500634_0000678_10473_11021 | 182 |
| 600 | 3300053162 | Ga0500638_013878 | Ga0500638_013878_488_1036 | 182 |
| 601 | 3300053177 | Ga0500636_0273281 | Ga0500636_0273281_104_652 | 182 |
| 602 | 3300053730 | Ga0500645_000521 | Ga0500645_000521_22941_23489 | 182 |
| 603 | 3300053730 | Ga0500645_007029 | Ga0500645_007029_617_1165 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.987 | 2 | 176 |
| 6din-assembly1.cif.gz_A-2 | high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase | 0.976 | 1 | 182 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9758 | 1 | 182 |
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9733 | 2 | 182 |
| 1ep0-assembly1.cif.gz_A | high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum | 0.9638 | 2 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9756 | 2 | 182 | 2.60.120.10 |
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9638 | 2 | 178 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9602 | 1 | 178 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9577 | 1 | 178 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9459 | 2 | 175 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432R1U7-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9997 | 45 | 176 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7C8XNS0-F1-model_v4 | deleted | 0.9977 | 44 | 168 |
|
| AF-A0A0F8Z5C9-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase | 0.9955 | 40 | 176 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A1F3TT77-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9951 | 1 | 177 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A5C7VRA9-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.995 | 1 | 150 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar