F468254

General Info

Members Datasets Scaffolds Average Seq Length
603 294 1206 123

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100000757|Ga0070707_10000075722
Length 146
Sequence LVIKSCRRSNYLRGLYRPGRAGRRSNLEVPILKQGEFLIATIQAALSDADLEHLRMALIQRVVRFRSRAVIVDVTAMDVMDSFASRTLKEIAQMIRLRGAETVIVGIQPEVAFAMVQLGITLESVVTALDLEEGLAYLSQKFKNLN

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
197 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
265 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
266 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
287 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
288 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
289 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
290 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
291 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
292 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0
Rhizoplane 1.16
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 15.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100000757 3300005468 Bacteria 31825
2 JGI24739J22299_10003890 3300001989 Bacteria 5708
3 JGI24735J21928_10012485 3300002067 Bacteria 2685
4 JGI24735J21928_10096394 3300002067 Bacteria 849
5 JGI24738J21930_10029093 3300002075 Bacteria 1130
6 JGI25404J52841_10112186 3300003659 Bacteria 574
7 Ga0058863_11939990 3300004799 Bacteria 1205
8 Ga0058861_12019593 3300004800 Bacteria 1054
9 Ga0058862_12032011 3300004803 Bacteria 786
10 Ga0065704_10128233 3300005289 Bacteria 1665
11 Ga0065704_10199856 3300005289 Bacteria 1151
12 Ga0065712_10068043 3300005290 Bacteria 16250
13 Ga0065707_10998489 3300005295 Unclassified 540
14 Ga0070658_10000430 3300005327 Bacteria 36463
15 Ga0070658_10030651 3300005327 Bacteria 4320
16 Ga0070658_10738525 3300005327 Bacteria 855
17 Ga0070683_100016113 3300005329 Bacteria 6580
18 Ga0070683_100017313 3300005329 Bacteria 6369
19 Ga0070690_101608814 3300005330 Unclassified 527
20 Ga0068869_100062298 3300005334 Unclassified 2738
21 Ga0070680_100002768 3300005336 Bacteria 13019
22 Ga0070680_100290406 3300005336 Bacteria 1386
23 Ga0070680_100317577 3300005336 Bacteria 1322
24 Ga0070680_100336922 3300005336 Bacteria 1282
25 Ga0070680_100763168 3300005336 Bacteria 833
26 Ga0070680_100861899 3300005336 Bacteria 781
27 Ga0070682_100006566 3300005337 Bacteria 6527
28 Ga0070682_100152269 3300005337 Bacteria 1588
29 Ga0068868_101501305 3300005338 Bacteria 631
30 Ga0070660_100002814 3300005339 Bacteria 11970
31 Ga0070660_100022971 3300005339 Bacteria 4617
32 Ga0070660_100294708 3300005339 Bacteria 1329
33 Ga0070689_100058328 3300005340 Bacteria 2998
34 Ga0070689_100870593 3300005340 Unclassified 796
35 Ga0070687_100147273 3300005343 Bacteria 1378
36 Ga0070661_100004671 3300005344 Bacteria 9432
37 Ga0070661_100043989 3300005344 Bacteria 3262
38 Ga0070692_10158390 3300005345 Bacteria 1295
39 Ga0070668_100339246 3300005347 Bacteria 1269
40 Ga0070669_100151973 3300005353 Bacteria 1793
41 Ga0070675_100049639 3300005354 Bacteria 3445
42 Ga0070675_100083008 3300005354 Bacteria 2674
43 Ga0070675_100343029 3300005354 Bacteria 1323
44 Ga0070674_100414275 3300005356 Bacteria 1104
45 Ga0070673_100004344 3300005364 Bacteria 8952
46 Ga0070688_100103756 3300005365 Bacteria 1879
47 Ga0070659_100005303 3300005366 Bacteria 9247
48 Ga0070659_100018107 3300005366 Bacteria 5312
49 Ga0070703_10127341 3300005406 Bacteria 931
50 Ga0070709_10040565 3300005434 Unclassified 2863
51 Ga0070709_10476079 3300005434 Unclassified 945
52 Ga0070713_100237939 3300005436 Bacteria 1657
53 Ga0070713_100654316 3300005436 Bacteria 1001
54 Ga0070701_10148358 3300005438 Bacteria 1348
55 Ga0070711_100022261 3300005439 Bacteria 4106
56 Ga0070711_100943183 3300005439 Unclassified 738
57 Ga0070705_100349493 3300005440 Bacteria 1077
58 Ga0070705_101010254 3300005440 Bacteria 676
59 Ga0070700_101207043 3300005441 Bacteria 632
60 Ga0070694_100009171 3300005444 Bacteria 6069
61 Ga0070694_100405890 3300005444 Bacteria 1068
62 Ga0070694_100725526 3300005444 Bacteria 810
63 Ga0070694_100757018 3300005444 Bacteria 794
64 Ga0070708_100027418 3300005445 Bacteria 4887
65 Ga0070708_100042192 3300005445 Bacteria 4003
66 Ga0070708_100045449 3300005445 Unclassified 3868
67 Ga0070708_100087615 3300005445 Bacteria 2829
68 Ga0070708_100548915 3300005445 Bacteria 1090
69 Ga0070708_101769841 3300005445 Unclassified 574
70 Ga0070708_102132254 3300005445 Bacteria 518
71 Ga0070663_100014555 3300005455 Bacteria 5052
72 Ga0070663_100780889 3300005455 Bacteria 818
73 Ga0070678_100218774 3300005456 Bacteria 1582
74 Ga0070678_100811948 3300005456 Bacteria 850
75 Ga0070662_100012278 3300005457 Bacteria 5674
76 Ga0070681_10012012 3300005458 Bacteria 8586
77 Ga0070681_10052395 3300005458 Unclassified 4070
78 Ga0070681_11537999 3300005458 Unclassified 590
79 Ga0070681_11640299 3300005458 Bacteria 569
80 Ga0068867_100165383 3300005459 Bacteria 1748
81 Ga0068867_100505965 3300005459 Bacteria 1039
82 Ga0070685_10289970 3300005466 Bacteria 1099
83 Ga0070706_100026674 3300005467 Bacteria 5315
84 Ga0070706_100040481 3300005467 Bacteria 4301
85 Ga0070706_100049112 3300005467 Bacteria 3894
86 Ga0070706_100492981 3300005467 Bacteria 1140
87 Ga0070707_100017897 3300005468 Bacteria 6663
88 Ga0070707_100060885 3300005468 Bacteria 3620
89 Ga0070707_100161889 3300005468 Bacteria 2180
90 Ga0070707_100171091 3300005468 Bacteria 2117
91 Ga0070707_100245359 3300005468 Bacteria 1743
92 Ga0070707_100567966 3300005468 Unclassified 1096
93 Ga0070698_100009446 3300005471 Bacteria 10447
94 Ga0070698_100023991 3300005471 Bacteria 6369
95 Ga0070698_100031252 3300005471 Bacteria 5520
96 Ga0070698_100112882 3300005471 Bacteria 2682
97 Ga0070698_100156552 3300005471 Bacteria 2224
98 Ga0070698_100237534 3300005471 Unclassified 1755
99 Ga0070698_100704409 3300005471 Bacteria 952
100 Ga0070699_100046774 3300005518 Bacteria 3744
101 Ga0070699_100270568 3300005518 Bacteria 1520
102 Ga0070699_100408260 3300005518 Unclassified 1229
103 Ga0070699_100653442 3300005518 Unclassified 960
104 Ga0070699_101034958 3300005518 Unclassified 753
105 Ga0070699_101210114 3300005518 Unclassified 693
106 Ga0070699_101611310 3300005518 Unclassified 595
107 Ga0070679_100000204 3300005530 Bacteria 48597
108 Ga0070679_100048047 3300005530 Bacteria 4253
109 Ga0070679_100050961 3300005530 Bacteria 4123
110 Ga0070679_100252812 3300005530 Bacteria 1718
111 Ga0070684_100004114 3300005535 Bacteria 11006
112 Ga0070684_100119570 3300005535 Bacteria 2369
113 Ga0070684_100795381 3300005535 Bacteria 884
114 Ga0070697_100000245 3300005536 Bacteria 44166
115 Ga0070697_100006469 3300005536 Bacteria 9069
116 Ga0070697_100031731 3300005536 Bacteria 4251
117 Ga0070697_100052213 3300005536 Bacteria 3322
118 Ga0070697_100145925 3300005536 Bacteria 1992
119 Ga0070697_100561706 3300005536 Bacteria 1001
120 Ga0070697_101350704 3300005536 Unclassified 636
121 Ga0070697_101697643 3300005536 Unclassified 565
122 Ga0068853_100026203 3300005539 Bacteria 4895
123 Ga0070672_100176946 3300005543 Bacteria 1777
124 Ga0070672_101346594 3300005543 Unclassified 638
125 Ga0070686_100044985 3300005544 Bacteria 2779
126 Ga0070686_100151292 3300005544 Bacteria 1626
127 Ga0070686_100854622 3300005544 Bacteria 737
128 Ga0070686_101149995 3300005544 Unclassified 643
129 Ga0070695_100054231 3300005545 Bacteria 2579
130 Ga0070695_100056005 3300005545 Bacteria 2543
131 Ga0070695_100561728 3300005545 Unclassified 891
132 Ga0070696_100044915 3300005546 Bacteria 3060
133 Ga0070665_100294644 3300005548 Bacteria 1625
134 Ga0070665_100414769 3300005548 Bacteria 1355
135 Ga0070704_100102311 3300005549 Bacteria 2161
136 Ga0070704_100176284 3300005549 Bacteria 1705
137 Ga0070704_100290835 3300005549 Bacteria 1357
138 Ga0070704_100573081 3300005549 Unclassified 989
139 Ga0068855_100015382 3300005563 Bacteria 9212
140 Ga0068855_100040254 3300005563 Bacteria 5547
141 Ga0068855_100041108 3300005563 Bacteria 5482
142 Ga0068855_100096356 3300005563 Bacteria 3409
143 Ga0068855_100707279 3300005563 Bacteria 1078
144 Ga0070664_100007907 3300005564 Bacteria 8589
145 Ga0070664_100170438 3300005564 Bacteria 1931
146 Ga0070664_100332936 3300005564 Bacteria 1378
147 Ga0068857_100031881 3300005577 Bacteria 4657
148 Ga0068857_100075671 3300005577 Bacteria 3001
149 Ga0068857_100261546 3300005577 Bacteria 1588
150 Ga0068857_101089472 3300005577 Bacteria 771
151 Ga0068857_101734025 3300005577 Bacteria 611
152 Ga0068854_100051113 3300005578 Unclassified 2960
153 Ga0068854_100338079 3300005578 Bacteria 1229
154 Ga0068856_100009433 3300005614 Bacteria 9476
155 Ga0068856_100027492 3300005614 Bacteria 5550
156 Ga0068856_100032011 3300005614 Bacteria 5147
157 Ga0068856_101076918 3300005614 Unclassified 821
158 Ga0068856_102035484 3300005614 Unclassified 584
159 Ga0068852_100003295 3300005616 Bacteria 11278
160 Ga0068852_100024491 3300005616 Bacteria 4879
161 Ga0068859_100062063 3300005617 Bacteria 3767
162 Ga0068864_100839031 3300005618 Bacteria 905
163 Ga0068864_101816775 3300005618 Bacteria 615
164 Ga0068861_100080386 3300005719 Unclassified 2550
165 Ga0068851_10018010 3300005834 Bacteria 3400
166 Ga0068870_10018795 3300005840 Bacteria 3342
167 Ga0068870_10032551 3300005840 Bacteria 2652
168 Ga0068863_100372257 3300005841 Bacteria 1394
169 Ga0068860_102145849 3300005843 Unclassified 580
170 Ga0068862_100095142 3300005844 Unclassified 2598
171 Ga0068862_101012181 3300005844 Unclassified 822
172 Ga0081455_10085283 3300005937 Bacteria 2576
173 Ga0070717_10004749 3300006028 Bacteria 9879
174 Ga0075363_100183450 3300006048 Bacteria 1191
175 Ga0070716_100000419 3300006173 Bacteria 17498
176 Ga0070716_100247890 3300006173 Bacteria 1211
177 Ga0070716_100333165 3300006173 Unclassified 1068
178 Ga0070716_100412986 3300006173 Bacteria 974
179 Ga0075370_10284924 3300006353 Bacteria 982
180 Ga0075428_100000302 3300006844 Bacteria 48489
181 Ga0075428_100010554 3300006844 Bacteria 10267
182 Ga0075428_100034098 3300006844 Bacteria 5616
183 Ga0075428_100105087 3300006844 Bacteria 3080
184 Ga0075428_100153204 3300006844 Unclassified 2504
185 Ga0075430_100001283 3300006846 Bacteria 20248
186 Ga0075430_100002458 3300006846 Bacteria 15422
187 Ga0075430_100014640 3300006846 Bacteria 6681
188 Ga0075430_100044154 3300006846 Bacteria 3770
189 Ga0075430_100106988 3300006846 Unclassified 2333
190 Ga0075431_100000369 3300006847 Bacteria 35787
191 Ga0075431_100000824 3300006847 Bacteria 27066
192 Ga0075431_100012703 3300006847 Bacteria 8504
193 Ga0075431_100014624 3300006847 Bacteria 7939
194 Ga0075431_100034841 3300006847 Bacteria 5185
195 Ga0075431_100036161 3300006847 Bacteria 5087
196 Ga0075431_100141204 3300006847 Bacteria 2482
197 Ga0075433_10034272 3300006852 Bacteria 4359
198 Ga0075433_10208015 3300006852 Bacteria 1739
199 Ga0075433_10210436 3300006852 Bacteria 1728
200 Ga0075434_100015221 3300006871 Bacteria 7371
201 Ga0075434_100025853 3300006871 Bacteria 5746
202 Ga0075434_100052669 3300006871 Bacteria 4044
203 Ga0075434_100359134 3300006871 Bacteria 1478
204 Ga0075434_100469881 3300006871 Bacteria 1279
205 Ga0075429_100003096 3300006880 Bacteria 14116
206 Ga0075429_100014099 3300006880 Bacteria 6924
207 Ga0075429_100033782 3300006880 Bacteria 4444
208 Ga0075429_100279570 3300006880 Bacteria 1462
209 Ga0075429_100488924 3300006880 Bacteria 1078
210 Ga0075429_100495314 3300006880 Bacteria 1071
211 Ga0075436_100006784 3300006914 Bacteria 7834
212 Ga0075436_100058315 3300006914 Bacteria 2666
213 Ga0075436_100560860 3300006914 Bacteria 839
214 Ga0075436_101451978 3300006914 Bacteria 520
215 Ga0097620_100062063 3300006931 Bacteria 3767
216 Ga0075435_100014501 3300007076 Bacteria 5893
217 Ga0075435_100703751 3300007076 Bacteria 878
218 Ga0099794_10012243 3300007265 Bacteria 3694
219 Ga0099794_10013743 3300007265 Bacteria 3531
220 Ga0099794_10015286 3300007265 Bacteria 3385
221 Ga0099794_10021323 3300007265 Bacteria 2943
222 Ga0099794_10023552 3300007265 Bacteria 2818
223 Ga0099794_10038029 3300007265 Unclassified 2279
224 Ga0099794_10065561 3300007265 Bacteria 1771
225 Ga0099794_10071967 3300007265 Viruses 1694
226 Ga0099794_10083634 3300007265 Bacteria 1577
227 Ga0099794_10136481 3300007265 Unclassified 1241
228 Ga0099794_10147870 3300007265 Bacteria 1192
229 Ga0099794_10224668 3300007265 Bacteria 965
230 Ga0099794_10234803 3300007265 Unclassified 944
231 Ga0099794_10261786 3300007265 Bacteria 893
232 Ga0099795_10014979 3300007788 Bacteria 2417
233 Ga0105240_10036252 3300009093 Bacteria 6346
234 Ga0105240_10045151 3300009093 Bacteria 5592
235 Ga0105240_10191331 3300009093 Bacteria 2406
236 Ga0105240_10610943 3300009093 Unclassified 1199
237 Ga0111539_10023967 3300009094 Bacteria 7496
238 Ga0111539_10044482 3300009094 Bacteria 5319
239 Ga0111539_10130913 3300009094 Bacteria 2938
240 Ga0111539_10185964 3300009094 Bacteria 2426
241 Ga0111539_12955110 3300009094 Bacteria 550
242 Ga0105247_10347735 3300009101 Unclassified 1042
243 Ga0114129_10023845 3300009147 Bacteria 8671
244 Ga0114129_10077212 3300009147 Bacteria 4633
245 Ga0114129_10094797 3300009147 Bacteria 4134
246 Ga0114129_10127492 3300009147 Bacteria 3498
247 Ga0114129_10162119 3300009147 Bacteria 3053
248 Ga0114129_10169455 3300009147 Bacteria 2978
249 Ga0114129_10517251 3300009147 Bacteria 1556
250 Ga0114129_10594073 3300009147 Bacteria 1435
251 Ga0114129_10629912 3300009147 Bacteria 1386
252 Ga0114129_11151349 3300009147 Bacteria 968
253 Ga0114129_11268557 3300009147 Bacteria 915
254 Ga0105243_10962149 3300009148 Unclassified 854
255 Ga0105242_10825785 3300009176 Unclassified 920
256 Ga0105242_12628326 3300009176 Bacteria 553
257 Ga0105237_10031160 3300009545 Bacteria 5409
258 Ga0105237_10372055 3300009545 Bacteria 1434
259 Ga0105237_11417431 3300009545 Unclassified 701
260 Ga0105238_10006427 3300009551 Bacteria 11692
261 Ga0105238_10026651 3300009551 Bacteria 5893
262 Ga0105249_10690465 3300009553 Bacteria 1080
263 Ga0099796_10006403 3300010159 Bacteria 3010
264 Ga0099796_10027408 3300010159 Bacteria 1819
265 Ga0099796_10163890 3300010159 Unclassified 883
266 Ga0105239_10023385 3300010375 Bacteria 6805
267 Ga0105239_10040440 3300010375 Bacteria 5108
268 Ga0105239_10509436 3300010375 Bacteria 1369
269 Ga0105246_11278563 3300011119 Bacteria 679
270 Ga0157371_10138414 3300013102 Bacteria 1734
271 Ga0157370_10063785 3300013104 Bacteria 3489
272 Ga0157369_10017515 3300013105 Bacteria 8050
273 Ga0157369_10179745 3300013105 Bacteria 2226
274 Ga0157369_10230561 3300013105 Bacteria 1936
275 Ga0157374_12954837 3300013296 Unclassified 502
276 Ga0157378_10062089 3300013297 Unclassified 3336
277 Ga0157378_12075042 3300013297 Unclassified 619
278 Ga0163162_10534004 3300013306 Bacteria 1302
279 Ga0157372_10308169 3300013307 Bacteria 1843
280 Ga0157372_10671960 3300013307 Bacteria 1206
281 Ga0157372_10733668 3300013307 Bacteria 1149
282 Ga0157372_11076206 3300013307 Unclassified 930
283 Ga0157372_12561207 3300013307 Unclassified 585
284 Ga0157375_12557491 3300013308 Bacteria 610
285 Ga0163163_10128189 3300014325 Bacteria 2576
286 Ga0163163_11415299 3300014325 Bacteria 757
287 Ga0163163_11968440 3300014325 Bacteria 644
288 Ga0157380_10272592 3300014326 Bacteria 1544
289 Ga0157380_10575212 3300014326 Bacteria 1110
290 Ga0157377_10009347 3300014745 Bacteria 4805
291 Ga0157376_11383215 3300014969 Bacteria 735
292 Ga0157376_11443505 3300014969 Unclassified 720
293 Ga0206353_11390319 3300020082 Bacteria 7704
294 Ga0213875_10086146 3300021388 Bacteria 1465
295 Ga0207697_10012034 3300025315 Unclassified 3641
296 Ga0207656_10024056 3300025321 Bacteria 2459
297 Ga0207653_10177393 3300025885 Bacteria 796
298 Ga0207688_10097288 3300025901 Bacteria 1696
299 Ga0207647_10100804 3300025904 Bacteria 1714
300 Ga0207685_10016696 3300025905 Bacteria 2355
301 Ga0207699_10012151 3300025906 Unclassified 4372
302 Ga0207643_10023243 3300025908 Bacteria 3418
303 Ga0207643_10031607 3300025908 Bacteria 2952
304 Ga0207705_10004496 3300025909 Bacteria 10541
305 Ga0207705_10010662 3300025909 Bacteria 6674
306 Ga0207705_10534837 3300025909 Bacteria 911
307 Ga0207684_10010544 3300025910 Bacteria 8124
308 Ga0207684_10296886 3300025910 Bacteria 1393
309 Ga0207684_10333238 3300025910 Bacteria 1307
310 Ga0207684_10337600 3300025910 Unclassified 1298
311 Ga0207654_10029266 3300025911 Unclassified 3013
312 Ga0207707_10001494 3300025912 Bacteria 21591
313 Ga0207707_10011976 3300025912 Bacteria 7541
314 Ga0207707_10538333 3300025912 Bacteria 993
315 Ga0207695_10027597 3300025913 Bacteria 6319
316 Ga0207695_10278186 3300025913 Bacteria 1568
317 Ga0207695_10439409 3300025913 Unclassified 1188
318 Ga0207671_10090392 3300025914 Bacteria 2306
319 Ga0207693_10088473 3300025915 Bacteria 2427
320 Ga0207663_10006475 3300025916 Bacteria 5994
321 Ga0207660_10024752 3300025917 Bacteria 4066
322 Ga0207660_10124874 3300025917 Bacteria 1953
323 Ga0207660_10232487 3300025917 Bacteria 1450
324 Ga0207660_10436744 3300025917 Unclassified 1057
325 Ga0207657_10018726 3300025919 Bacteria 6597
326 Ga0207657_10148606 3300025919 Unclassified 1910
327 Ga0207657_10152186 3300025919 Bacteria 1883
328 Ga0207649_10004323 3300025920 Bacteria 7720
329 Ga0207649_10040451 3300025920 Bacteria 2833
330 Ga0207652_10004433 3300025921 Bacteria 11440
331 Ga0207652_10019004 3300025921 Bacteria 5644
332 Ga0207652_10071753 3300025921 Bacteria 3009
333 Ga0207652_10355322 3300025921 Bacteria 1322
334 Ga0207646_10000478 3300025922 Bacteria 53489
335 Ga0207646_10004774 3300025922 Bacteria 14558
336 Ga0207646_10172902 3300025922 Unclassified 1951
337 Ga0207646_10239643 3300025922 Bacteria 1639
338 Ga0207646_10257484 3300025922 Bacteria 1577
339 Ga0207694_10006436 3300025924 Bacteria 8947
340 Ga0207694_10043320 3300025924 Bacteria 3474
341 Ga0207659_10006095 3300025926 Bacteria 7364
342 Ga0207659_10317475 3300025926 Bacteria 1284
343 Ga0207659_10561664 3300025926 Bacteria 971
344 Ga0207700_10301553 3300025928 Unclassified 1384
345 Ga0207700_10392925 3300025928 Bacteria 1214
346 Ga0207690_10007016 3300025932 Bacteria 6678
347 Ga0207690_10259333 3300025932 Bacteria 1346
348 Ga0207706_10029065 3300025933 Bacteria 4936
349 Ga0207706_10173096 3300025933 Bacteria 1897
350 Ga0207706_11111194 3300025933 Bacteria 660
351 Ga0207670_10271498 3300025936 Bacteria 1318
352 Ga0207669_10792420 3300025937 Bacteria 785
353 Ga0207704_11869275 3300025938 Bacteria 516
354 Ga0207665_10000233 3300025939 Bacteria 37930
355 Ga0207665_10093225 3300025939 Bacteria 2091
356 Ga0207665_10297905 3300025939 Unclassified 1205
357 Ga0207665_10358124 3300025939 Bacteria 1103
358 Ga0207691_10191918 3300025940 Bacteria 1781
359 Ga0207689_10080636 3300025942 Bacteria 2675
360 Ga0207689_10233788 3300025942 Bacteria 1519
361 Ga0207661_10012529 3300025944 Bacteria 6164
362 Ga0207661_10012596 3300025944 Bacteria 6153
363 Ga0207661_10221357 3300025944 Bacteria 1673
364 Ga0207679_10054667 3300025945 Unclassified 2940
365 Ga0207679_10064403 3300025945 Bacteria 2740
366 Ga0207679_10133126 3300025945 Bacteria 1998
367 Ga0207667_10090687 3300025949 Bacteria 3158
368 Ga0207667_10122833 3300025949 Unclassified 2675
369 Ga0207667_10128722 3300025949 Bacteria 2607
370 Ga0207667_10133698 3300025949 Bacteria 2555
371 Ga0207651_10015688 3300025960 Bacteria 4412
372 Ga0207712_10235509 3300025961 Bacteria 1472
373 Ga0207668_10157909 3300025972 Bacteria 1764
374 Ga0207668_10974438 3300025972 Bacteria 757
375 Ga0207640_10128184 3300025981 Bacteria 1830
376 Ga0207639_10089482 3300026041 Bacteria 2460
377 Ga0207639_10149250 3300026041 Bacteria 1956
378 Ga0207678_10004481 3300026067 Bacteria 12560
379 Ga0207678_10111933 3300026067 Bacteria 2329
380 Ga0207708_11095287 3300026075 Unclassified 694
381 Ga0207702_10040748 3300026078 Unclassified 3893
382 Ga0207702_10090077 3300026078 Bacteria 2684
383 Ga0207702_10101034 3300026078 Bacteria 2546
384 Ga0207702_10726735 3300026078 Unclassified 979
385 Ga0207641_10353990 3300026088 Bacteria 1400
386 Ga0207648_10176614 3300026089 Bacteria 1889
387 Ga0207676_10822923 3300026095 Bacteria 907
388 Ga0207674_10031058 3300026116 Bacteria 5613
389 Ga0207674_10038836 3300026116 Bacteria 4939
390 Ga0207674_10050000 3300026116 Bacteria 4273
391 Ga0207674_10237337 3300026116 Bacteria 1770
392 Ga0207674_10259241 3300026116 Bacteria 1686
393 Ga0207675_100065941 3300026118 Bacteria 3384
394 Ga0207698_10011490 3300026142 Bacteria 5745
395 Ga0207698_10015892 3300026142 Bacteria 5058
396 Ga0209179_1009892 3300027512 Bacteria 1648
397 Ga0209179_1068996 3300027512 Unclassified 773
398 Ga0209983_1070048 3300027665 Bacteria 781
399 Ga0209588_1005122 3300027671 Bacteria 3738
400 Ga0209588_1005827 3300027671 Bacteria 3549
401 Ga0209588_1010774 3300027671 Bacteria 2754
402 Ga0209588_1017167 3300027671 Bacteria 2242
403 Ga0209588_1044881 3300027671 Bacteria 1430
404 Ga0209588_1099099 3300027671 Unclassified 938
405 Ga0209588_1131954 3300027671 Unclassified 796
406 Ga0209588_1144744 3300027671 Bacteria 755
407 Ga0207428_10058472 3300027907 Bacteria 3059
408 Ga0207428_10073072 3300027907 Bacteria 2691
409 Ga0268266_10249826 3300028379 Bacteria 1640
410 Ga0268265_10068506 3300028380 Unclassified 2752
411 Ga0268265_10403438 3300028380 Bacteria 1264
412 Ga0268265_10827272 3300028380 Unclassified 904
413 Ga0268265_10954570 3300028380 Unclassified 845
414 Ga0268264_10000043 3300028381 Bacteria 371761
415 Ga0265318_10223162 3300028577 Unclassified 688
416 Ga0307515_10054268 3300028794 Bacteria 5888
417 Ga0265338_10257895 3300028800 Bacteria 1283
418 Ga0265325_10128380 3300031241 Bacteria 1216
419 Ga0265316_10028602 3300031344 Unclassified 4595
420 Ga0265316_10471585 3300031344 Bacteria 899
421 Ga0307513_10459131 3300031456 Unclassified 997
422 Ga0307408_100972649 3300031548 Unclassified 781
423 Ga0265342_10544310 3300031712 Bacteria 589
424 Ga0307411_10609463 3300032005 Unclassified 940
425 Ga0373952_0050492 3300035092 Unclassified 990
426 Ga0373932_0342464 3300035112 Bacteria 567
427 Ga0373945_0255200 3300035116 Bacteria 741
428 Ga0373943_0016804 3300035170 Bacteria 3343
429 Ga0373946_0026989 3300035171 Bacteria 2269
430 Ga0373924_0348083 3300035410 Bacteria 660
431 Ga0373947_0038657 3300035725 Bacteria 2836
432 Ga0373937_0513266 3300036401 Bacteria 1139
433 Ga0373925_0001192 3300037068 Bacteria 22926
434 Ga0373925_0006420 3300037068 Bacteria 8654
435 Ga0373925_0220495 3300037068 Bacteria 1514
436 Ga0395899_0000187 3300037312 Bacteria 90916
437 Ga0395900_0001321 3300037418 Bacteria 30057
438 Ga0395898_0003504 3300037466 Bacteria 17510
439 Ga0395905_0013956 3300037471 Bacteria 7683
440 Ga0395905_1036890 3300037471 Bacteria 723
441 Ga0436364_0847428 3300037853 Bacteria 3270
442 Ga0395901_0000412 3300038443 Bacteria 50385
443 Ga0451853_0741491 3300041512 Bacteria 635
444 Ga0439450_036457 3300042008 Unclassified 1126
445 Ga0439450_171282 3300042008 Unclassified 574
446 Ga0439451_104478 3300042009 Bacteria 573
447 Ga0439434_0057363 3300042435 Bacteria 1214
448 Ga0439459_0129885 3300042438 Bacteria 643
449 Ga0451577_2034544 3300042876 Bacteria 502
450 Ga0439440_0116807 3300042993 Bacteria 739
451 Ga0439440_0227497 3300042993 Bacteria 561
452 Ga0466972_0046539 3300044658 Bacteria 2100
453 Ga0453683_0050667 3300044673 Bacteria 2601
454 Ga0453683_0148669 3300044673 Bacteria 1480
455 Ga0453683_0426406 3300044673 Bacteria 856
456 Ga0466964_0081058 3300044706 Bacteria 1393
457 Ga0453684_0016096 3300044712 Bacteria 11735
458 Ga0453684_0130482 3300044712 Bacteria 3016
459 Ga0466960_0622301 3300044901 Bacteria 642
460 Ga0451576_0086678 3300045051 Bacteria 3257
461 Ga0466967_0069419 3300045976 Bacteria 3149
462 Ga0466967_0758678 3300045976 Bacteria 962
463 Ga0466967_1173797 3300045976 Bacteria 765
464 Ga0495627_003058 3300046453 Bacteria 7622
465 Ga0495638_0143183 3300046460 Bacteria 1393
466 Ga0495641_0366542 3300046461 Bacteria 652
467 Ga0495580_1054092 3300046472 Bacteria 516
468 Ga0495582_0118579 3300046473 Bacteria 1490
469 Ga0495582_0812622 3300046473 Unclassified 541
470 Ga0495639_0002078 3300046475 Bacteria 8865
471 Ga0495639_0083932 3300046475 Bacteria 1487
472 Ga0495662_0135937 3300046476 Bacteria 1209
473 Ga0495594_0031460 3300046499 Bacteria 2877
474 Ga0495663_0098391 3300046525 Bacteria 961
475 Ga0495666_0009104 3300046526 Bacteria 4966
476 Ga0495666_0118315 3300046526 Bacteria 1242
477 Ga0495586_0001438 3300046535 Bacteria 13155
478 Ga0495586_0037668 3300046535 Bacteria 2597
479 Ga0495586_0581074 3300046535 Unclassified 647
480 Ga0495598_0014760 3300046537 Bacteria 1958
481 Ga0495621_0400346 3300046539 Bacteria 582
482 Ga0495622_0026901 3300046557 Bacteria 2684
483 Ga0495622_0082350 3300046557 Bacteria 1480
484 Ga0495633_0047175 3300046558 Bacteria 2036
485 Ga0495633_0174816 3300046558 Bacteria 989
486 Ga0495656_0015066 3300046615 Bacteria 2911
487 Ga0495625_0846358 3300046660 Bacteria 528
488 Ga0495635_0045517 3300046663 Bacteria 3028
489 Ga0495659_0265407 3300046664 Bacteria 718
490 Ga0495646_0179789 3300046680 Bacteria 1162
491 Ga0495658_0124093 3300046683 Bacteria 1565
492 Ga0495613_0282988 3300046689 Bacteria 1151
493 Ga0495624_0046354 3300046690 Bacteria 2764
494 Ga0495670_0279415 3300046691 Bacteria 893
495 Ga0495600_0707515 3300046809 Bacteria 605
496 Ga0495581_0035030 3300047315 Bacteria 2905
497 Ga0495636_0185543 3300047318 Unclassified 945
498 Ga0495674_1328935 3300047319 Unclassified 538
499 Ga0495676_0045687 3300047321 Bacteria 3562
500 Ga0495676_0145659 3300047321 Bacteria 1692
501 Ga0495680_0164116 3300047322 Bacteria 1611
502 Ga0495684_0018244 3300047471 Bacteria 5407
503 Ga0495684_0070265 3300047471 Bacteria 2662
504 Ga0496108_0083997 3300048911 Bacteria 2702
505 Ga0496109_0110903 3300048912 Bacteria 2551
506 Ga0496109_1022093 3300048912 Bacteria 764
507 Ga0496110_0382988 3300048913 Bacteria 1282
508 Ga0496113_0095768 3300048916 Unclassified 2294
509 Ga0496113_0796265 3300048916 Bacteria 751
510 Ga0496115_0761719 3300048918 Bacteria 756
511 Ga0496126_0005253 3300048929 Bacteria 14883
512 Ga0501031_0624555 3300049568 Unclassified 693
513 Ga0501038_0833218 3300049574 Unclassified 684
514 Ga0501039_0218331 3300049575 Bacteria 1499
515 Ga0501040_0027371 3300049576 Bacteria 3838
516 Ga0501041_0370960 3300049577 Bacteria 905
517 Ga0501042_0004758 3300049578 Bacteria 8667
518 Ga0501046_0529983 3300049580 Bacteria 841
519 Ga0501046_0531339 3300049580 Bacteria 840
520 Ga0501047_0257451 3300049581 Bacteria 1593
521 Ga0501048_0029024 3300049582 Bacteria 4015
522 Ga0501048_0731484 3300049582 Bacteria 711
523 Ga0501067_0002382 3300049583 Bacteria 10402
524 Ga0501068_0000094 3300049584 Bacteria 37982
525 Ga0501069_0082622 3300049585 Bacteria 1810
526 Ga0501071_0020345 3300049587 Bacteria 4610
527 Ga0501071_0097182 3300049587 Bacteria 2168
528 Ga0501072_0042905 3300049588 Bacteria 3554
529 Ga0501074_0641626 3300049590 Bacteria 750
530 Ga0501075_0072185 3300049591 Bacteria 2609
531 Ga0501075_0907636 3300049591 Unclassified 670
532 Ga0501076_0287724 3300049592 Bacteria 1347
533 Ga0501076_0408506 3300049592 Bacteria 1117
534 Ga0501077_0165101 3300049593 Bacteria 1406
535 Ga0501202_228126 3300049652 Bacteria 517
536 Ga0501225_0156087 3300049705 Bacteria 699
537 Ga0501245_014954 3300049708 Bacteria 1163
538 Ga0501079_0030199 3300049741 Bacteria 4164
539 Ga0501080_0587391 3300049742 Bacteria 990
540 Ga0501081_0035923 3300049743 Bacteria 3376
541 Ga0501271_043671 3300049768 Bacteria 591
542 Ga0501035_1032086 3300049822 Unclassified 645
543 Ga0501045_0106793 3300049824 Bacteria 2075
544 Ga0501045_0513032 3300049824 Bacteria 890
545 nmdc:mga07m45_297959_c1 3300050496 Bacteria 938
546 nmdc:mga05p37_1012190_c1 3300050507 Bacteria 881
547 nmdc:mga05p37_1040804_c1 3300050507 Bacteria 865
548 nmdc:mga05p37_143351_c1 3300050507 Bacteria 2926
549 nmdc:mga05p37_19269_c1 3300050507 Bacteria 3769
550 nmdc:mga05p37_32541_c1 3300050507 Bacteria 6378
551 nmdc:mga05p37_326615_c1 3300050507 Bacteria 1814
552 nmdc:mga05p37_470735_c1 3300050507 Bacteria 1450
553 nmdc:mga05p37_583822_c1 3300050507 Bacteria 1265
554 nmdc:mga05p37_621955_c1 3300050507 Bacteria 1215
555 nmdc:mga05p37_760587_c1 3300050507 Bacteria 1066
556 nmdc:mga05p37_802805_c1 3300050507 Bacteria 1029
557 nmdc:mga09592_162120_c1 3300050508 Bacteria 1932
558 nmdc:mga09592_417_c1 3300050508 Bacteria 31206
559 nmdc:mga09592_654477_c1 3300050508 Bacteria 897
560 nmdc:mga09592_7686_c1 3300050508 Bacteria 8760
561 nmdc:mga0qj67_134669_c1 3300050509 Bacteria 2002
562 nmdc:mga0qj67_141840_c1 3300050509 Bacteria 1948
563 nmdc:mga0qj67_1621_c1 3300050509 Bacteria 15831
564 nmdc:mga0qj67_468_c1 3300050509 Bacteria 27611
565 nmdc:mga0qj67_51234_c1 3300050509 Bacteria 3264
566 nmdc:mga06r32_15243_c1 3300050510 Bacteria 6981
567 nmdc:mga06r32_15349_c1 3300050510 Bacteria 6959
568 nmdc:mga06r32_29367_c1 3300050510 Bacteria 5152
569 nmdc:mga06r32_50334_c1 3300050510 Bacteria 3985
570 nmdc:mga06r32_516479_c1 3300050510 Unclassified 1170
571 nmdc:mga06r32_76804_c1 3300050510 Bacteria 3244
572 nmdc:mga06r32_8888_c1 3300050510 Bacteria 9054
573 nmdc:mga08y16_28407_c1 3300050511 Bacteria 5897
574 nmdc:mga08y16_558_c1 3300050511 Bacteria 34451
575 nmdc:mga08y16_875780_c1 3300050511 Bacteria 886
576 nmdc:mga08y16_96478_c1 3300050511 Bacteria 3079
577 nmdc:mga0n895_215489_c1 3300050512 Bacteria 1950
578 nmdc:mga0n895_390373_c1 3300050512 Bacteria 1408
579 nmdc:mga0n895_68025_c1 3300050512 Bacteria 3528
580 nmdc:mga0rr50_167335_c1 3300050513 Bacteria 1788
581 nmdc:mga08x19_1115_c1 3300050514 Bacteria 16753
582 nmdc:mga08x19_1275894_c1 3300050514 Bacteria 520
583 nmdc:mga08x19_17274_c1 3300050514 Bacteria 4413
584 nmdc:mga08x19_233256_c1 3300050514 Bacteria 1267
585 nmdc:mga0a205_18090_c1 3300050515 Bacteria 6621
586 nmdc:mga0a205_253066_c1 3300050515 Bacteria 1640
587 nmdc:mga0a205_28985_c1 3300050515 Bacteria 5295
588 nmdc:mga0a205_2983_c1 3300050515 Bacteria 15011
589 Ga0495612_0186830 3300053078 Bacteria 911
590 Ga0500556_0029217 3300053104 Bacteria 1857
591 Ga0500595_010632 3300053119 Bacteria 3648
592 Ga0500597_258992 3300053120 Unclassified 709
593 Ga0500607_176258 3300053121 Bacteria 955
594 Ga0500642_0051823 3300053130 Bacteria 1815
595 Ga0500642_0072166 3300053130 Bacteria 1573
596 Ga0500642_0262516 3300053130 Unclassified 790
597 Ga0500658_0323296 3300053134 Bacteria 709
598 Ga0500588_0008326 3300053146 Bacteria 2418
599 Ga0500609_000963 3300053731 Bacteria 4317
600 Ga0500596_002559 3300053735 Bacteria 3571
601 Ga0501084_0061268 3300054114 Bacteria 3150
602 Ga0501082_0226586 3300060353 Unclassified 1627
603 Ga0501082_1701991 3300060353 Bacteria 550
604 Ga0070707_100000757
605 JGI24739J22299_10003890
606 JGI24735J21928_10012485
607 JGI24735J21928_10096394
608 JGI24738J21930_10029093
609 JGI25404J52841_10112186
610 Ga0058863_11939990
611 Ga0058861_12019593
612 Ga0058862_12032011
613 Ga0065704_10128233
614 Ga0065704_10199856
615 Ga0065712_10068043
616 Ga0065707_10998489
617 Ga0070658_10000430
618 Ga0070658_10030651
619 Ga0070658_10738525
620 Ga0070683_100016113
621 Ga0070683_100017313
622 Ga0070690_101608814
623 Ga0068869_100062298
624 Ga0070680_100002768
625 Ga0070680_100290406
626 Ga0070680_100317577
627 Ga0070680_100336922
628 Ga0070680_100763168
629 Ga0070680_100861899
630 Ga0070682_100006566
631 Ga0070682_100152269
632 Ga0068868_101501305
633 Ga0070660_100002814
634 Ga0070660_100022971
635 Ga0070660_100294708
636 Ga0070689_100058328
637 Ga0070689_100870593
638 Ga0070687_100147273
639 Ga0070661_100004671
640 Ga0070661_100043989
641 Ga0070692_10158390
642 Ga0070668_100339246
643 Ga0070669_100151973
644 Ga0070675_100049639
645 Ga0070675_100083008
646 Ga0070675_100343029
647 Ga0070674_100414275
648 Ga0070673_100004344
649 Ga0070688_100103756
650 Ga0070659_100005303
651 Ga0070659_100018107
652 Ga0070703_10127341
653 Ga0070709_10040565
654 Ga0070709_10476079
655 Ga0070713_100237939
656 Ga0070713_100654316
657 Ga0070701_10148358
658 Ga0070711_100022261
659 Ga0070711_100943183
660 Ga0070705_100349493
661 Ga0070705_101010254
662 Ga0070700_101207043
663 Ga0070694_100009171
664 Ga0070694_100405890
665 Ga0070694_100725526
666 Ga0070694_100757018
667 Ga0070708_100027418
668 Ga0070708_100042192
669 Ga0070708_100045449
670 Ga0070708_100087615
671 Ga0070708_100548915
672 Ga0070708_101769841
673 Ga0070708_102132254
674 Ga0070663_100014555
675 Ga0070663_100780889
676 Ga0070678_100218774
677 Ga0070678_100811948
678 Ga0070662_100012278
679 Ga0070681_10012012
680 Ga0070681_10052395
681 Ga0070681_11537999
682 Ga0070681_11640299
683 Ga0068867_100165383
684 Ga0068867_100505965
685 Ga0070685_10289970
686 Ga0070706_100026674
687 Ga0070706_100040481
688 Ga0070706_100049112
689 Ga0070706_100492981
690 Ga0070707_100017897
691 Ga0070707_100060885
692 Ga0070707_100161889
693 Ga0070707_100171091
694 Ga0070707_100245359
695 Ga0070707_100567966
696 Ga0070698_100009446
697 Ga0070698_100023991
698 Ga0070698_100031252
699 Ga0070698_100112882
700 Ga0070698_100156552
701 Ga0070698_100237534
702 Ga0070698_100704409
703 Ga0070699_100046774
704 Ga0070699_100270568
705 Ga0070699_100408260
706 Ga0070699_100653442
707 Ga0070699_101034958
708 Ga0070699_101210114
709 Ga0070699_101611310
710 Ga0070679_100000204
711 Ga0070679_100048047
712 Ga0070679_100050961
713 Ga0070679_100252812
714 Ga0070684_100004114
715 Ga0070684_100119570
716 Ga0070684_100795381
717 Ga0070697_100000245
718 Ga0070697_100006469
719 Ga0070697_100031731
720 Ga0070697_100052213
721 Ga0070697_100145925
722 Ga0070697_100561706
723 Ga0070697_101350704
724 Ga0070697_101697643
725 Ga0068853_100026203
726 Ga0070672_100176946
727 Ga0070672_101346594
728 Ga0070686_100044985
729 Ga0070686_100151292
730 Ga0070686_100854622
731 Ga0070686_101149995
732 Ga0070695_100054231
733 Ga0070695_100056005
734 Ga0070695_100561728
735 Ga0070696_100044915
736 Ga0070665_100294644
737 Ga0070665_100414769
738 Ga0070704_100102311
739 Ga0070704_100176284
740 Ga0070704_100290835
741 Ga0070704_100573081
742 Ga0068855_100015382
743 Ga0068855_100040254
744 Ga0068855_100041108
745 Ga0068855_100096356
746 Ga0068855_100707279
747 Ga0070664_100007907
748 Ga0070664_100170438
749 Ga0070664_100332936
750 Ga0068857_100031881
751 Ga0068857_100075671
752 Ga0068857_100261546
753 Ga0068857_101089472
754 Ga0068857_101734025
755 Ga0068854_100051113
756 Ga0068854_100338079
757 Ga0068856_100009433
758 Ga0068856_100027492
759 Ga0068856_100032011
760 Ga0068856_101076918
761 Ga0068856_102035484
762 Ga0068852_100003295
763 Ga0068852_100024491
764 Ga0068859_100062063
765 Ga0068864_100839031
766 Ga0068864_101816775
767 Ga0068861_100080386
768 Ga0068851_10018010
769 Ga0068870_10018795
770 Ga0068870_10032551
771 Ga0068863_100372257
772 Ga0068860_102145849
773 Ga0068862_100095142
774 Ga0068862_101012181
775 Ga0081455_10085283
776 Ga0070717_10004749
777 Ga0075363_100183450
778 Ga0070716_100000419
779 Ga0070716_100247890
780 Ga0070716_100333165
781 Ga0070716_100412986
782 Ga0075370_10284924
783 Ga0075428_100000302
784 Ga0075428_100010554
785 Ga0075428_100034098
786 Ga0075428_100105087
787 Ga0075428_100153204
788 Ga0075430_100001283
789 Ga0075430_100002458
790 Ga0075430_100014640
791 Ga0075430_100044154
792 Ga0075430_100106988
793 Ga0075431_100000369
794 Ga0075431_100000824
795 Ga0075431_100012703
796 Ga0075431_100014624
797 Ga0075431_100034841
798 Ga0075431_100036161
799 Ga0075431_100141204
800 Ga0075433_10034272
801 Ga0075433_10208015
802 Ga0075433_10210436
803 Ga0075434_100015221
804 Ga0075434_100025853
805 Ga0075434_100052669
806 Ga0075434_100359134
807 Ga0075434_100469881
808 Ga0075429_100003096
809 Ga0075429_100014099
810 Ga0075429_100033782
811 Ga0075429_100279570
812 Ga0075429_100488924
813 Ga0075429_100495314
814 Ga0075436_100006784
815 Ga0075436_100058315
816 Ga0075436_100560860
817 Ga0075436_101451978
818 Ga0097620_100062063
819 Ga0075435_100014501
820 Ga0075435_100703751
821 Ga0099794_10012243
822 Ga0099794_10013743
823 Ga0099794_10015286
824 Ga0099794_10021323
825 Ga0099794_10023552
826 Ga0099794_10038029
827 Ga0099794_10065561
828 Ga0099794_10071967
829 Ga0099794_10083634
830 Ga0099794_10136481
831 Ga0099794_10147870
832 Ga0099794_10224668
833 Ga0099794_10234803
834 Ga0099794_10261786
835 Ga0099795_10014979
836 Ga0105240_10036252
837 Ga0105240_10045151
838 Ga0105240_10191331
839 Ga0105240_10610943
840 Ga0111539_10023967
841 Ga0111539_10044482
842 Ga0111539_10130913
843 Ga0111539_10185964
844 Ga0111539_12955110
845 Ga0105247_10347735
846 Ga0114129_10023845
847 Ga0114129_10077212
848 Ga0114129_10094797
849 Ga0114129_10127492
850 Ga0114129_10162119
851 Ga0114129_10169455
852 Ga0114129_10517251
853 Ga0114129_10594073
854 Ga0114129_10629912
855 Ga0114129_11151349
856 Ga0114129_11268557
857 Ga0105243_10962149
858 Ga0105242_10825785
859 Ga0105242_12628326
860 Ga0105237_10031160
861 Ga0105237_10372055
862 Ga0105237_11417431
863 Ga0105238_10006427
864 Ga0105238_10026651
865 Ga0105249_10690465
866 Ga0099796_10006403
867 Ga0099796_10027408
868 Ga0099796_10163890
869 Ga0105239_10023385
870 Ga0105239_10040440
871 Ga0105239_10509436
872 Ga0105246_11278563
873 Ga0157371_10138414
874 Ga0157370_10063785
875 Ga0157369_10017515
876 Ga0157369_10179745
877 Ga0157369_10230561
878 Ga0157374_12954837
879 Ga0157378_10062089
880 Ga0157378_12075042
881 Ga0163162_10534004
882 Ga0157372_10308169
883 Ga0157372_10671960
884 Ga0157372_10733668
885 Ga0157372_11076206
886 Ga0157372_12561207
887 Ga0157375_12557491
888 Ga0163163_10128189
889 Ga0163163_11415299
890 Ga0163163_11968440
891 Ga0157380_10272592
892 Ga0157380_10575212
893 Ga0157377_10009347
894 Ga0157376_11383215
895 Ga0157376_11443505
896 Ga0206353_11390319
897 Ga0213875_10086146
898 Ga0207697_10012034
899 Ga0207656_10024056
900 Ga0207653_10177393
901 Ga0207688_10097288
902 Ga0207647_10100804
903 Ga0207685_10016696
904 Ga0207699_10012151
905 Ga0207643_10023243
906 Ga0207643_10031607
907 Ga0207705_10004496
908 Ga0207705_10010662
909 Ga0207705_10534837
910 Ga0207684_10010544
911 Ga0207684_10296886
912 Ga0207684_10333238
913 Ga0207684_10337600
914 Ga0207654_10029266
915 Ga0207707_10001494
916 Ga0207707_10011976
917 Ga0207707_10538333
918 Ga0207695_10027597
919 Ga0207695_10278186
920 Ga0207695_10439409
921 Ga0207671_10090392
922 Ga0207693_10088473
923 Ga0207663_10006475
924 Ga0207660_10024752
925 Ga0207660_10124874
926 Ga0207660_10232487
927 Ga0207660_10436744
928 Ga0207657_10018726
929 Ga0207657_10148606
930 Ga0207657_10152186
931 Ga0207649_10004323
932 Ga0207649_10040451
933 Ga0207652_10004433
934 Ga0207652_10019004
935 Ga0207652_10071753
936 Ga0207652_10355322
937 Ga0207646_10000478
938 Ga0207646_10004774
939 Ga0207646_10172902
940 Ga0207646_10239643
941 Ga0207646_10257484
942 Ga0207694_10006436
943 Ga0207694_10043320
944 Ga0207659_10006095
945 Ga0207659_10317475
946 Ga0207659_10561664
947 Ga0207700_10301553
948 Ga0207700_10392925
949 Ga0207690_10007016
950 Ga0207690_10259333
951 Ga0207706_10029065
952 Ga0207706_10173096
953 Ga0207706_11111194
954 Ga0207670_10271498
955 Ga0207669_10792420
956 Ga0207704_11869275
957 Ga0207665_10000233
958 Ga0207665_10093225
959 Ga0207665_10297905
960 Ga0207665_10358124
961 Ga0207691_10191918
962 Ga0207689_10080636
963 Ga0207689_10233788
964 Ga0207661_10012529
965 Ga0207661_10012596
966 Ga0207661_10221357
967 Ga0207679_10054667
968 Ga0207679_10064403
969 Ga0207679_10133126
970 Ga0207667_10090687
971 Ga0207667_10122833
972 Ga0207667_10128722
973 Ga0207667_10133698
974 Ga0207651_10015688
975 Ga0207712_10235509
976 Ga0207668_10157909
977 Ga0207668_10974438
978 Ga0207640_10128184
979 Ga0207639_10089482
980 Ga0207639_10149250
981 Ga0207678_10004481
982 Ga0207678_10111933
983 Ga0207708_11095287
984 Ga0207702_10040748
985 Ga0207702_10090077
986 Ga0207702_10101034
987 Ga0207702_10726735
988 Ga0207641_10353990
989 Ga0207648_10176614
990 Ga0207676_10822923
991 Ga0207674_10031058
992 Ga0207674_10038836
993 Ga0207674_10050000
994 Ga0207674_10237337
995 Ga0207674_10259241
996 Ga0207675_100065941
997 Ga0207698_10011490
998 Ga0207698_10015892
999 Ga0209179_1009892
1000 Ga0209179_1068996
1001 Ga0209983_1070048
1002 Ga0209588_1005122
1003 Ga0209588_1005827
1004 Ga0209588_1010774
1005 Ga0209588_1017167
1006 Ga0209588_1044881
1007 Ga0209588_1099099
1008 Ga0209588_1131954
1009 Ga0209588_1144744
1010 Ga0207428_10058472
1011 Ga0207428_10073072
1012 Ga0268266_10249826
1013 Ga0268265_10068506
1014 Ga0268265_10403438
1015 Ga0268265_10827272
1016 Ga0268265_10954570
1017 Ga0268264_10000043
1018 Ga0265318_10223162
1019 Ga0307515_10054268
1020 Ga0265338_10257895
1021 Ga0265325_10128380
1022 Ga0265316_10028602
1023 Ga0265316_10471585
1024 Ga0307513_10459131
1025 Ga0307408_100972649
1026 Ga0265342_10544310
1027 Ga0307411_10609463
1028 Ga0373952_0050492
1029 Ga0373932_0342464
1030 Ga0373945_0255200
1031 Ga0373943_0016804
1032 Ga0373946_0026989
1033 Ga0373924_0348083
1034 Ga0373947_0038657
1035 Ga0373937_0513266
1036 Ga0373925_0001192
1037 Ga0373925_0006420
1038 Ga0373925_0220495
1039 Ga0395899_0000187
1040 Ga0395900_0001321
1041 Ga0395898_0003504
1042 Ga0395905_0013956
1043 Ga0395905_1036890
1044 Ga0436364_0847428
1045 Ga0395901_0000412
1046 Ga0451853_0741491
1047 Ga0439450_036457
1048 Ga0439450_171282
1049 Ga0439451_104478
1050 Ga0439434_0057363
1051 Ga0439459_0129885
1052 Ga0451577_2034544
1053 Ga0439440_0116807
1054 Ga0439440_0227497
1055 Ga0466972_0046539
1056 Ga0453683_0050667
1057 Ga0453683_0148669
1058 Ga0453683_0426406
1059 Ga0466964_0081058
1060 Ga0453684_0016096
1061 Ga0453684_0130482
1062 Ga0466960_0622301
1063 Ga0451576_0086678
1064 Ga0466967_0069419
1065 Ga0466967_0758678
1066 Ga0466967_1173797
1067 Ga0495627_003058
1068 Ga0495638_0143183
1069 Ga0495641_0366542
1070 Ga0495580_1054092
1071 Ga0495582_0118579
1072 Ga0495582_0812622
1073 Ga0495639_0002078
1074 Ga0495639_0083932
1075 Ga0495662_0135937
1076 Ga0495594_0031460
1077 Ga0495663_0098391
1078 Ga0495666_0009104
1079 Ga0495666_0118315
1080 Ga0495586_0001438
1081 Ga0495586_0037668
1082 Ga0495586_0581074
1083 Ga0495598_0014760
1084 Ga0495621_0400346
1085 Ga0495622_0026901
1086 Ga0495622_0082350
1087 Ga0495633_0047175
1088 Ga0495633_0174816
1089 Ga0495656_0015066
1090 Ga0495625_0846358
1091 Ga0495635_0045517
1092 Ga0495659_0265407
1093 Ga0495646_0179789
1094 Ga0495658_0124093
1095 Ga0495613_0282988
1096 Ga0495624_0046354
1097 Ga0495670_0279415
1098 Ga0495600_0707515
1099 Ga0495581_0035030
1100 Ga0495636_0185543
1101 Ga0495674_1328935
1102 Ga0495676_0045687
1103 Ga0495676_0145659
1104 Ga0495680_0164116
1105 Ga0495684_0018244
1106 Ga0495684_0070265
1107 Ga0496108_0083997
1108 Ga0496109_0110903
1109 Ga0496109_1022093
1110 Ga0496110_0382988
1111 Ga0496113_0095768
1112 Ga0496113_0796265
1113 Ga0496115_0761719
1114 Ga0496126_0005253
1115 Ga0501031_0624555
1116 Ga0501038_0833218
1117 Ga0501039_0218331
1118 Ga0501040_0027371
1119 Ga0501041_0370960
1120 Ga0501042_0004758
1121 Ga0501046_0529983
1122 Ga0501046_0531339
1123 Ga0501047_0257451
1124 Ga0501048_0029024
1125 Ga0501048_0731484
1126 Ga0501067_0002382
1127 Ga0501068_0000094
1128 Ga0501069_0082622
1129 Ga0501071_0020345
1130 Ga0501071_0097182
1131 Ga0501072_0042905
1132 Ga0501074_0641626
1133 Ga0501075_0072185
1134 Ga0501075_0907636
1135 Ga0501076_0287724
1136 Ga0501076_0408506
1137 Ga0501077_0165101
1138 Ga0501202_228126
1139 Ga0501225_0156087
1140 Ga0501245_014954
1141 Ga0501079_0030199
1142 Ga0501080_0587391
1143 Ga0501081_0035923
1144 Ga0501271_043671
1145 Ga0501035_1032086
1146 Ga0501045_0106793
1147 Ga0501045_0513032
1148 nmdc:mga07m45_297959_c1
1149 nmdc:mga05p37_1012190_c1
1150 nmdc:mga05p37_1040804_c1
1151 nmdc:mga05p37_143351_c1
1152 nmdc:mga05p37_19269_c1
1153 nmdc:mga05p37_32541_c1
1154 nmdc:mga05p37_326615_c1
1155 nmdc:mga05p37_470735_c1
1156 nmdc:mga05p37_583822_c1
1157 nmdc:mga05p37_621955_c1
1158 nmdc:mga05p37_760587_c1
1159 nmdc:mga05p37_802805_c1
1160 nmdc:mga09592_162120_c1
1161 nmdc:mga09592_417_c1
1162 nmdc:mga09592_654477_c1
1163 nmdc:mga09592_7686_c1
1164 nmdc:mga0qj67_134669_c1
1165 nmdc:mga0qj67_141840_c1
1166 nmdc:mga0qj67_1621_c1
1167 nmdc:mga0qj67_468_c1
1168 nmdc:mga0qj67_51234_c1
1169 nmdc:mga06r32_15243_c1
1170 nmdc:mga06r32_15349_c1
1171 nmdc:mga06r32_29367_c1
1172 nmdc:mga06r32_50334_c1
1173 nmdc:mga06r32_516479_c1
1174 nmdc:mga06r32_76804_c1
1175 nmdc:mga06r32_8888_c1
1176 nmdc:mga08y16_28407_c1
1177 nmdc:mga08y16_558_c1
1178 nmdc:mga08y16_875780_c1
1179 nmdc:mga08y16_96478_c1
1180 nmdc:mga0n895_215489_c1
1181 nmdc:mga0n895_390373_c1
1182 nmdc:mga0n895_68025_c1
1183 nmdc:mga0rr50_167335_c1
1184 nmdc:mga08x19_1115_c1
1185 nmdc:mga08x19_1275894_c1
1186 nmdc:mga08x19_17274_c1
1187 nmdc:mga08x19_233256_c1
1188 nmdc:mga0a205_18090_c1
1189 nmdc:mga0a205_253066_c1
1190 nmdc:mga0a205_28985_c1
1191 nmdc:mga0a205_2983_c1
1192 Ga0495612_0186830
1193 Ga0500556_0029217
1194 Ga0500595_010632
1195 Ga0500597_258992
1196 Ga0500607_176258
1197 Ga0500642_0051823
1198 Ga0500642_0072166
1199 Ga0500642_0262516
1200 Ga0500658_0323296
1201 Ga0500588_0008326
1202 Ga0500609_000963
1203 Ga0500596_002559
1204 Ga0501084_0061268
1205 Ga0501082_0226586
1206 Ga0501082_1701991

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

28

134

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.8762 1 115
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.8631 1 114
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.8623 1 115
6qcm-assembly1.cif.gz_I cryo em structure of the listeria stressosome 0.8493 1 115
7b0u-assembly1.cif.gz_A stressosome complex from listeria innocua 0.8304 1 119
ID Description Score Start End Superfamily
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8132 2 78 3.30.750.24
af_Q80ZD3_447_566_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8064 3 112 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7967 2 113 3.30.750.24
5cpqB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7884 57 79 3.20.20.80
4hylA00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7858 3 112 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2V7FHM0-F1-model_v4 STAS domain-containing protein 0.9583 1 112
AF-A0A2T1A8M4-F1-model_v4 RsbT antagonist protein RsbS 0.9552 1 111
AF-A0A1V2I0Y2-F1-model_v4 Sugar dehydratase 0.9508 1 113
AF-A0A1X7D3N5-F1-model_v4 RsbT antagonist protein RsbS 0.9504 2 115
AF-A0A3M1HG16-F1-model_v4 STAS domain-containing protein 0.9495 1 121

Map