F468197

General Info

Members Datasets Scaffolds Average Seq Length
602 391 1204 152

Family's Representative Sequence

Representative Sequence 3300041443|Ga0451789_1195376|Ga0451789_1195376_188_718
Length 176
Sequence MRSAKVLMVRAWSHGTVTMAWPYGVAVSDGPTVEMWTDGACKGNPGIGGWGAWMRYGEHERELFGGEALTTNNRMELTAVIEGLRALTRPCAVTLHVDSQYVMNGVTRWIAGWKRNGWRTGDKKPVKNQELWEALDAEVARHTVTWVWVKGHAGDPGNERADQLANRGVELVRAEL

Samples

Sample ID Description Type Environment
1 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
86 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
87 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
88 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
162 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
163 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
212 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
213 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
214 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
215 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
216 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
344 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
345 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
346 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
347 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
348 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
349 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
350 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
353 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
354 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
360 2508501039 Frankia saprophytica CN3 Isolate Nodule
361 2547132512 Azospira oryzae 6a3 Isolate Unclassified
362 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
363 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
364 2643221561 Nocardioides sp. Root151 Isolate Unclassified
365 2643221569 Achromobacter sp. Root565 Isolate Unclassified
366 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
367 2643221594 Achromobacter sp. Root170 Isolate Unclassified
368 2643221621 Achromobacter sp. Root83 Isolate Unclassified
369 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
370 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
371 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
372 2643221696 Nocardioides sp. Root140 Isolate Unclassified
373 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
374 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
375 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
376 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
377 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
378 2808606394 Promicromonospora sp. C35 Isolate Unclassified
379 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
380 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
381 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
382 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
383 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
384 2858950400 Achromobacter sp. K91 Isolate Unclassified
385 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
386 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
387 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
388 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
389 2941479691
390 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
391 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.35
Metatranscriptomes 0.33
Isolates 5.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.64
Nodule 0.17
Rhizoplane 3.32
Rhizosphere 79.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451789_1195376 3300041443 Bacteria 763
2 JGI25153J46596_10008471 3300003215 Bacteria 4909
3 JGI25153J46596_10010729 3300003215 Bacteria 4116
4 Ga0055525_1000013 3300003759 Bacteria 440870
5 Ga0055530_10043622 3300003791 Bacteria 1080
6 Ga0065165_1007818 3300005262 Bacteria 5147
7 Ga0070683_100014173 3300005329 Bacteria 6964
8 Ga0068869_100001878 3300005334 Bacteria 12622
9 Ga0070666_10036996 3300005335 Bacteria 3243
10 Ga0070682_100079882 3300005337 Bacteria 2113
11 Ga0068868_100077246 3300005338 Bacteria 2663
12 Ga0070660_100225650 3300005339 Bacteria 1523
13 Ga0070689_100024275 3300005340 Bacteria 4546
14 Ga0070691_10008608 3300005341 Bacteria 4671
15 Ga0070691_10371980 3300005341 Bacteria 799
16 Ga0070687_100035680 3300005343 Bacteria 2471
17 Ga0070687_100046834 3300005343 Bacteria 2215
18 Ga0070661_100125710 3300005344 Bacteria 1923
19 Ga0070692_10002093 3300005345 Bacteria 7616
20 Ga0070692_10082598 3300005345 Bacteria 1733
21 Ga0070668_100070628 3300005347 Bacteria 2719
22 Ga0070675_100422138 3300005354 Bacteria 1193
23 Ga0070671_101030859 3300005355 Bacteria 721
24 Ga0070674_100236251 3300005356 Bacteria 1429
25 Ga0070674_100511411 3300005356 Bacteria 1002
26 Ga0070673_101142311 3300005364 Bacteria 728
27 Ga0070688_100143012 3300005365 Bacteria 1627
28 Ga0070659_100055770 3300005366 Bacteria 3115
29 Ga0070667_100146897 3300005367 Bacteria 2068
30 Ga0070703_10010151 3300005406 Bacteria 2655
31 Ga0070709_10674086 3300005434 Bacteria 802
32 Ga0070713_100192014 3300005436 Bacteria 1841
33 Ga0070713_100321401 3300005436 Bacteria 1429
34 Ga0070701_10003480 3300005438 Bacteria 6237
35 Ga0070701_10195058 3300005438 Bacteria 1194
36 Ga0070705_100194830 3300005440 Bacteria 1384
37 Ga0070694_100023503 3300005444 Bacteria 3965
38 Ga0070694_100028532 3300005444 Bacteria 3633
39 Ga0070708_100103946 3300005445 Bacteria 2604
40 Ga0070678_100076589 3300005456 Bacteria 2520
41 Ga0070678_100613467 3300005456 Bacteria 972
42 Ga0070662_100337824 3300005457 Bacteria 1232
43 Ga0070681_10104188 3300005458 Bacteria 2779
44 Ga0068867_100183644 3300005459 Bacteria 1664
45 Ga0070685_10240171 3300005466 Bacteria 1195
46 Ga0070698_100397373 3300005471 Bacteria 1311
47 Ga0070699_100453737 3300005518 Bacteria 1162
48 Ga0070684_100266536 3300005535 Bacteria 1567
49 Ga0068853_100110051 3300005539 Bacteria 2446
50 Ga0068853_100426751 3300005539 Bacteria 1244
51 Ga0068853_100551292 3300005539 Bacteria 1092
52 Ga0070672_100876611 3300005543 Bacteria 792
53 Ga0070686_100006091 3300005544 Bacteria 6694
54 Ga0070695_100179181 3300005545 Bacteria 1500
55 Ga0070696_100105473 3300005546 Bacteria 2025
56 Ga0070696_100446627 3300005546 Bacteria 1020
57 Ga0070693_100051012 3300005547 Bacteria 2367
58 Ga0070693_100612479 3300005547 Bacteria 787
59 Ga0070704_100097709 3300005549 Bacteria 2204
60 Ga0070704_100507466 3300005549 Bacteria 1047
61 Ga0068855_101301134 3300005563 Bacteria 752
62 Ga0068857_100474415 3300005577 Bacteria 1172
63 Ga0068854_100181239 3300005578 Bacteria 1645
64 Ga0068856_100869683 3300005614 Bacteria 920
65 Ga0070702_100000808 3300005615 Bacteria 11979
66 Ga0070702_100016003 3300005615 Bacteria 3842
67 Ga0068852_100024515 3300005616 Bacteria 4877
68 Ga0068852_101133728 3300005616 Bacteria 803
69 Ga0068859_100000014 3300005617 Bacteria 280955
70 Ga0068859_100166875 3300005617 Bacteria 2281
71 Ga0068864_100157471 3300005618 Bacteria 2062
72 Ga0068866_10024378 3300005718 Bacteria 2828
73 Ga0068866_10034949 3300005718 Bacteria 2451
74 Ga0068861_100005194 3300005719 Bacteria 8776
75 Ga0068861_101438031 3300005719 Bacteria 675
76 Ga0068870_10056551 3300005840 Bacteria 2094
77 Ga0068870_10624110 3300005840 Bacteria 735
78 Ga0068863_100103101 3300005841 Bacteria 2713
79 Ga0068858_100005157 3300005842 Bacteria 12797
80 Ga0068858_100010545 3300005842 Bacteria 8751
81 Ga0068860_100026027 3300005843 Bacteria 5643
82 Ga0068860_100199300 3300005843 Bacteria 1939
83 Ga0068862_100000823 3300005844 Bacteria 30714
84 Ga0068862_100036602 3300005844 Bacteria 4160
85 Ga0068862_100066609 3300005844 Bacteria 3104
86 Ga0070717_10046331 3300006028 Bacteria 3558
87 Ga0075363_100028367 3300006048 Bacteria 2878
88 Ga0075364_10217417 3300006051 Bacteria 1296
89 Ga0075364_10725839 3300006051 Bacteria 678
90 Ga0075364_11012595 3300006051 Bacteria 565
91 Ga0070716_101208253 3300006173 Bacteria 607
92 Ga0075366_10023405 3300006195 Bacteria 3598
93 Ga0097621_100005474 3300006237 Bacteria 8940
94 Ga0068871_100002002 3300006358 Bacteria 13799
95 Ga0068871_100189645 3300006358 Bacteria 1770
96 Ga0075433_10726955 3300006852 Bacteria 869
97 Ga0075434_101089268 3300006871 Bacteria 812
98 Ga0075434_101363433 3300006871 Bacteria 719
99 Ga0068865_100112321 3300006881 Bacteria 2012
100 Ga0097620_100000014 3300006931 Bacteria 280955
101 Ga0097620_100166882 3300006931 Bacteria 2281
102 Ga0075435_100615052 3300007076 Bacteria 942
103 Ga0105251_10168850 3300009011 Bacteria 986
104 Ga0105244_10018662 3300009036 Bacteria 3886
105 Ga0105250_10159058 3300009092 Bacteria 943
106 Ga0105240_10464490 3300009093 Bacteria 1414
107 Ga0105245_10004511 3300009098 Bacteria 12301
108 Ga0105245_10254886 3300009098 Bacteria 1706
109 Ga0105245_12699312 3300009098 Bacteria 550
110 Ga0105243_10137638 3300009148 Bacteria 2079
111 Ga0105241_11448590 3300009174 Bacteria 659
112 Ga0105242_10020738 3300009176 Bacteria 5154
113 Ga0105248_10307117 3300009177 Bacteria 1786
114 Ga0105248_10573575 3300009177 Bacteria 1273
115 Ga0105238_10182144 3300009551 Bacteria 2077
116 Ga0105238_10318422 3300009551 Bacteria 1541
117 Ga0105238_10524377 3300009551 Bacteria 1187
118 Ga0105238_11976271 3300009551 Bacteria 617
119 Ga0105249_10057436 3300009553 Bacteria 3565
120 Ga0105249_10649890 3300009553 Bacteria 1112
121 Ga0105249_11403536 3300009553 Bacteria 770
122 Ga0105148_108742 3300009978 Bacteria 759
123 Ga0157329_1043212 3300012491 Bacteria 512
124 Ga0157335_1008902 3300012492 Bacteria 779
125 Ga0157338_1002488 3300012515 Bacteria 1449
126 Ga0157373_10020641 3300013100 Bacteria 4785
127 Ga0157371_10121597 3300013102 Bacteria 1857
128 Ga0157370_10121745 3300013104 Bacteria 2436
129 Ga0157370_10131962 3300013104 Bacteria 2330
130 Ga0157369_10635606 3300013105 Bacteria 1101
131 Ga0157369_11242409 3300013105 Bacteria 760
132 Ga0157378_10032443 3300013297 Bacteria 4615
133 Ga0157378_12032272 3300013297 Bacteria 625
134 Ga0163162_10350123 3300013306 Bacteria 1610
135 Ga0157375_10020713 3300013308 Bacteria 6016
136 Ga0157375_10351804 3300013308 Bacteria 1639
137 Ga0163163_10001293 3300014325 Bacteria 21150
138 Ga0163163_10102845 3300014325 Bacteria 2881
139 Ga0157380_10027403 3300014326 Bacteria 4334
140 Ga0157380_10362376 3300014326 Bacteria 1361
141 Ga0157379_10096229 3300014968 Bacteria 2657
142 Ga0157379_10101166 3300014968 Bacteria 2587
143 Ga0157379_10106083 3300014968 Bacteria 2522
144 Ga0157376_10086986 3300014969 Bacteria 2695
145 Ga0182005_1155307 3300015265 Bacteria 668
146 Ga0163161_10134995 3300017792 Bacteria 1865
147 Ga0163161_10897078 3300017792 Bacteria 751
148 Ga0197907_11106774 3300020069 Bacteria 929
149 Ga0206353_10836718 3300020082 Bacteria 1916
150 Ga0213873_10200581 3300021358 Bacteria 619
151 Ga0213872_10000044 3300021361 Bacteria 114843
152 Ga0209563_100025 3300025230 Bacteria 596456
153 Ga0209759_1057314 3300025256 Bacteria 564
154 Ga0209673_1012932 3300025273 Bacteria 3325
155 Ga0209758_1000731 3300025297 Bacteria 48032
156 Ga0209050_1000312 3300025298 Bacteria 98756
157 Ga0209050_1006031 3300025298 Bacteria 7338
158 Ga0209256_1105593 3300025299 Bacteria 575
159 Ga0209051_1023765 3300025303 Bacteria 2540
160 Ga0209051_1070515 3300025303 Bacteria 1054
161 Ga0207653_10037827 3300025885 Bacteria 1575
162 Ga0207642_10044504 3300025899 Bacteria 1965
163 Ga0207688_10115473 3300025901 Bacteria 1562
164 Ga0207647_10255338 3300025904 Bacteria 1005
165 Ga0207699_10499046 3300025906 Bacteria 878
166 Ga0207645_10326164 3300025907 Bacteria 1025
167 Ga0207643_10030356 3300025908 Bacteria 3008
168 Ga0207693_10231585 3300025915 Bacteria 1451
169 Ga0207662_10036613 3300025918 Bacteria 2869
170 Ga0207662_10071426 3300025918 Bacteria 2102
171 Ga0207657_10015642 3300025919 Bacteria 7340
172 Ga0207649_10657690 3300025920 Bacteria 810
173 Ga0207652_10737001 3300025921 Bacteria 878
174 Ga0207681_10164113 3300025923 Bacteria 1678
175 Ga0207694_10122468 3300025924 Bacteria 2078
176 Ga0207659_10141096 3300025926 Bacteria 1870
177 Ga0207687_10180437 3300025927 Bacteria 1635
178 Ga0207687_10673240 3300025927 Bacteria 877
179 Ga0207700_10156706 3300025928 Bacteria 1887
180 Ga0207700_10358380 3300025928 Bacteria 1271
181 Ga0207664_10002647 3300025929 Bacteria 11866
182 Ga0207664_10010794 3300025929 Bacteria 6464
183 Ga0207664_10489892 3300025929 Bacteria 1100
184 Ga0207644_10656085 3300025931 Bacteria 873
185 Ga0207690_10538253 3300025932 Bacteria 948
186 Ga0207706_10131651 3300025933 Bacteria 2200
187 Ga0207686_10227912 3300025934 Bacteria 1349
188 Ga0207709_10034905 3300025935 Bacteria 2969
189 Ga0207709_10120923 3300025935 Bacteria 1768
190 Ga0207670_10018027 3300025936 Bacteria 4281
191 Ga0207670_10774451 3300025936 Bacteria 798
192 Ga0207704_10113491 3300025938 Bacteria 1837
193 Ga0207704_11742742 3300025938 Bacteria 535
194 Ga0207665_10199632 3300025939 Bacteria 1457
195 Ga0207691_10059980 3300025940 Bacteria 3458
196 Ga0207689_10001033 3300025942 Bacteria 26735
197 Ga0207689_10009520 3300025942 Bacteria 8384
198 Ga0207679_10279029 3300025945 Bacteria 1432
199 Ga0207651_10676137 3300025960 Bacteria 908
200 Ga0207712_10042264 3300025961 Bacteria 3137
201 Ga0207668_10251311 3300025972 Bacteria 1436
202 Ga0207640_10373369 3300025981 Bacteria 1153
203 Ga0207677_10394947 3300026023 Bacteria 1171
204 Ga0207703_10007487 3300026035 Bacteria 8671
205 Ga0207703_10019871 3300026035 Bacteria 5250
206 Ga0207639_10874826 3300026041 Bacteria 839
207 Ga0207678_10108482 3300026067 Bacteria 2368
208 Ga0207678_10423094 3300026067 Bacteria 1155
209 Ga0207678_10895702 3300026067 Bacteria 784
210 Ga0207708_10000335 3300026075 Bacteria 37085
211 Ga0207708_10013136 3300026075 Bacteria 6180
212 Ga0207702_10361571 3300026078 Bacteria 1391
213 Ga0207641_10489128 3300026088 Bacteria 1193
214 Ga0207641_10795821 3300026088 Bacteria 935
215 Ga0207648_10001298 3300026089 Bacteria 27839
216 Ga0207674_10029492 3300026116 Bacteria 5776
217 Ga0207674_10820389 3300026116 Bacteria 897
218 Ga0207675_100003006 3300026118 Bacteria 16540
219 Ga0207675_100206942 3300026118 Bacteria 1886
220 Ga0207683_10202203 3300026121 Bacteria 1806
221 Ga0207683_10285760 3300026121 Bacteria 1508
222 Ga0207698_11518293 3300026142 Bacteria 685
223 Ga0268265_10000077 3300028380 Bacteria 124726
224 Ga0268265_10173685 3300028380 Bacteria 1844
225 Ga0268265_10599243 3300028380 Bacteria 1053
226 Ga0268264_10070611 3300028381 Bacteria 2956
227 Ga0268264_11473694 3300028381 Bacteria 691
228 Ga0307515_10000022 3300028794 Bacteria 404064
229 Ga0314311_1155062 3300030733 Bacteria 920
230 Ga0316179_1015490 3300030734 Bacteria 1163
231 Ga0316180_1049861 3300030736 Bacteria 614
232 Ga0316182_1033104 3300030745 Bacteria 1420
233 Ga0265339_10050990 3300031249 Bacteria 2260
234 Ga0265331_10089458 3300031250 Bacteria 1424
235 Ga0307513_10389411 3300031456 Bacteria 1131
236 Ga0307509_10327233 3300031507 Bacteria 1266
237 Ga0307408_100507693 3300031548 Bacteria 1057
238 Ga0265314_10054091 3300031711 Bacteria 2780
239 Ga0307516_10137217 3300031730 Bacteria 2219
240 Ga0307518_10114336 3300031838 Bacteria 1918
241 Ga0307410_10649391 3300031852 Bacteria 885
242 Ga0307412_10000310 3300031911 Bacteria 30888
243 Ga0307412_10053983 3300031911 Bacteria 2666
244 Ga0307416_102454575 3300032002 Bacteria 620
245 Ga0373930_0032679 3300034816 Bacteria 1077
246 Ga0373959_0017752 3300034820 Bacteria 1332
247 Ga0373938_0032198 3300034957 Bacteria 1128
248 Ga0373926_0001831 3300035083 Bacteria 6616
249 Ga0373934_0026513 3300035086 Bacteria 2248
250 Ga0373944_0001713 3300035089 Bacteria 5549
251 Ga0373944_0002505 3300035089 Bacteria 4666
252 Ga0373951_0067677 3300035091 Bacteria 905
253 Ga0373952_0185415 3300035092 Bacteria 602
254 Ga0373923_0002288 3300035111 Bacteria 5847
255 Ga0373932_0028421 3300035112 Bacteria 1537
256 Ga0373936_0000231 3300035113 Bacteria 18435
257 Ga0373939_0009607 3300035114 Bacteria 2403
258 Ga0373941_0075167 3300035115 Bacteria 1130
259 Ga0373945_0003996 3300035116 Bacteria 4661
260 Ga0373945_0010282 3300035116 Bacteria 3078
261 Ga0373953_0023044 3300035117 Bacteria 2354
262 Ga0373956_0009527 3300035119 Bacteria 3954
263 Ga0373957_0035524 3300035120 Bacteria 1852
264 Ga0373960_0020582 3300035121 Bacteria 1746
265 Ga0373943_0000735 3300035170 Bacteria 14278
266 Ga0373943_0003991 3300035170 Bacteria 6715
267 Ga0373946_0000105 3300035171 Bacteria 23918
268 Ga0373946_0002326 3300035171 Bacteria 6721
269 Ga0373955_0104794 3300035172 Bacteria 1628
270 Ga0373955_0193868 3300035172 Bacteria 1208
271 Ga0373942_0117353 3300035207 Bacteria 828
272 Ga0373961_0037991 3300035241 Bacteria 1378
273 Ga0373962_0087700 3300035242 Bacteria 954
274 Ga0373924_0263062 3300035410 Bacteria 764
275 Ga0373935_0002081 3300035692 Bacteria 11347
276 Ga0373935_0343750 3300035692 Bacteria 1062
277 Ga0373927_0003382 3300035695 Bacteria 11483
278 Ga0373927_0110773 3300035695 Bacteria 1788
279 Ga0373947_0003117 3300035725 Bacteria 9863
280 Ga0373925_0000627 3300037068 Bacteria 33637
281 Ga0395900_0000046 3300037418 Bacteria 230114
282 Ga0395900_0001925 3300037418 Bacteria 23563
283 Ga0395898_0003660 3300037466 Bacteria 17084
284 Ga0395898_0239877 3300037466 Bacteria 1729
285 Ga0395905_0225557 3300037471 Bacteria 1753
286 Ga0395905_0782265 3300037471 Bacteria 857
287 Ga0436364_0789616 3300037853 Bacteria 3901
288 Ga0436361_0886712 3300039447 Bacteria 114879
289 Ga0436362_0405840 3300039453 Bacteria 663
290 Ga0439465_0183982 3300041413 Bacteria 757
291 Ga0451791_1617290 3300041451 Bacteria 1292
292 Ga0451797_1499073 3300041453 Bacteria 612
293 Ga0451795_0857445 3300041456 Bacteria 592
294 Ga0451798_0117124 3300041458 Bacteria 741
295 Ga0451804_0639915 3300041463 Bacteria 591
296 Ga0439431_0035588 3300041997 Bacteria 1252
297 Ga0450893_0068909 3300042532 Bacteria 685
298 Ga0451577_0004135 3300042876 Bacteria 15553
299 Ga0451577_0006275 3300042876 Bacteria 11904
300 Ga0451577_0769592 3300042876 Bacteria 870
301 Ga0466969_0502207 3300044656 Bacteria 553
302 Ga0466972_0071700 3300044658 Bacteria 1652
303 Ga0466965_0030957 3300044683 Bacteria 2608
304 Ga0466965_0098472 3300044683 Bacteria 1493
305 Ga0466966_0236866 3300044684 Bacteria 1100
306 Ga0466961_0037247 3300044693 Bacteria 3120
307 Ga0466963_0209012 3300044694 Bacteria 1365
308 Ga0466964_0240757 3300044706 Bacteria 887
309 Ga0453684_0543274 3300044712 Bacteria 1281
310 Ga0466968_0434527 3300044735 Bacteria 647
311 Ga0466970_0056458 3300044765 Bacteria 2098
312 Ga0466970_0103775 3300044765 Bacteria 1549
313 Ga0466970_0167687 3300044765 Bacteria 1216
314 Ga0466957_0135145 3300044842 Bacteria 1584
315 Ga0466957_0357145 3300044842 Bacteria 992
316 Ga0466960_0377007 3300044901 Bacteria 813
317 Ga0466959_0000018 3300045049 Bacteria 136580
318 Ga0451576_0274889 3300045051 Bacteria 1761
319 Ga0466958_0062078 3300045836 Bacteria 2277
320 Ga0466967_0119952 3300045976 Bacteria 2428
321 Ga0466967_0223800 3300045976 Bacteria 1789
322 Ga0466967_0321188 3300045976 Bacteria 1493
323 Ga0466967_1159746 3300045976 Bacteria 770
324 Ga0495592_0050106 3300046454 Bacteria 3103
325 Ga0495603_0003724 3300046455 Bacteria 9072
326 Ga0495629_0745388 3300046459 Bacteria 648
327 Ga0495641_0029055 3300046461 Bacteria 2668
328 Ga0495641_0222607 3300046461 Bacteria 846
329 Ga0495651_0048241 3300046462 Bacteria 3289
330 Ga0495651_0162542 3300046462 Bacteria 1598
331 Ga0495653_0029395 3300046463 Bacteria 4387
332 Ga0495653_0284612 3300046463 Bacteria 1083
333 Ga0495650_0005272 3300046471 Bacteria 8465
334 Ga0495580_0060062 3300046472 Bacteria 2671
335 Ga0495582_0077428 3300046473 Bacteria 1844
336 Ga0495662_0003892 3300046476 Bacteria 7531
337 Ga0495664_0000659 3300046477 Bacteria 17555
338 Ga0495608_0088579 3300046511 Bacteria 2003
339 Ga0495618_0054645 3300046514 Bacteria 2527
340 Ga0495618_0124601 3300046514 Bacteria 1650
341 Ga0495628_0016854 3300046516 Bacteria 6088
342 Ga0495628_0647066 3300046516 Bacteria 751
343 Ga0495630_0027061 3300046517 Bacteria 4250
344 Ga0495630_0526389 3300046517 Bacteria 906
345 Ga0495632_0005591 3300046519 Bacteria 8275
346 Ga0495652_0142310 3300046529 Bacteria 1885
347 Ga0495665_0353218 3300046531 Bacteria 748
348 Ga0495665_0422004 3300046531 Bacteria 675
349 Ga0495640_0026764 3300046533 Bacteria 4163
350 Ga0495640_0102147 3300046533 Bacteria 1881
351 Ga0495587_0040195 3300046536 Bacteria 2796
352 Ga0495587_0240763 3300046536 Bacteria 1018
353 Ga0495598_0200016 3300046537 Bacteria 721
354 Ga0495645_0259998 3300046543 Bacteria 1150
355 Ga0495622_0154900 3300046557 Bacteria 1035
356 Ga0495667_0008867 3300046559 Bacteria 6838
357 Ga0495634_0023683 3300046642 Bacteria 4313
358 Ga0495634_0165959 3300046642 Bacteria 1390
359 Ga0495635_0021220 3300046663 Bacteria 4527
360 Ga0495635_0029717 3300046663 Bacteria 3800
361 Ga0495588_0021339 3300046674 Bacteria 3191
362 Ga0495657_0195010 3300046675 Bacteria 1236
363 Ga0495657_0283643 3300046675 Bacteria 990
364 Ga0495599_0030467 3300046678 Bacteria 3384
365 Ga0495599_0265813 3300046678 Bacteria 1041
366 Ga0495599_0282578 3300046678 Bacteria 1005
367 Ga0495623_0126743 3300046679 Bacteria 1532
368 Ga0495646_0064997 3300046680 Bacteria 2161
369 Ga0495647_0290108 3300046681 Bacteria 735
370 Ga0495613_0030661 3300046689 Bacteria 3994
371 Ga0495613_1054288 3300046689 Bacteria 520
372 Ga0495624_0006653 3300046690 Bacteria 8173
373 Ga0495624_0020485 3300046690 Bacteria 4400
374 Ga0495600_0022338 3300046809 Bacteria 4060
375 Ga0495600_0207804 3300046809 Bacteria 1255
376 Ga0495660_0047579 3300046810 Bacteria 2348
377 Ga0495581_0007132 3300047315 Bacteria 6471
378 Ga0495581_0138652 3300047315 Bacteria 1418
379 Ga0495604_0295910 3300047317 Bacteria 1088
380 Ga0495674_0009289 3300047319 Bacteria 9345
381 Ga0495674_0039125 3300047319 Bacteria 4252
382 Ga0495676_0031083 3300047321 Bacteria 4521
383 Ga0495676_0034117 3300047321 Bacteria 4273
384 Ga0495680_0029852 3300047322 Bacteria 4460
385 Ga0495675_0006041 3300047444 Bacteria 7411
386 Ga0495684_0001720 3300047471 Bacteria 17613
387 Ga0495684_0441127 3300047471 Bacteria 906
388 Ga0495593_0035723 3300047673 Bacteria 2696
389 Ga0495593_0098493 3300047673 Bacteria 1501
390 Ga0495602_0208928 3300048088 Bacteria 1483
391 Ga0495614_0046088 3300048089 Bacteria 1869
392 Ga0496100_0383618 3300048903 Bacteria 1067
393 Ga0496103_0111578 3300048906 Bacteria 1737
394 Ga0496104_0279175 3300048907 Bacteria 1583
395 Ga0496105_0155445 3300048908 Bacteria 1878
396 Ga0496106_0024724 3300048909 Bacteria 4466
397 Ga0496109_0021692 3300048912 Bacteria 5683
398 Ga0496109_0677307 3300048912 Bacteria 969
399 Ga0496110_0040038 3300048913 Bacteria 4083
400 Ga0496110_0320052 3300048913 Bacteria 1413
401 Ga0496110_1246498 3300048913 Bacteria 653
402 Ga0496111_0115910 3300048914 Bacteria 1975
403 Ga0496114_0201221 3300048917 Bacteria 1744
404 Ga0496114_0342207 3300048917 Bacteria 1323
405 Ga0496115_0188430 3300048918 Bacteria 1704
406 Ga0496116_0069187 3300048919 Bacteria 2245
407 Ga0496117_0011778 3300048920 Bacteria 7792
408 Ga0496117_0303608 3300048920 Bacteria 844
409 Ga0496117_0623693 3300048920 Bacteria 500
410 Ga0496118_0013986 3300048921 Bacteria 7538
411 Ga0496118_0033371 3300048921 Bacteria 4224
412 Ga0496118_0050147 3300048921 Bacteria 3206
413 Ga0496119_0015768 3300048922 Bacteria 5793
414 Ga0496119_0037318 3300048922 Bacteria 3158
415 Ga0496120_0003931 3300048923 Bacteria 12954
416 Ga0496121_0000411 3300048924 Bacteria 85089
417 Ga0496121_0073918 3300048924 Bacteria 2729
418 Ga0496122_0000646 3300048925 Bacteria 70740
419 Ga0496122_0000891 3300048925 Bacteria 55619
420 Ga0496122_0001323 3300048925 Bacteria 40594
421 Ga0496122_0056639 3300048925 Bacteria 2920
422 Ga0496123_0000405 3300048926 Bacteria 79019
423 Ga0496123_0000568 3300048926 Bacteria 63015
424 Ga0496123_0040461 3300048926 Bacteria 3245
425 Ga0496124_0000088 3300048927 Bacteria 194644
426 Ga0496124_0001934 3300048927 Bacteria 28387
427 Ga0496124_0035597 3300048927 Bacteria 4354
428 Ga0496124_0188165 3300048927 Bacteria 1582
429 Ga0496125_0000075 3300048928 Bacteria 234414
430 Ga0496125_0000096 3300048928 Bacteria 205618
431 Ga0496125_0000977 3300048928 Bacteria 44759
432 Ga0496125_0015682 3300048928 Bacteria 7309
433 Ga0496125_0034263 3300048928 Bacteria 4478
434 Ga0496126_0007489 3300048929 Bacteria 11957
435 Ga0496126_0014673 3300048929 Bacteria 7909
436 Ga0496126_0265887 3300048929 Bacteria 1425
437 Ga0501031_0000150 3300049568 Bacteria 39354
438 Ga0501031_0151630 3300049568 Bacteria 1515
439 Ga0501032_0000101 3300049569 Bacteria 72620
440 Ga0501032_0006839 3300049569 Bacteria 8367
441 Ga0501032_0178470 3300049569 Bacteria 1391
442 Ga0501033_0000373 3300049570 Bacteria 42856
443 Ga0501033_0004354 3300049570 Bacteria 11347
444 Ga0501033_0004796 3300049570 Bacteria 10798
445 Ga0501033_0054260 3300049570 Bacteria 2966
446 Ga0501033_0081768 3300049570 Bacteria 2369
447 Ga0501033_0177438 3300049570 Bacteria 1528
448 Ga0501034_0001646 3300049571 Bacteria 28850
449 Ga0501034_0038835 3300049571 Bacteria 4822
450 Ga0501036_0000652 3300049572 Bacteria 25459
451 Ga0501036_0055606 3300049572 Bacteria 3353
452 Ga0501036_0661907 3300049572 Bacteria 864
453 Ga0501036_0933316 3300049572 Bacteria 712
454 Ga0501036_1407090 3300049572 Bacteria 565
455 Ga0501037_0000076 3300049573 Bacteria 92049
456 Ga0501037_0000287 3300049573 Bacteria 42841
457 Ga0501037_0054914 3300049573 Bacteria 2913
458 Ga0501037_0641998 3300049573 Bacteria 710
459 Ga0501037_0966832 3300049573 Bacteria 556
460 Ga0501038_0000125 3300049574 Bacteria 64770
461 Ga0501038_0042193 3300049574 Bacteria 3974
462 Ga0501038_0046854 3300049574 Bacteria 3747
463 Ga0501038_0218768 3300049574 Bacteria 1520
464 Ga0501038_0609626 3300049574 Bacteria 825
465 Ga0501038_0674542 3300049574 Bacteria 776
466 Ga0501039_0000086 3300049575 Bacteria 70210
467 Ga0501039_0061818 3300049575 Bacteria 2901
468 Ga0501039_1398490 3300049575 Bacteria 539
469 Ga0501041_0737004 3300049577 Bacteria 631
470 Ga0501042_0245325 3300049578 Bacteria 1292
471 Ga0501043_0000039 3300049579 Bacteria 119155
472 Ga0501043_0000098 3300049579 Bacteria 79426
473 Ga0501043_0156216 3300049579 Bacteria 1784
474 Ga0501043_0266454 3300049579 Bacteria 1316
475 Ga0501043_0531115 3300049579 Bacteria 876
476 Ga0501046_0000160 3300049580 Bacteria 70083
477 Ga0501046_0133819 3300049580 Bacteria 1879
478 Ga0501047_0000496 3300049581 Bacteria 42628
479 Ga0501047_0008258 3300049581 Bacteria 9828
480 Ga0501047_0213923 3300049581 Bacteria 1785
481 Ga0501047_0266934 3300049581 Bacteria 1558
482 Ga0501047_0891832 3300049581 Bacteria 703
483 Ga0501047_1131024 3300049581 Bacteria 596
484 Ga0501048_0000364 3300049582 Bacteria 31338
485 Ga0501067_0045434 3300049583 Bacteria 2439
486 Ga0501067_0111438 3300049583 Bacteria 1521
487 Ga0501067_0569153 3300049583 Bacteria 635
488 Ga0501068_0007169 3300049584 Bacteria 6174
489 Ga0501069_0000022 3300049585 Bacteria 119155
490 Ga0501069_0000178 3300049585 Bacteria 28624
491 Ga0501069_0008179 3300049585 Bacteria 5493
492 Ga0501070_0000080 3300049586 Bacteria 81734
493 Ga0501070_0000306 3300049586 Bacteria 45155
494 Ga0501070_0000959 3300049586 Bacteria 26022
495 Ga0501070_0001852 3300049586 Bacteria 18673
496 Ga0501070_0161497 3300049586 Bacteria 1847
497 Ga0501070_0907594 3300049586 Bacteria 687
498 Ga0501071_0008305 3300049587 Bacteria 6858
499 Ga0501072_0177637 3300049588 Bacteria 1698
500 Ga0501072_1340247 3300049588 Bacteria 554
501 Ga0501073_0012779 3300049589 Bacteria 6125
502 Ga0501073_0020279 3300049589 Bacteria 4796
503 Ga0501073_0211245 3300049589 Bacteria 1341
504 Ga0501074_0000046 3300049590 Bacteria 57165
505 Ga0501074_0000058 3300049590 Bacteria 55082
506 Ga0501074_0048118 3300049590 Bacteria 3080
507 Ga0501074_0063056 3300049590 Bacteria 2670
508 Ga0501074_0546584 3300049590 Bacteria 820
509 Ga0501076_0264148 3300049592 Bacteria 1409
510 Ga0501079_0697594 3300049741 Bacteria 799
511 Ga0501079_1106738 3300049741 Bacteria 624
512 Ga0501080_0000422 3300049742 Bacteria 32596
513 Ga0501080_0012437 3300049742 Bacteria 7802
514 Ga0501080_0555954 3300049742 Bacteria 1022
515 Ga0501083_0000050 3300049744 Bacteria 86199
516 Ga0501083_0316751 3300049744 Bacteria 1014
517 Ga0501035_0000763 3300049822 Bacteria 34588
518 Ga0501035_0000987 3300049822 Bacteria 30112
519 Ga0501035_0002532 3300049822 Bacteria 17865
520 Ga0501035_0006637 3300049822 Bacteria 10830
521 Ga0501035_0039666 3300049822 Bacteria 4260
522 Ga0501035_0114453 3300049822 Bacteria 2362
523 Ga0501035_0196598 3300049822 Bacteria 1732
524 Ga0501035_0483923 3300049822 Bacteria 1020
525 Ga0501044_0001017 3300049823 Bacteria 33729
526 Ga0501044_0001241 3300049823 Bacteria 30294
527 Ga0501044_0008520 3300049823 Bacteria 11236
528 Ga0501044_0010936 3300049823 Bacteria 9850
529 Ga0501044_0012850 3300049823 Bacteria 9063
530 Ga0501044_0013725 3300049823 Bacteria 8755
531 Ga0501044_0085683 3300049823 Bacteria 3183
532 Ga0501044_0757237 3300049823 Bacteria 853
533 Ga0501045_0198979 3300049824 Bacteria 1493
534 nmdc:mga00v17_250688_c1 3300050491 Bacteria 1148
535 nmdc:mga0k408_33987_c1 3300050493 Bacteria 2918
536 nmdc:mga06z11_427269_c1 3300050494 Bacteria 799
537 nmdc:mga07m45_34096_c1 3300050496 Bacteria 2828
538 nmdc:mga0n895_1403141_c1 3300050512 Bacteria 667
539 nmdc:mga0n895_542902_c1 3300050512 Bacteria 1169
540 nmdc:mga08x19_41304_c1 3300050514 Bacteria 2937
541 nmdc:mga0sz30_476586_c1 3300050516 Bacteria 561
542 Ga0495601_0019605 3300053077 Bacteria 4126
543 Ga0495612_0020091 3300053078 Bacteria 2676
544 Ga0495612_0460605 3300053078 Bacteria 581
545 Ga0495595_0066201 3300053084 Bacteria 1700
546 Ga0495619_0708294 3300053085 Bacteria 684
547 Ga0500578_0001591 3300053086 Bacteria 22016
548 Ga0500583_0236750 3300053092 Bacteria 903
549 Ga0500651_0054253 3300053093 Bacteria 2512
550 Ga0500650_0137101 3300053098 Bacteria 1135
551 Ga0500569_058854 3300053109 Bacteria 1181
552 Ga0500628_017384 3300053129 Bacteria 1404
553 Ga0500642_0009769 3300053130 Bacteria 3350
554 Ga0500642_0220183 3300053130 Bacteria 879
555 Ga0500652_009058 3300053131 Bacteria 3348
556 Ga0500568_0020845 3300053139 Bacteria 2829
557 Ga0500577_0095966 3300053142 Bacteria 1205
558 Ga0500588_0212563 3300053146 Bacteria 719
559 Ga0500604_0065768 3300053151 Bacteria 1147
560 Ga0500604_0084892 3300053151 Bacteria 1027
561 Ga0500616_0260683 3300053153 Bacteria 736
562 Ga0500622_0008282 3300053156 Bacteria 5829
563 Ga0500622_0089478 3300053156 Bacteria 1529
564 Ga0501084_0027556 3300054114 Bacteria 4747
565 Ga0501084_0050886 3300054114 Bacteria 3466
566 Ga0501084_0150143 3300054114 Bacteria 1964
567 Ga0501082_0047126 3300060353 Bacteria 3715
568 Ga0501082_0132692 3300060353 Bacteria 2161
569 Ga0501082_0624171 3300060353 Bacteria 943
570 Ga0466962_0235781 3300061719 Bacteria 897
571 2508672192 2508501039 Bacteria 9978592
572 2548849060 2547132512 Bacteria 3416496
573 2587732193 2585428058 Bacteria 6853932
574 2588292169 2588253510 Bacteria 6901809
575 2643827186 2643221561 Bacteria 4984412
576 2643861126 2643221569 Bacteria 6064337
577 2643971803 2643221592 Bacteria 6608788
578 2643983423 2643221594 Bacteria 5811388
579 2644124428 2643221621 Bacteria 6212786
580 2644139293 2643221625 Bacteria 6512927
581 2644274903 2643221648 Bacteria 6521465
582 2644527689 2643221694 Bacteria 4392972
583 2644533982 2643221696 Bacteria 5431823
584 2644670690 2643221722 Bacteria 4247614
585 2739606671 2739367654 Bacteria 6049412
586 2739610599 2739367655 Bacteria 4051151
587 2760306504 2758568522 Bacteria 5953541
588 2760625027 2758568621 Bacteria 5967089
589 2809029893 2808606394 Bacteria 6248540
590 2809032664 2808606395 Bacteria 6020352
591 2842890789 2842888712 Bacteria 4279094
592 2857542345 2857537821 Bacteria 5248181
593 2857547598 2857542790 Bacteria 5326616
594 2857577310 2857576091 Bacteria 5465855
595 2858951270 2858950400 Bacteria 6783797
596 2881931270 2881927736 Bacteria 3993927
597 2883826249 2883821847 Bacteria 5121194
598 2887380977 2887375801 Bacteria 5334027
599 2887447256 2887443736 Bacteria 4426037
600 2941485399
601 8002395476 8002392321 Bacteria 4159911
602 8056582759 8056579771 Bacteria 5840325
603 Ga0451789_1195376
604 JGI25153J46596_10008471
605 JGI25153J46596_10010729
606 Ga0055525_1000013
607 Ga0055530_10043622
608 Ga0065165_1007818
609 Ga0070683_100014173
610 Ga0068869_100001878
611 Ga0070666_10036996
612 Ga0070682_100079882
613 Ga0068868_100077246
614 Ga0070660_100225650
615 Ga0070689_100024275
616 Ga0070691_10008608
617 Ga0070691_10371980
618 Ga0070687_100035680
619 Ga0070687_100046834
620 Ga0070661_100125710
621 Ga0070692_10002093
622 Ga0070692_10082598
623 Ga0070668_100070628
624 Ga0070675_100422138
625 Ga0070671_101030859
626 Ga0070674_100236251
627 Ga0070674_100511411
628 Ga0070673_101142311
629 Ga0070688_100143012
630 Ga0070659_100055770
631 Ga0070667_100146897
632 Ga0070703_10010151
633 Ga0070709_10674086
634 Ga0070713_100192014
635 Ga0070713_100321401
636 Ga0070701_10003480
637 Ga0070701_10195058
638 Ga0070705_100194830
639 Ga0070694_100023503
640 Ga0070694_100028532
641 Ga0070708_100103946
642 Ga0070678_100076589
643 Ga0070678_100613467
644 Ga0070662_100337824
645 Ga0070681_10104188
646 Ga0068867_100183644
647 Ga0070685_10240171
648 Ga0070698_100397373
649 Ga0070699_100453737
650 Ga0070684_100266536
651 Ga0068853_100110051
652 Ga0068853_100426751
653 Ga0068853_100551292
654 Ga0070672_100876611
655 Ga0070686_100006091
656 Ga0070695_100179181
657 Ga0070696_100105473
658 Ga0070696_100446627
659 Ga0070693_100051012
660 Ga0070693_100612479
661 Ga0070704_100097709
662 Ga0070704_100507466
663 Ga0068855_101301134
664 Ga0068857_100474415
665 Ga0068854_100181239
666 Ga0068856_100869683
667 Ga0070702_100000808
668 Ga0070702_100016003
669 Ga0068852_100024515
670 Ga0068852_101133728
671 Ga0068859_100000014
672 Ga0068859_100166875
673 Ga0068864_100157471
674 Ga0068866_10024378
675 Ga0068866_10034949
676 Ga0068861_100005194
677 Ga0068861_101438031
678 Ga0068870_10056551
679 Ga0068870_10624110
680 Ga0068863_100103101
681 Ga0068858_100005157
682 Ga0068858_100010545
683 Ga0068860_100026027
684 Ga0068860_100199300
685 Ga0068862_100000823
686 Ga0068862_100036602
687 Ga0068862_100066609
688 Ga0070717_10046331
689 Ga0075363_100028367
690 Ga0075364_10217417
691 Ga0075364_10725839
692 Ga0075364_11012595
693 Ga0070716_101208253
694 Ga0075366_10023405
695 Ga0097621_100005474
696 Ga0068871_100002002
697 Ga0068871_100189645
698 Ga0075433_10726955
699 Ga0075434_101089268
700 Ga0075434_101363433
701 Ga0068865_100112321
702 Ga0097620_100000014
703 Ga0097620_100166882
704 Ga0075435_100615052
705 Ga0105251_10168850
706 Ga0105244_10018662
707 Ga0105250_10159058
708 Ga0105240_10464490
709 Ga0105245_10004511
710 Ga0105245_10254886
711 Ga0105245_12699312
712 Ga0105243_10137638
713 Ga0105241_11448590
714 Ga0105242_10020738
715 Ga0105248_10307117
716 Ga0105248_10573575
717 Ga0105238_10182144
718 Ga0105238_10318422
719 Ga0105238_10524377
720 Ga0105238_11976271
721 Ga0105249_10057436
722 Ga0105249_10649890
723 Ga0105249_11403536
724 Ga0105148_108742
725 Ga0157329_1043212
726 Ga0157335_1008902
727 Ga0157338_1002488
728 Ga0157373_10020641
729 Ga0157371_10121597
730 Ga0157370_10121745
731 Ga0157370_10131962
732 Ga0157369_10635606
733 Ga0157369_11242409
734 Ga0157378_10032443
735 Ga0157378_12032272
736 Ga0163162_10350123
737 Ga0157375_10020713
738 Ga0157375_10351804
739 Ga0163163_10001293
740 Ga0163163_10102845
741 Ga0157380_10027403
742 Ga0157380_10362376
743 Ga0157379_10096229
744 Ga0157379_10101166
745 Ga0157379_10106083
746 Ga0157376_10086986
747 Ga0182005_1155307
748 Ga0163161_10134995
749 Ga0163161_10897078
750 Ga0197907_11106774
751 Ga0206353_10836718
752 Ga0213873_10200581
753 Ga0213872_10000044
754 Ga0209563_100025
755 Ga0209759_1057314
756 Ga0209673_1012932
757 Ga0209758_1000731
758 Ga0209050_1000312
759 Ga0209050_1006031
760 Ga0209256_1105593
761 Ga0209051_1023765
762 Ga0209051_1070515
763 Ga0207653_10037827
764 Ga0207642_10044504
765 Ga0207688_10115473
766 Ga0207647_10255338
767 Ga0207699_10499046
768 Ga0207645_10326164
769 Ga0207643_10030356
770 Ga0207693_10231585
771 Ga0207662_10036613
772 Ga0207662_10071426
773 Ga0207657_10015642
774 Ga0207649_10657690
775 Ga0207652_10737001
776 Ga0207681_10164113
777 Ga0207694_10122468
778 Ga0207659_10141096
779 Ga0207687_10180437
780 Ga0207687_10673240
781 Ga0207700_10156706
782 Ga0207700_10358380
783 Ga0207664_10002647
784 Ga0207664_10010794
785 Ga0207664_10489892
786 Ga0207644_10656085
787 Ga0207690_10538253
788 Ga0207706_10131651
789 Ga0207686_10227912
790 Ga0207709_10034905
791 Ga0207709_10120923
792 Ga0207670_10018027
793 Ga0207670_10774451
794 Ga0207704_10113491
795 Ga0207704_11742742
796 Ga0207665_10199632
797 Ga0207691_10059980
798 Ga0207689_10001033
799 Ga0207689_10009520
800 Ga0207679_10279029
801 Ga0207651_10676137
802 Ga0207712_10042264
803 Ga0207668_10251311
804 Ga0207640_10373369
805 Ga0207677_10394947
806 Ga0207703_10007487
807 Ga0207703_10019871
808 Ga0207639_10874826
809 Ga0207678_10108482
810 Ga0207678_10423094
811 Ga0207678_10895702
812 Ga0207708_10000335
813 Ga0207708_10013136
814 Ga0207702_10361571
815 Ga0207641_10489128
816 Ga0207641_10795821
817 Ga0207648_10001298
818 Ga0207674_10029492
819 Ga0207674_10820389
820 Ga0207675_100003006
821 Ga0207675_100206942
822 Ga0207683_10202203
823 Ga0207683_10285760
824 Ga0207698_11518293
825 Ga0268265_10000077
826 Ga0268265_10173685
827 Ga0268265_10599243
828 Ga0268264_10070611
829 Ga0268264_11473694
830 Ga0307515_10000022
831 Ga0314311_1155062
832 Ga0316179_1015490
833 Ga0316180_1049861
834 Ga0316182_1033104
835 Ga0265339_10050990
836 Ga0265331_10089458
837 Ga0307513_10389411
838 Ga0307509_10327233
839 Ga0307408_100507693
840 Ga0265314_10054091
841 Ga0307516_10137217
842 Ga0307518_10114336
843 Ga0307410_10649391
844 Ga0307412_10000310
845 Ga0307412_10053983
846 Ga0307416_102454575
847 Ga0373930_0032679
848 Ga0373959_0017752
849 Ga0373938_0032198
850 Ga0373926_0001831
851 Ga0373934_0026513
852 Ga0373944_0001713
853 Ga0373944_0002505
854 Ga0373951_0067677
855 Ga0373952_0185415
856 Ga0373923_0002288
857 Ga0373932_0028421
858 Ga0373936_0000231
859 Ga0373939_0009607
860 Ga0373941_0075167
861 Ga0373945_0003996
862 Ga0373945_0010282
863 Ga0373953_0023044
864 Ga0373956_0009527
865 Ga0373957_0035524
866 Ga0373960_0020582
867 Ga0373943_0000735
868 Ga0373943_0003991
869 Ga0373946_0000105
870 Ga0373946_0002326
871 Ga0373955_0104794
872 Ga0373955_0193868
873 Ga0373942_0117353
874 Ga0373961_0037991
875 Ga0373962_0087700
876 Ga0373924_0263062
877 Ga0373935_0002081
878 Ga0373935_0343750
879 Ga0373927_0003382
880 Ga0373927_0110773
881 Ga0373947_0003117
882 Ga0373925_0000627
883 Ga0395900_0000046
884 Ga0395900_0001925
885 Ga0395898_0003660
886 Ga0395898_0239877
887 Ga0395905_0225557
888 Ga0395905_0782265
889 Ga0436364_0789616
890 Ga0436361_0886712
891 Ga0436362_0405840
892 Ga0439465_0183982
893 Ga0451791_1617290
894 Ga0451797_1499073
895 Ga0451795_0857445
896 Ga0451798_0117124
897 Ga0451804_0639915
898 Ga0439431_0035588
899 Ga0450893_0068909
900 Ga0451577_0004135
901 Ga0451577_0006275
902 Ga0451577_0769592
903 Ga0466969_0502207
904 Ga0466972_0071700
905 Ga0466965_0030957
906 Ga0466965_0098472
907 Ga0466966_0236866
908 Ga0466961_0037247
909 Ga0466963_0209012
910 Ga0466964_0240757
911 Ga0453684_0543274
912 Ga0466968_0434527
913 Ga0466970_0056458
914 Ga0466970_0103775
915 Ga0466970_0167687
916 Ga0466957_0135145
917 Ga0466957_0357145
918 Ga0466960_0377007
919 Ga0466959_0000018
920 Ga0451576_0274889
921 Ga0466958_0062078
922 Ga0466967_0119952
923 Ga0466967_0223800
924 Ga0466967_0321188
925 Ga0466967_1159746
926 Ga0495592_0050106
927 Ga0495603_0003724
928 Ga0495629_0745388
929 Ga0495641_0029055
930 Ga0495641_0222607
931 Ga0495651_0048241
932 Ga0495651_0162542
933 Ga0495653_0029395
934 Ga0495653_0284612
935 Ga0495650_0005272
936 Ga0495580_0060062
937 Ga0495582_0077428
938 Ga0495662_0003892
939 Ga0495664_0000659
940 Ga0495608_0088579
941 Ga0495618_0054645
942 Ga0495618_0124601
943 Ga0495628_0016854
944 Ga0495628_0647066
945 Ga0495630_0027061
946 Ga0495630_0526389
947 Ga0495632_0005591
948 Ga0495652_0142310
949 Ga0495665_0353218
950 Ga0495665_0422004
951 Ga0495640_0026764
952 Ga0495640_0102147
953 Ga0495587_0040195
954 Ga0495587_0240763
955 Ga0495598_0200016
956 Ga0495645_0259998
957 Ga0495622_0154900
958 Ga0495667_0008867
959 Ga0495634_0023683
960 Ga0495634_0165959
961 Ga0495635_0021220
962 Ga0495635_0029717
963 Ga0495588_0021339
964 Ga0495657_0195010
965 Ga0495657_0283643
966 Ga0495599_0030467
967 Ga0495599_0265813
968 Ga0495599_0282578
969 Ga0495623_0126743
970 Ga0495646_0064997
971 Ga0495647_0290108
972 Ga0495613_0030661
973 Ga0495613_1054288
974 Ga0495624_0006653
975 Ga0495624_0020485
976 Ga0495600_0022338
977 Ga0495600_0207804
978 Ga0495660_0047579
979 Ga0495581_0007132
980 Ga0495581_0138652
981 Ga0495604_0295910
982 Ga0495674_0009289
983 Ga0495674_0039125
984 Ga0495676_0031083
985 Ga0495676_0034117
986 Ga0495680_0029852
987 Ga0495675_0006041
988 Ga0495684_0001720
989 Ga0495684_0441127
990 Ga0495593_0035723
991 Ga0495593_0098493
992 Ga0495602_0208928
993 Ga0495614_0046088
994 Ga0496100_0383618
995 Ga0496103_0111578
996 Ga0496104_0279175
997 Ga0496105_0155445
998 Ga0496106_0024724
999 Ga0496109_0021692
1000 Ga0496109_0677307
1001 Ga0496110_0040038
1002 Ga0496110_0320052
1003 Ga0496110_1246498
1004 Ga0496111_0115910
1005 Ga0496114_0201221
1006 Ga0496114_0342207
1007 Ga0496115_0188430
1008 Ga0496116_0069187
1009 Ga0496117_0011778
1010 Ga0496117_0303608
1011 Ga0496117_0623693
1012 Ga0496118_0013986
1013 Ga0496118_0033371
1014 Ga0496118_0050147
1015 Ga0496119_0015768
1016 Ga0496119_0037318
1017 Ga0496120_0003931
1018 Ga0496121_0000411
1019 Ga0496121_0073918
1020 Ga0496122_0000646
1021 Ga0496122_0000891
1022 Ga0496122_0001323
1023 Ga0496122_0056639
1024 Ga0496123_0000405
1025 Ga0496123_0000568
1026 Ga0496123_0040461
1027 Ga0496124_0000088
1028 Ga0496124_0001934
1029 Ga0496124_0035597
1030 Ga0496124_0188165
1031 Ga0496125_0000075
1032 Ga0496125_0000096
1033 Ga0496125_0000977
1034 Ga0496125_0015682
1035 Ga0496125_0034263
1036 Ga0496126_0007489
1037 Ga0496126_0014673
1038 Ga0496126_0265887
1039 Ga0501031_0000150
1040 Ga0501031_0151630
1041 Ga0501032_0000101
1042 Ga0501032_0006839
1043 Ga0501032_0178470
1044 Ga0501033_0000373
1045 Ga0501033_0004354
1046 Ga0501033_0004796
1047 Ga0501033_0054260
1048 Ga0501033_0081768
1049 Ga0501033_0177438
1050 Ga0501034_0001646
1051 Ga0501034_0038835
1052 Ga0501036_0000652
1053 Ga0501036_0055606
1054 Ga0501036_0661907
1055 Ga0501036_0933316
1056 Ga0501036_1407090
1057 Ga0501037_0000076
1058 Ga0501037_0000287
1059 Ga0501037_0054914
1060 Ga0501037_0641998
1061 Ga0501037_0966832
1062 Ga0501038_0000125
1063 Ga0501038_0042193
1064 Ga0501038_0046854
1065 Ga0501038_0218768
1066 Ga0501038_0609626
1067 Ga0501038_0674542
1068 Ga0501039_0000086
1069 Ga0501039_0061818
1070 Ga0501039_1398490
1071 Ga0501041_0737004
1072 Ga0501042_0245325
1073 Ga0501043_0000039
1074 Ga0501043_0000098
1075 Ga0501043_0156216
1076 Ga0501043_0266454
1077 Ga0501043_0531115
1078 Ga0501046_0000160
1079 Ga0501046_0133819
1080 Ga0501047_0000496
1081 Ga0501047_0008258
1082 Ga0501047_0213923
1083 Ga0501047_0266934
1084 Ga0501047_0891832
1085 Ga0501047_1131024
1086 Ga0501048_0000364
1087 Ga0501067_0045434
1088 Ga0501067_0111438
1089 Ga0501067_0569153
1090 Ga0501068_0007169
1091 Ga0501069_0000022
1092 Ga0501069_0000178
1093 Ga0501069_0008179
1094 Ga0501070_0000080
1095 Ga0501070_0000306
1096 Ga0501070_0000959
1097 Ga0501070_0001852
1098 Ga0501070_0161497
1099 Ga0501070_0907594
1100 Ga0501071_0008305
1101 Ga0501072_0177637
1102 Ga0501072_1340247
1103 Ga0501073_0012779
1104 Ga0501073_0020279
1105 Ga0501073_0211245
1106 Ga0501074_0000046
1107 Ga0501074_0000058
1108 Ga0501074_0048118
1109 Ga0501074_0063056
1110 Ga0501074_0546584
1111 Ga0501076_0264148
1112 Ga0501079_0697594
1113 Ga0501079_1106738
1114 Ga0501080_0000422
1115 Ga0501080_0012437
1116 Ga0501080_0555954
1117 Ga0501083_0000050
1118 Ga0501083_0316751
1119 Ga0501035_0000763
1120 Ga0501035_0000987
1121 Ga0501035_0002532
1122 Ga0501035_0006637
1123 Ga0501035_0039666
1124 Ga0501035_0114453
1125 Ga0501035_0196598
1126 Ga0501035_0483923
1127 Ga0501044_0001017
1128 Ga0501044_0001241
1129 Ga0501044_0008520
1130 Ga0501044_0010936
1131 Ga0501044_0012850
1132 Ga0501044_0013725
1133 Ga0501044_0085683
1134 Ga0501044_0757237
1135 Ga0501045_0198979
1136 nmdc:mga00v17_250688_c1
1137 nmdc:mga0k408_33987_c1
1138 nmdc:mga06z11_427269_c1
1139 nmdc:mga07m45_34096_c1
1140 nmdc:mga0n895_1403141_c1
1141 nmdc:mga0n895_542902_c1
1142 nmdc:mga08x19_41304_c1
1143 nmdc:mga0sz30_476586_c1
1144 Ga0495601_0019605
1145 Ga0495612_0020091
1146 Ga0495612_0460605
1147 Ga0495595_0066201
1148 Ga0495619_0708294
1149 Ga0500578_0001591
1150 Ga0500583_0236750
1151 Ga0500651_0054253
1152 Ga0500650_0137101
1153 Ga0500569_058854
1154 Ga0500628_017384
1155 Ga0500642_0009769
1156 Ga0500642_0220183
1157 Ga0500652_009058
1158 Ga0500568_0020845
1159 Ga0500577_0095966
1160 Ga0500588_0212563
1161 Ga0500604_0065768
1162 Ga0500604_0084892
1163 Ga0500616_0260683
1164 Ga0500622_0008282
1165 Ga0500622_0089478
1166 Ga0501084_0027556
1167 Ga0501084_0050886
1168 Ga0501084_0150143
1169 Ga0501082_0047126
1170 Ga0501082_0132692
1171 Ga0501082_0624171
1172 Ga0466962_0235781
1173 2508672192
1174 2548849060
1175 2587732193
1176 2588292169
1177 2643827186
1178 2643861126
1179 2643971803
1180 2643983423
1181 2644124428
1182 2644139293
1183 2644274903
1184 2644527689
1185 2644533982
1186 2644670690
1187 2739606671
1188 2739610599
1189 2760306504
1190 2760625027
1191 2809029893
1192 2809032664
1193 2842890789
1194 2857542345
1195 2857547598
1196 2857577310
1197 2858951270
1198 2881931270
1199 2883826249
1200 2887380977
1201 2887447256
1202 2941485399
1203 8002395476
1204 8056582759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

30

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9681 13 151
2zqb-assembly1.cif.gz_C crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations 0.9651 15 150
1g15-assembly1.cif.gz_A co-crystal of e. coli rnase hi with two mn2+ ions bound in the the active site 0.9644 15 151
7vsa-assembly1.cif.gz_A e. coli ribonuclease hi in complex with two mg2+ 0.9615 13 151
1jl2-assembly1.cif.gz_C crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h 0.9598 15 151
ID Description Score Start End Superfamily
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9598 15 151 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9378 14 151 3.30.420.10
4ibnA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9056 13 151 3.30.420.10
af_Q86MG7_99_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9 17 148 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8969 15 151 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A527HH28-F1-model_v4 deleted 1.002 13 84
AF-A0A3C2BGT8-F1-model_v4 deleted 1.001 13 84
AF-A0A3D0XTL9-F1-model_v4 Ribonuclease HI 1.001 14 76 GO:0003676
GO:0004523
AF-A0A258MYJ5-F1-model_v4 deleted 0.9981 14 84
AF-A0A2N3AU90-F1-model_v4 Ribonuclease HI 0.9975 14 95 GO:0003676
GO:0004523

Map