F468169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 602 | 349 | 591 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10015546|Ga0105241_100155463 |
| Length | 245 |
| Sequence | VRPAAGYDPNVDSLEVATTYAQWAIEPMGHPIRRSIKENRMKLYFSPEACSLSPHIVLNELGLPFTTVNVDTKTKKTADGRDFLRINPKGYVPALELDDGEVLSEGPAIVQYLADLKPEKKLAPANGTLERARLQEWLNFITSELHKSYSPLFSPAMPAAAKAIFKDKLEQRYAFIAKTLDRQDYLLGAHFTVADAYLFVVTRWARHFDIDLNQWPSLAKFMERVGARAAVKLALNAESQAKKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 3 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 4 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 5 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 6 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 7 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 8 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 9 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 10 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 15 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 16 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 17 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 135 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 241 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 247 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 248 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 252 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 253 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 256 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 257 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 258 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 259 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 260 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 263 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 332 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 335 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 337 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 338 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 339 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 341 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 342 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 349 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.51 |
| Metatranscriptomes | 0.66 |
| Isolates | 1.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.97 |
| Nodule | 1.33 |
| Rhizoplane | 2.16 |
| Rhizosphere | 82.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1024787 | 3300001904 | Bacteria | 934 |
| 2 | JGI24737J22298_10000247 | 3300001990 | Bacteria | 17946 |
| 3 | JGI24737J22298_10001819 | 3300001990 | Bacteria | 7643 |
| 4 | JGI24744J21845_10010559 | 3300002077 | Bacteria | 1892 |
| 5 | JGI25156J39149_1000009 | 3300002705 | Bacteria | 224379 |
| 6 | JGI25154J39366_1000024 | 3300002738 | Bacteria | 211372 |
| 7 | JGI25157J39369_1000007 | 3300002741 | Bacteria | 224377 |
| 8 | JGI25159J45721_1000314 | 3300002987 | Bacteria | 22609 |
| 9 | JGI25165J46597_1014494 | 3300003214 | Bacteria | 1072 |
| 10 | JGI25160J50197_1000131 | 3300003354 | Bacteria | 67778 |
| 11 | JGI25161J50226_1000009 | 3300003374 | Bacteria | 224699 |
| 12 | Ga0055539_1000222 | 3300003752 | Bacteria | 40292 |
| 13 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 14 | Ga0055525_1001185 | 3300003759 | Bacteria | 5883 |
| 15 | Ga0055537_1018448 | 3300003773 | Bacteria | 1114 |
| 16 | Ga0055534_1017490 | 3300003784 | Bacteria | 1266 |
| 17 | JGI25405J52794_10049997 | 3300003911 | Bacteria | 895 |
| 18 | Ga0055543_1000122 | 3300004625 | Bacteria | 65110 |
| 19 | Ga0065165_1009960 | 3300005262 | Bacteria | 4182 |
| 20 | Ga0065165_1016071 | 3300005262 | Bacteria | 2820 |
| 21 | Ga0070658_10030271 | 3300005327 | Bacteria | 4350 |
| 22 | Ga0070658_10254397 | 3300005327 | Bacteria | 1490 |
| 23 | Ga0070658_10387300 | 3300005327 | Bacteria | 1200 |
| 24 | Ga0070658_10454845 | 3300005327 | Bacteria | 1103 |
| 25 | Ga0070658_10570517 | 3300005327 | Bacteria | 980 |
| 26 | Ga0070690_100129577 | 3300005330 | Bacteria | 1702 |
| 27 | Ga0070670_100071113 | 3300005331 | Bacteria | 2987 |
| 28 | Ga0070670_100090153 | 3300005331 | Bacteria | 2635 |
| 29 | Ga0068869_100128824 | 3300005334 | Bacteria | 1943 |
| 30 | Ga0068869_100367629 | 3300005334 | Bacteria | 1176 |
| 31 | Ga0068869_100575708 | 3300005334 | Bacteria | 949 |
| 32 | Ga0070666_10001531 | 3300005335 | Bacteria | 14034 |
| 33 | Ga0070666_10043546 | 3300005335 | Bacteria | 3006 |
| 34 | Ga0070666_10070654 | 3300005335 | Bacteria | 2375 |
| 35 | Ga0070666_10377990 | 3300005335 | Bacteria | 1017 |
| 36 | Ga0070680_100028823 | 3300005336 | Bacteria | 4455 |
| 37 | Ga0070680_100505686 | 3300005336 | Unclassified | 1034 |
| 38 | Ga0070680_100759072 | 3300005336 | Bacteria | 835 |
| 39 | Ga0070682_100500494 | 3300005337 | Bacteria | 941 |
| 40 | Ga0068868_100530373 | 3300005338 | Bacteria | 1035 |
| 41 | Ga0070660_100181564 | 3300005339 | Bacteria | 1703 |
| 42 | Ga0070660_100348026 | 3300005339 | Bacteria | 1220 |
| 43 | Ga0070660_100408767 | 3300005339 | Bacteria | 1123 |
| 44 | Ga0070691_10007124 | 3300005341 | Bacteria | 5127 |
| 45 | Ga0070661_100022984 | 3300005344 | Bacteria | 4466 |
| 46 | Ga0070661_100035875 | 3300005344 | Bacteria | 3604 |
| 47 | Ga0070668_100539108 | 3300005347 | Unclassified | 1014 |
| 48 | Ga0070674_100029149 | 3300005356 | Bacteria | 3632 |
| 49 | Ga0070673_100539473 | 3300005364 | Bacteria | 1059 |
| 50 | Ga0070659_100005959 | 3300005366 | Bacteria | 8788 |
| 51 | Ga0070659_100010935 | 3300005366 | Bacteria | 6698 |
| 52 | Ga0070659_100094338 | 3300005366 | Bacteria | 2403 |
| 53 | Ga0070667_100022953 | 3300005367 | Bacteria | 5173 |
| 54 | Ga0070714_100005041 | 3300005435 | Bacteria | 10044 |
| 55 | Ga0070713_100074020 | 3300005436 | Bacteria | 2885 |
| 56 | Ga0070713_101291335 | 3300005436 | Bacteria | 707 |
| 57 | Ga0070711_100546532 | 3300005439 | Bacteria | 960 |
| 58 | Ga0070705_100131282 | 3300005440 | Bacteria | 1634 |
| 59 | Ga0070694_100105443 | 3300005444 | Bacteria | 2000 |
| 60 | Ga0070708_100414118 | 3300005445 | Bacteria | 1271 |
| 61 | Ga0070663_100778063 | 3300005455 | Bacteria | 819 |
| 62 | Ga0070678_100001672 | 3300005456 | Bacteria | 11879 |
| 63 | Ga0070678_100157499 | 3300005456 | Bacteria | 1836 |
| 64 | Ga0070662_100014321 | 3300005457 | Bacteria | 5296 |
| 65 | Ga0070662_100430957 | 3300005457 | Bacteria | 1092 |
| 66 | Ga0070681_10020234 | 3300005458 | Bacteria | 6671 |
| 67 | Ga0070681_10289248 | 3300005458 | Bacteria | 1549 |
| 68 | Ga0068867_100017603 | 3300005459 | Bacteria | 5075 |
| 69 | Ga0068867_100430130 | 3300005459 | Unclassified | 1120 |
| 70 | Ga0070685_10008868 | 3300005466 | Bacteria | 5186 |
| 71 | Ga0070706_100306308 | 3300005467 | Bacteria | 1482 |
| 72 | Ga0070707_100048186 | 3300005468 | Bacteria | 4081 |
| 73 | Ga0070679_100168250 | 3300005530 | Bacteria | 2165 |
| 74 | Ga0070679_100308138 | 3300005530 | Bacteria | 1533 |
| 75 | Ga0070679_100533327 | 3300005530 | Unclassified | 1118 |
| 76 | Ga0070684_100322598 | 3300005535 | Bacteria | 1419 |
| 77 | Ga0070697_100098379 | 3300005536 | Unclassified | 2428 |
| 78 | Ga0070697_100307991 | 3300005536 | Bacteria | 1362 |
| 79 | Ga0068853_100033923 | 3300005539 | Bacteria | 4330 |
| 80 | Ga0068853_100044900 | 3300005539 | Bacteria | 3784 |
| 81 | Ga0068853_100058974 | 3300005539 | Bacteria | 3315 |
| 82 | Ga0068853_100061839 | 3300005539 | Bacteria | 3239 |
| 83 | Ga0068853_100100679 | 3300005539 | Unclassified | 2555 |
| 84 | Ga0068853_100174237 | 3300005539 | Bacteria | 1948 |
| 85 | Ga0068853_100523249 | 3300005539 | Bacteria | 1121 |
| 86 | Ga0070672_100097277 | 3300005543 | Bacteria | 2383 |
| 87 | Ga0070686_100893451 | 3300005544 | Bacteria | 722 |
| 88 | Ga0070695_100020522 | 3300005545 | Bacteria | 4034 |
| 89 | Ga0070695_100236566 | 3300005545 | Bacteria | 1323 |
| 90 | Ga0070693_100021797 | 3300005547 | Bacteria | 3398 |
| 91 | Ga0070665_100000668 | 3300005548 | Bacteria | 46152 |
| 92 | Ga0070665_100016965 | 3300005548 | Bacteria | 7301 |
| 93 | Ga0070665_100183759 | 3300005548 | Bacteria | 2091 |
| 94 | Ga0070665_100532892 | 3300005548 | Bacteria | 1186 |
| 95 | Ga0070704_100265986 | 3300005549 | Unclassified | 1414 |
| 96 | Ga0070704_100303538 | 3300005549 | Bacteria | 1331 |
| 97 | Ga0070704_100558771 | 3300005549 | Bacteria | 1001 |
| 98 | Ga0068855_100042779 | 3300005563 | Bacteria | 5367 |
| 99 | Ga0068855_100077030 | 3300005563 | Bacteria | 3869 |
| 100 | Ga0068855_100475537 | 3300005563 | Bacteria | 1361 |
| 101 | Ga0070664_100061003 | 3300005564 | Bacteria | 3213 |
| 102 | Ga0068857_100020420 | 3300005577 | Bacteria | 5825 |
| 103 | Ga0068857_100228283 | 3300005577 | Bacteria | 1702 |
| 104 | Ga0068854_100530026 | 3300005578 | Bacteria | 996 |
| 105 | Ga0068856_100022335 | 3300005614 | Bacteria | 6149 |
| 106 | Ga0068856_100037193 | 3300005614 | Bacteria | 4775 |
| 107 | Ga0068852_100014128 | 3300005616 | Bacteria | 6132 |
| 108 | Ga0068852_100077928 | 3300005616 | Bacteria | 2931 |
| 109 | Ga0068852_100162455 | 3300005616 | Bacteria | 2087 |
| 110 | Ga0068852_100625075 | 3300005616 | Bacteria | 1083 |
| 111 | Ga0068852_100703446 | 3300005616 | Bacteria | 1021 |
| 112 | Ga0068852_100759915 | 3300005616 | Bacteria | 982 |
| 113 | Ga0068859_100330197 | 3300005617 | Bacteria | 1619 |
| 114 | Ga0068859_101175913 | 3300005617 | Bacteria | 844 |
| 115 | Ga0068864_100016572 | 3300005618 | Bacteria | 6134 |
| 116 | Ga0068864_100024569 | 3300005618 | Bacteria | 5071 |
| 117 | Ga0068864_100235965 | 3300005618 | Bacteria | 1693 |
| 118 | Ga0068861_100028347 | 3300005719 | Bacteria | 4085 |
| 119 | Ga0068851_10151867 | 3300005834 | Bacteria | 1266 |
| 120 | Ga0068851_10176881 | 3300005834 | Bacteria | 1180 |
| 121 | Ga0068870_10124133 | 3300005840 | Bacteria | 1491 |
| 122 | Ga0068863_100004895 | 3300005841 | Bacteria | 13197 |
| 123 | Ga0068863_100184990 | 3300005841 | Bacteria | 2001 |
| 124 | Ga0068863_100441190 | 3300005841 | Bacteria | 1277 |
| 125 | Ga0068858_100129556 | 3300005842 | Bacteria | 2364 |
| 126 | Ga0068860_100034119 | 3300005843 | Bacteria | 4880 |
| 127 | Ga0068862_100135614 | 3300005844 | Bacteria | 2181 |
| 128 | Ga0081540_1025908 | 3300005983 | Bacteria | 3361 |
| 129 | Ga0070717_10207124 | 3300006028 | Bacteria | 1720 |
| 130 | Ga0075364_10093909 | 3300006051 | Bacteria | 1992 |
| 131 | Ga0075364_10155914 | 3300006051 | Unclassified | 1540 |
| 132 | Ga0070716_100326977 | 3300006173 | Bacteria | 1076 |
| 133 | Ga0075362_10075384 | 3300006177 | Bacteria | 1547 |
| 134 | Ga0075367_10087059 | 3300006178 | Bacteria | 1897 |
| 135 | Ga0075366_10147545 | 3300006195 | Bacteria | 1424 |
| 136 | Ga0075366_10354479 | 3300006195 | Bacteria | 901 |
| 137 | Ga0097621_100161484 | 3300006237 | Bacteria | 1926 |
| 138 | Ga0097621_100570230 | 3300006237 | Bacteria | 1032 |
| 139 | Ga0068871_100232668 | 3300006358 | Bacteria | 1600 |
| 140 | Ga0068871_100234297 | 3300006358 | Bacteria | 1594 |
| 141 | Ga0068871_100367475 | 3300006358 | Bacteria | 1275 |
| 142 | Ga0068871_100671846 | 3300006358 | Unclassified | 947 |
| 143 | Ga0075428_100028395 | 3300006844 | Bacteria | 6189 |
| 144 | Ga0075431_100017138 | 3300006847 | Bacteria | 7365 |
| 145 | Ga0075431_100392651 | 3300006847 | Bacteria | 1390 |
| 146 | Ga0075433_10015394 | 3300006852 | Bacteria | 6272 |
| 147 | Ga0075433_10224847 | 3300006852 | Bacteria | 1667 |
| 148 | Ga0075433_10240777 | 3300006852 | Bacteria | 1606 |
| 149 | Ga0075434_100091795 | 3300006871 | Bacteria | 3038 |
| 150 | Ga0075434_100137884 | 3300006871 | Bacteria | 2459 |
| 151 | Ga0075434_100310522 | 3300006871 | Bacteria | 1597 |
| 152 | Ga0075434_100737499 | 3300006871 | Unclassified | 1002 |
| 153 | Ga0075429_100356766 | 3300006880 | Bacteria | 1280 |
| 154 | Ga0068865_100438093 | 3300006881 | Bacteria | 1078 |
| 155 | Ga0097620_100330250 | 3300006931 | Bacteria | 1619 |
| 156 | Ga0097620_101175865 | 3300006931 | Bacteria | 844 |
| 157 | Ga0075435_100347094 | 3300007076 | Bacteria | 1272 |
| 158 | Ga0075435_100361130 | 3300007076 | Bacteria | 1246 |
| 159 | Ga0075435_100526087 | 3300007076 | Bacteria | 1023 |
| 160 | Ga0099794_10010503 | 3300007265 | Bacteria | 3933 |
| 161 | Ga0105240_10035211 | 3300009093 | Bacteria | 6453 |
| 162 | Ga0105240_10166641 | 3300009093 | Bacteria | 2613 |
| 163 | Ga0105240_10231444 | 3300009093 | Bacteria | 2147 |
| 164 | Ga0105240_10289002 | 3300009093 | Bacteria | 1880 |
| 165 | Ga0105240_10377097 | 3300009093 | Bacteria | 1602 |
| 166 | Ga0105240_10564349 | 3300009093 | Bacteria | 1258 |
| 167 | Ga0105240_10674134 | 3300009093 | Unclassified | 1131 |
| 168 | Ga0111539_10068617 | 3300009094 | Bacteria | 4186 |
| 169 | Ga0111539_10279910 | 3300009094 | Bacteria | 1941 |
| 170 | Ga0105245_10059159 | 3300009098 | Bacteria | 3450 |
| 171 | Ga0105245_10096380 | 3300009098 | Bacteria | 2730 |
| 172 | Ga0105245_10285487 | 3300009098 | Bacteria | 1615 |
| 173 | Ga0114129_10001176 | 3300009147 | Bacteria | 34702 |
| 174 | Ga0114129_10073669 | 3300009147 | Bacteria | 4757 |
| 175 | Ga0114129_10727649 | 3300009147 | Bacteria | 1273 |
| 176 | Ga0105243_10191883 | 3300009148 | Bacteria | 1785 |
| 177 | Ga0105241_10005239 | 3300009174 | Bacteria | 9578 |
| 178 | Ga0105241_10015546 | 3300009174 | Bacteria | 5578 |
| 179 | Ga0105241_10036994 | 3300009174 | Bacteria | 3675 |
| 180 | Ga0105241_10097450 | 3300009174 | Bacteria | 2332 |
| 181 | Ga0105241_10365390 | 3300009174 | Bacteria | 1257 |
| 182 | Ga0105241_10484985 | 3300009174 | Bacteria | 1099 |
| 183 | Ga0105241_10758095 | 3300009174 | Bacteria | 891 |
| 184 | Ga0105242_10009248 | 3300009176 | Bacteria | 7562 |
| 185 | Ga0105242_10374164 | 3300009176 | Bacteria | 1322 |
| 186 | Ga0105242_10733492 | 3300009176 | Unclassified | 970 |
| 187 | Ga0105242_11286942 | 3300009176 | Bacteria | 754 |
| 188 | Ga0105248_10020605 | 3300009177 | Bacteria | 7308 |
| 189 | Ga0105248_10266706 | 3300009177 | Bacteria | 1927 |
| 190 | Ga0105248_10284800 | 3300009177 | Bacteria | 1861 |
| 191 | Ga0105248_10520022 | 3300009177 | Bacteria | 1342 |
| 192 | Ga0105237_10002146 | 3300009545 | Bacteria | 24848 |
| 193 | Ga0105237_10187479 | 3300009545 | Bacteria | 2068 |
| 194 | Ga0105237_10309093 | 3300009545 | Bacteria | 1584 |
| 195 | Ga0105237_10313197 | 3300009545 | Unclassified | 1573 |
| 196 | Ga0105237_10350985 | 3300009545 | Bacteria | 1479 |
| 197 | Ga0105238_10009034 | 3300009551 | Bacteria | 9971 |
| 198 | Ga0105238_10009438 | 3300009551 | Bacteria | 9767 |
| 199 | Ga0105238_10048934 | 3300009551 | Bacteria | 4259 |
| 200 | Ga0105238_10092243 | 3300009551 | Bacteria | 3016 |
| 201 | Ga0105238_10219823 | 3300009551 | Bacteria | 1876 |
| 202 | Ga0105238_10309940 | 3300009551 | Bacteria | 1563 |
| 203 | Ga0105238_10554736 | 3300009551 | Bacteria | 1154 |
| 204 | Ga0105249_10417750 | 3300009553 | Bacteria | 1374 |
| 205 | Ga0105249_10552070 | 3300009553 | Bacteria | 1203 |
| 206 | Ga0105249_10725112 | 3300009553 | Bacteria | 1055 |
| 207 | Ga0105030_100615 | 3300009987 | Bacteria | 3183 |
| 208 | Ga0105239_10036900 | 3300010375 | Bacteria | 5362 |
| 209 | Ga0105239_10088739 | 3300010375 | Bacteria | 3410 |
| 210 | Ga0105239_10103428 | 3300010375 | Bacteria | 3152 |
| 211 | Ga0105239_10165491 | 3300010375 | Bacteria | 2473 |
| 212 | Ga0105239_10756739 | 3300010375 | Bacteria | 1112 |
| 213 | Ga0105239_11024179 | 3300010375 | Bacteria | 949 |
| 214 | Ga0105246_10042177 | 3300011119 | Bacteria | 3089 |
| 215 | Ga0157373_10080112 | 3300013100 | Bacteria | 2303 |
| 216 | Ga0157371_10118730 | 3300013102 | Bacteria | 1880 |
| 217 | Ga0157371_10167464 | 3300013102 | Bacteria | 1570 |
| 218 | Ga0157370_10063842 | 3300013104 | Bacteria | 3487 |
| 219 | Ga0157370_10130248 | 3300013104 | Bacteria | 2347 |
| 220 | Ga0157370_10187390 | 3300013104 | Bacteria | 1921 |
| 221 | Ga0157369_10000680 | 3300013105 | Bacteria | 43893 |
| 222 | Ga0157369_10002989 | 3300013105 | Bacteria | 20239 |
| 223 | Ga0157369_10008673 | 3300013105 | Bacteria | 11655 |
| 224 | Ga0157374_10199729 | 3300013296 | Bacteria | 1958 |
| 225 | Ga0157378_10000064 | 3300013297 | Bacteria | 93614 |
| 226 | Ga0157378_10031796 | 3300013297 | Bacteria | 4661 |
| 227 | Ga0157378_10299315 | 3300013297 | Bacteria | 1556 |
| 228 | Ga0163162_10000004 | 3300013306 | Bacteria | 505593 |
| 229 | Ga0163162_10007030 | 3300013306 | Bacteria | 10914 |
| 230 | Ga0163162_10018592 | 3300013306 | Bacteria | 6809 |
| 231 | Ga0163162_10092133 | 3300013306 | Bacteria | 3114 |
| 232 | Ga0163162_10115075 | 3300013306 | Bacteria | 2789 |
| 233 | Ga0163162_10319677 | 3300013306 | Bacteria | 1685 |
| 234 | Ga0157372_10000277 | 3300013307 | Bacteria | 56848 |
| 235 | Ga0157372_10165705 | 3300013307 | Bacteria | 2555 |
| 236 | Ga0157372_10393264 | 3300013307 | Bacteria | 1615 |
| 237 | Ga0157372_10536790 | 3300013307 | Bacteria | 1363 |
| 238 | Ga0157372_10611392 | 3300013307 | Bacteria | 1270 |
| 239 | Ga0157375_10002438 | 3300013308 | Bacteria | 16095 |
| 240 | Ga0157375_10273146 | 3300013308 | Bacteria | 1853 |
| 241 | Ga0157375_10694708 | 3300013308 | Bacteria | 1171 |
| 242 | Ga0157375_11002925 | 3300013308 | Bacteria | 975 |
| 243 | Ga0157375_11173084 | 3300013308 | Bacteria | 900 |
| 244 | Ga0163163_10000105 | 3300014325 | Bacteria | 89594 |
| 245 | Ga0163163_10000927 | 3300014325 | Bacteria | 24855 |
| 246 | Ga0163163_10098967 | 3300014325 | Bacteria | 2938 |
| 247 | Ga0163163_10244522 | 3300014325 | Bacteria | 1844 |
| 248 | Ga0163163_10283086 | 3300014325 | Bacteria | 1710 |
| 249 | Ga0163163_10504616 | 3300014325 | Bacteria | 1272 |
| 250 | Ga0157380_10254224 | 3300014326 | Bacteria | 1592 |
| 251 | Ga0182008_10128920 | 3300014497 | Bacteria | 1261 |
| 252 | Ga0157377_10354373 | 3300014745 | Bacteria | 986 |
| 253 | Ga0157379_10004161 | 3300014968 | Bacteria | 12351 |
| 254 | Ga0157379_10019588 | 3300014968 | Bacteria | 5977 |
| 255 | Ga0157376_10000933 | 3300014969 | Bacteria | 18990 |
| 256 | Ga0157376_10001256 | 3300014969 | Bacteria | 16697 |
| 257 | Ga0157376_10677226 | 3300014969 | Bacteria | 1034 |
| 258 | Ga0182007_10099949 | 3300015262 | Bacteria | 960 |
| 259 | Ga0163161_10232231 | 3300017792 | Bacteria | 1432 |
| 260 | Ga0206349_1918908 | 3300020075 | Bacteria | 729 |
| 261 | Ga0206355_1156896 | 3300020076 | Bacteria | 693 |
| 262 | Ga0206352_10848697 | 3300020078 | Bacteria | 729 |
| 263 | Ga0213872_10002413 | 3300021361 | Bacteria | 11019 |
| 264 | Ga0213872_10068050 | 3300021361 | Bacteria | 1607 |
| 265 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 266 | Ga0209436_111654 | 3300025208 | Bacteria | 1533 |
| 267 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 268 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 269 | Ga0207425_1005696 | 3300025245 | Bacteria | 3512 |
| 270 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 271 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 272 | Ga0209677_100096 | 3300025253 | Bacteria | 99089 |
| 273 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 274 | Ga0209233_1011340 | 3300025261 | Bacteria | 2629 |
| 275 | Ga0209565_1001008 | 3300025263 | Bacteria | 14453 |
| 276 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 277 | Ga0209675_1003887 | 3300025291 | Bacteria | 6873 |
| 278 | Ga0209758_1053869 | 3300025297 | Bacteria | 1378 |
| 279 | Ga0209050_1002656 | 3300025298 | Bacteria | 14623 |
| 280 | Ga0209256_1014087 | 3300025299 | Bacteria | 2910 |
| 281 | Ga0207426_1000242 | 3300025302 | Bacteria | 122839 |
| 282 | Ga0207656_10108680 | 3300025321 | Bacteria | 1279 |
| 283 | Ga0207713_1055708 | 3300025735 | Bacteria | 1541 |
| 284 | Ga0207642_10260893 | 3300025899 | Bacteria | 988 |
| 285 | Ga0207688_10025745 | 3300025901 | Bacteria | 3233 |
| 286 | Ga0207680_10000577 | 3300025903 | Bacteria | 17317 |
| 287 | Ga0207680_10225922 | 3300025903 | Bacteria | 1285 |
| 288 | Ga0207680_10298062 | 3300025903 | Bacteria | 1123 |
| 289 | Ga0207647_10001783 | 3300025904 | Bacteria | 16497 |
| 290 | Ga0207647_10017551 | 3300025904 | Bacteria | 4864 |
| 291 | Ga0207647_10040973 | 3300025904 | Bacteria | 2914 |
| 292 | Ga0207647_10361647 | 3300025904 | Bacteria | 821 |
| 293 | Ga0207699_10012445 | 3300025906 | Bacteria | 4329 |
| 294 | Ga0207645_10461123 | 3300025907 | Bacteria | 858 |
| 295 | Ga0207705_10098841 | 3300025909 | Bacteria | 2145 |
| 296 | Ga0207705_10302535 | 3300025909 | Bacteria | 1227 |
| 297 | Ga0207654_10000432 | 3300025911 | Bacteria | 24010 |
| 298 | Ga0207654_10012866 | 3300025911 | Bacteria | 4293 |
| 299 | Ga0207654_10154827 | 3300025911 | Bacteria | 1475 |
| 300 | Ga0207695_10000920 | 3300025913 | Bacteria | 52662 |
| 301 | Ga0207695_10045191 | 3300025913 | Bacteria | 4678 |
| 302 | Ga0207695_10149926 | 3300025913 | Bacteria | 2272 |
| 303 | Ga0207695_10283230 | 3300025913 | Bacteria | 1551 |
| 304 | Ga0207695_10851444 | 3300025913 | Bacteria | 792 |
| 305 | Ga0207671_10001068 | 3300025914 | Bacteria | 33289 |
| 306 | Ga0207671_10001915 | 3300025914 | Bacteria | 23107 |
| 307 | Ga0207671_10027160 | 3300025914 | Bacteria | 4281 |
| 308 | Ga0207671_10647953 | 3300025914 | Bacteria | 841 |
| 309 | Ga0207693_10062617 | 3300025915 | Bacteria | 2914 |
| 310 | Ga0207663_10079962 | 3300025916 | Bacteria | 2136 |
| 311 | Ga0207660_10224020 | 3300025917 | Bacteria | 1477 |
| 312 | Ga0207662_10316384 | 3300025918 | Bacteria | 1041 |
| 313 | Ga0207657_10012705 | 3300025919 | Bacteria | 8296 |
| 314 | Ga0207657_10033930 | 3300025919 | Bacteria | 4595 |
| 315 | Ga0207657_10242576 | 3300025919 | Bacteria | 1438 |
| 316 | Ga0207649_10002515 | 3300025920 | Bacteria | 10221 |
| 317 | Ga0207649_10030427 | 3300025920 | Bacteria | 3197 |
| 318 | Ga0207652_10185116 | 3300025921 | Bacteria | 1872 |
| 319 | Ga0207646_10286788 | 3300025922 | Bacteria | 1488 |
| 320 | Ga0207694_10004006 | 3300025924 | Bacteria | 11612 |
| 321 | Ga0207694_10107784 | 3300025924 | Bacteria | 2214 |
| 322 | Ga0207694_10220965 | 3300025924 | Bacteria | 1545 |
| 323 | Ga0207694_10273723 | 3300025924 | Bacteria | 1385 |
| 324 | Ga0207694_10368246 | 3300025924 | Bacteria | 1191 |
| 325 | Ga0207694_10418347 | 3300025924 | Bacteria | 1116 |
| 326 | Ga0207650_10022276 | 3300025925 | Bacteria | 4483 |
| 327 | Ga0207659_10204089 | 3300025926 | Bacteria | 1580 |
| 328 | Ga0207687_10243292 | 3300025927 | Bacteria | 1427 |
| 329 | Ga0207687_10565602 | 3300025927 | Bacteria | 955 |
| 330 | Ga0207700_10048811 | 3300025928 | Bacteria | 3145 |
| 331 | Ga0207700_10569968 | 3300025928 | Bacteria | 1006 |
| 332 | Ga0207664_10016026 | 3300025929 | Bacteria | 5459 |
| 333 | Ga0207644_10181925 | 3300025931 | Bacteria | 1648 |
| 334 | Ga0207644_10318394 | 3300025931 | Bacteria | 1257 |
| 335 | Ga0207690_10001436 | 3300025932 | Bacteria | 14907 |
| 336 | Ga0207690_10011538 | 3300025932 | Bacteria | 5278 |
| 337 | Ga0207706_10045635 | 3300025933 | Bacteria | 3882 |
| 338 | Ga0207706_10073189 | 3300025933 | Bacteria | 3013 |
| 339 | Ga0207686_10002538 | 3300025934 | Bacteria | 9913 |
| 340 | Ga0207686_10431317 | 3300025934 | Bacteria | 1010 |
| 341 | Ga0207709_10072326 | 3300025935 | Bacteria | 2193 |
| 342 | Ga0207669_10164287 | 3300025937 | Unclassified | 1572 |
| 343 | Ga0207704_10433007 | 3300025938 | Bacteria | 1046 |
| 344 | Ga0207665_10027516 | 3300025939 | Bacteria | 3756 |
| 345 | Ga0207691_10023986 | 3300025940 | Bacteria | 5739 |
| 346 | Ga0207711_10044392 | 3300025941 | Bacteria | 3794 |
| 347 | Ga0207711_10331861 | 3300025941 | Bacteria | 1407 |
| 348 | Ga0207711_10610212 | 3300025941 | Bacteria | 1018 |
| 349 | Ga0207711_11111474 | 3300025941 | Bacteria | 731 |
| 350 | Ga0207689_10193233 | 3300025942 | Bacteria | 1679 |
| 351 | Ga0207689_10317396 | 3300025942 | Bacteria | 1293 |
| 352 | Ga0207689_10662429 | 3300025942 | Bacteria | 880 |
| 353 | Ga0207661_10348726 | 3300025944 | Bacteria | 1335 |
| 354 | Ga0207679_10065498 | 3300025945 | Bacteria | 2719 |
| 355 | Ga0207679_10139158 | 3300025945 | Bacteria | 1960 |
| 356 | Ga0207667_10037846 | 3300025949 | Bacteria | 5157 |
| 357 | Ga0207667_10169632 | 3300025949 | Bacteria | 2243 |
| 358 | Ga0207667_10506443 | 3300025949 | Bacteria | 1224 |
| 359 | Ga0207667_11131722 | 3300025949 | Bacteria | 765 |
| 360 | Ga0207651_10021021 | 3300025960 | Bacteria | 3955 |
| 361 | Ga0207640_10127557 | 3300025981 | Bacteria | 1834 |
| 362 | Ga0207640_10628997 | 3300025981 | Bacteria | 912 |
| 363 | Ga0207658_10052377 | 3300025986 | Bacteria | 3011 |
| 364 | Ga0207677_10816423 | 3300026023 | Bacteria | 836 |
| 365 | Ga0207703_10046638 | 3300026035 | Bacteria | 3491 |
| 366 | Ga0207703_10074159 | 3300026035 | Bacteria | 2817 |
| 367 | Ga0207703_10716986 | 3300026035 | Bacteria | 952 |
| 368 | Ga0207639_10015303 | 3300026041 | Bacteria | 5409 |
| 369 | Ga0207639_10039080 | 3300026041 | Bacteria | 3533 |
| 370 | Ga0207639_10040521 | 3300026041 | Bacteria | 3477 |
| 371 | Ga0207639_10045893 | 3300026041 | Bacteria | 3294 |
| 372 | Ga0207639_10256441 | 3300026041 | Bacteria | 1527 |
| 373 | Ga0207639_10372876 | 3300026041 | Bacteria | 1280 |
| 374 | Ga0207639_10802394 | 3300026041 | Bacteria | 877 |
| 375 | Ga0207678_10049131 | 3300026067 | Bacteria | 3645 |
| 376 | Ga0207702_10005995 | 3300026078 | Bacteria | 10550 |
| 377 | Ga0207702_11024167 | 3300026078 | Bacteria | 819 |
| 378 | Ga0207641_10017105 | 3300026088 | Bacteria | 5932 |
| 379 | Ga0207641_10088121 | 3300026088 | Bacteria | 2709 |
| 380 | Ga0207641_10252434 | 3300026088 | Bacteria | 1648 |
| 381 | Ga0207648_10037439 | 3300026089 | Bacteria | 4273 |
| 382 | Ga0207648_10566830 | 3300026089 | Unclassified | 1044 |
| 383 | Ga0207676_10017029 | 3300026095 | Bacteria | 5265 |
| 384 | Ga0207676_10138511 | 3300026095 | Bacteria | 2080 |
| 385 | Ga0207674_10000271 | 3300026116 | Bacteria | 65366 |
| 386 | Ga0207674_10008203 | 3300026116 | Bacteria | 12103 |
| 387 | Ga0207674_10150836 | 3300026116 | Bacteria | 2282 |
| 388 | Ga0207675_100018731 | 3300026118 | Bacteria | 6462 |
| 389 | Ga0207683_10100792 | 3300026121 | Bacteria | 2578 |
| 390 | Ga0207698_10012482 | 3300026142 | Bacteria | 5561 |
| 391 | Ga0207698_10060920 | 3300026142 | Bacteria | 2937 |
| 392 | Ga0207698_10075803 | 3300026142 | Bacteria | 2690 |
| 393 | Ga0207698_10124950 | 3300026142 | Bacteria | 2186 |
| 394 | Ga0207698_11051845 | 3300026142 | Bacteria | 826 |
| 395 | Ga0268266_10001450 | 3300028379 | Bacteria | 28199 |
| 396 | Ga0268266_10003907 | 3300028379 | Bacteria | 14482 |
| 397 | Ga0268266_10012796 | 3300028379 | Bacteria | 7248 |
| 398 | Ga0268266_10296941 | 3300028379 | Bacteria | 1506 |
| 399 | Ga0268265_10091107 | 3300028380 | Bacteria | 2437 |
| 400 | Ga0268265_10570555 | 3300028380 | Bacteria | 1077 |
| 401 | Ga0268264_10009270 | 3300028381 | Bacteria | 8151 |
| 402 | Ga0268264_10037579 | 3300028381 | Bacteria | 3993 |
| 403 | Ga0268264_10999311 | 3300028381 | Bacteria | 843 |
| 404 | Ga0307515_10513481 | 3300028794 | Bacteria | 808 |
| 405 | Ga0265338_10045176 | 3300028800 | Bacteria | 4054 |
| 406 | Ga0265332_10196800 | 3300031238 | Bacteria | 838 |
| 407 | Ga0265340_10006688 | 3300031247 | Bacteria | 6317 |
| 408 | Ga0265340_10033223 | 3300031247 | Bacteria | 2570 |
| 409 | Ga0265340_10145252 | 3300031247 | Bacteria | 1083 |
| 410 | Ga0265331_10040995 | 3300031250 | Bacteria | 2251 |
| 411 | Ga0265327_10000589 | 3300031251 | Bacteria | 60929 |
| 412 | Ga0307513_10138812 | 3300031456 | Bacteria | 2361 |
| 413 | Ga0307513_10489912 | 3300031456 | Bacteria | 948 |
| 414 | Ga0307513_10494807 | 3300031456 | Bacteria | 941 |
| 415 | Ga0307408_100282140 | 3300031548 | Bacteria | 1384 |
| 416 | Ga0265313_10074665 | 3300031595 | Bacteria | 1554 |
| 417 | Ga0307508_10018556 | 3300031616 | Bacteria | 6322 |
| 418 | Ga0265314_10128459 | 3300031711 | Bacteria | 1584 |
| 419 | Ga0307405_10390503 | 3300031731 | Bacteria | 1086 |
| 420 | Ga0307413_10170935 | 3300031824 | Bacteria | 1538 |
| 421 | Ga0307413_10231159 | 3300031824 | Bacteria | 1358 |
| 422 | Ga0307410_10001801 | 3300031852 | Bacteria | 9933 |
| 423 | Ga0307406_10122792 | 3300031901 | Bacteria | 1809 |
| 424 | Ga0307407_10207383 | 3300031903 | Bacteria | 1317 |
| 425 | Ga0307412_10164424 | 3300031911 | Bacteria | 1653 |
| 426 | Ga0307412_10427591 | 3300031911 | Bacteria | 1085 |
| 427 | Ga0307409_100008147 | 3300031995 | Bacteria | 6332 |
| 428 | Ga0307416_100006649 | 3300032002 | Bacteria | 7256 |
| 429 | Ga0307416_100100479 | 3300032002 | Bacteria | 2516 |
| 430 | Ga0307414_10107132 | 3300032004 | Bacteria | 2117 |
| 431 | Ga0307411_10075330 | 3300032005 | Bacteria | 2303 |
| 432 | Ga0307415_100050041 | 3300032126 | Bacteria | 2829 |
| 433 | Ga0307415_100972468 | 3300032126 | Bacteria | 787 |
| 434 | Ga0307415_100981340 | 3300032126 | Bacteria | 784 |
| 435 | Ga0307510_10000025 | 3300033180 | Bacteria | 132169 |
| 436 | Ga0373923_0302380 | 3300035111 | Bacteria | 757 |
| 437 | Ga0373936_0078048 | 3300035113 | Bacteria | 1374 |
| 438 | Ga0373937_0057350 | 3300036401 | Bacteria | 3577 |
| 439 | Ga0373937_1012061 | 3300036401 | Bacteria | 780 |
| 440 | Ga0395899_0339620 | 3300037312 | Bacteria | 1007 |
| 441 | Ga0395900_0493053 | 3300037418 | Bacteria | 1176 |
| 442 | Ga0395900_0759110 | 3300037418 | Bacteria | 900 |
| 443 | Ga0395898_0012654 | 3300037466 | Bacteria | 8722 |
| 444 | Ga0395905_0010861 | 3300037471 | Bacteria | 8821 |
| 445 | Ga0395905_0039569 | 3300037471 | Bacteria | 4423 |
| 446 | Ga0395901_0002015 | 3300038443 | Bacteria | 20901 |
| 447 | Ga0436365_0856036 | 3300039437 | Bacteria | 1096 |
| 448 | Ga0436360_1341053 | 3300039438 | Bacteria | 3245 |
| 449 | Ga0436361_0108001 | 3300039447 | Bacteria | 112244 |
| 450 | Ga0436361_0667408 | 3300039447 | Bacteria | 1724 |
| 451 | Ga0436361_0808386 | 3300039447 | Bacteria | 2615 |
| 452 | Ga0436362_0554176 | 3300039453 | Bacteria | 728 |
| 453 | Ga0439439_0027398 | 3300041406 | Bacteria | 1440 |
| 454 | Ga0439439_0029413 | 3300041406 | Bacteria | 1394 |
| 455 | Ga0451795_0568060 | 3300041456 | Bacteria | 1034 |
| 456 | Ga0451802_1684582 | 3300041460 | Bacteria | 1091 |
| 457 | Ga0451804_0390599 | 3300041463 | Bacteria | 910 |
| 458 | Ga0451833_1175627 | 3300041491 | Bacteria | 705 |
| 459 | Ga0451847_0920145 | 3300041503 | Bacteria | 707 |
| 460 | Ga0451849_1070750 | 3300041505 | Bacteria | 1506 |
| 461 | Ga0451853_1431401 | 3300041512 | Bacteria | 1594 |
| 462 | Ga0439455_0013240 | 3300042012 | Bacteria | 1865 |
| 463 | Ga0439462_0088863 | 3300042015 | Bacteria | 847 |
| 464 | Ga0450898_021201 | 3300042134 | Bacteria | 1143 |
| 465 | Ga0439446_0007304 | 3300042156 | Bacteria | 2903 |
| 466 | Ga0439446_0008112 | 3300042156 | Bacteria | 2779 |
| 467 | Ga0450908_004216 | 3300042184 | Bacteria | 2781 |
| 468 | Ga0439434_0000842 | 3300042435 | Bacteria | 8840 |
| 469 | Ga0451577_0203138 | 3300042876 | Bacteria | 1789 |
| 470 | Ga0466969_0007183 | 3300044656 | Bacteria | 5924 |
| 471 | Ga0466965_0068166 | 3300044683 | Bacteria | 1786 |
| 472 | Ga0466966_0008473 | 3300044684 | Bacteria | 6807 |
| 473 | Ga0466961_0000034 | 3300044693 | Bacteria | 84993 |
| 474 | Ga0466964_0266151 | 3300044706 | Bacteria | 851 |
| 475 | Ga0466957_0281194 | 3300044842 | Bacteria | 1114 |
| 476 | Ga0466960_0020410 | 3300044901 | Bacteria | 2934 |
| 477 | Ga0466959_0116595 | 3300045049 | Bacteria | 1901 |
| 478 | Ga0451576_0035746 | 3300045051 | Bacteria | 5269 |
| 479 | Ga0451576_0410082 | 3300045051 | Bacteria | 1421 |
| 480 | Ga0466958_0007106 | 3300045836 | Bacteria | 6131 |
| 481 | Ga0466967_0859285 | 3300045976 | Bacteria | 902 |
| 482 | Ga0495591_000604 | 3300046458 | Bacteria | 27206 |
| 483 | Ga0495638_0033535 | 3300046460 | Bacteria | 3284 |
| 484 | Ga0495638_0093041 | 3300046460 | Bacteria | 1814 |
| 485 | Ga0495582_0066129 | 3300046473 | Bacteria | 1997 |
| 486 | Ga0495639_0025058 | 3300046475 | Bacteria | 2629 |
| 487 | Ga0495632_0010313 | 3300046519 | Bacteria | 5544 |
| 488 | Ga0495643_0073124 | 3300046522 | Bacteria | 1797 |
| 489 | Ga0495621_0167334 | 3300046539 | Bacteria | 872 |
| 490 | Ga0495645_0025960 | 3300046543 | Bacteria | 4253 |
| 491 | Ga0495661_0000840 | 3300046665 | Bacteria | 28644 |
| 492 | Ga0495661_0033244 | 3300046665 | Eukaryota | 3254 |
| 493 | Ga0495588_0028521 | 3300046674 | Bacteria | 2794 |
| 494 | Ga0495646_0186462 | 3300046680 | Bacteria | 1136 |
| 495 | Ga0495581_0265721 | 3300047315 | Bacteria | 1003 |
| 496 | Ga0495672_0052289 | 3300047320 | Bacteria | 2400 |
| 497 | Ga0495684_0569725 | 3300047471 | Bacteria | 768 |
| 498 | Ga0495686_0030984 | 3300047472 | Bacteria | 3471 |
| 499 | Ga0495615_0021045 | 3300048090 | Bacteria | 1468 |
| 500 | Ga0496102_0193343 | 3300048905 | Bacteria | 1917 |
| 501 | Ga0496102_0633901 | 3300048905 | Bacteria | 992 |
| 502 | Ga0496103_0256854 | 3300048906 | Unclassified | 1124 |
| 503 | Ga0496103_0521837 | 3300048906 | Bacteria | 759 |
| 504 | Ga0496104_0000005 | 3300048907 | Bacteria | 620360 |
| 505 | Ga0496105_0000016 | 3300048908 | Bacteria | 212909 |
| 506 | Ga0496105_0503275 | 3300048908 | Unclassified | 951 |
| 507 | Ga0496107_0087734 | 3300048910 | Bacteria | 2271 |
| 508 | Ga0496114_0840564 | 3300048917 | Bacteria | 798 |
| 509 | Ga0496115_0273394 | 3300048918 | Bacteria | 1388 |
| 510 | Ga0496117_0000077 | 3300048920 | Bacteria | 227735 |
| 511 | Ga0496118_0000026 | 3300048921 | Bacteria | 375725 |
| 512 | Ga0496119_0013115 | 3300048922 | Bacteria | 6637 |
| 513 | Ga0496120_0000648 | 3300048923 | Bacteria | 51270 |
| 514 | Ga0496120_0015330 | 3300048923 | Bacteria | 5061 |
| 515 | Ga0496120_0035504 | 3300048923 | Eukaryota | 2977 |
| 516 | Ga0496120_0216298 | 3300048923 | Bacteria | 918 |
| 517 | Ga0496121_0051696 | 3300048924 | Bacteria | 3458 |
| 518 | Ga0496124_0030697 | 3300048927 | Bacteria | 4765 |
| 519 | Ga0496125_0020338 | 3300048928 | Bacteria | 6229 |
| 520 | Ga0496126_0028834 | 3300048929 | Bacteria | 5282 |
| 521 | Ga0501315_029955 | 3300049531 | Bacteria | 779 |
| 522 | Ga0501032_0208358 | 3300049569 | Bacteria | 1275 |
| 523 | Ga0501036_0411919 | 3300049572 | Bacteria | 1127 |
| 524 | Ga0501037_0031570 | 3300049573 | Bacteria | 3911 |
| 525 | Ga0501037_0293802 | 3300049573 | Bacteria | 1130 |
| 526 | Ga0501038_0044719 | 3300049574 | Bacteria | 3846 |
| 527 | Ga0501038_0154363 | 3300049574 | Bacteria | 1870 |
| 528 | Ga0501038_0364837 | 3300049574 | Bacteria | 1123 |
| 529 | Ga0501039_0154491 | 3300049575 | Bacteria | 1803 |
| 530 | Ga0501040_0167047 | 3300049576 | Bacteria | 1557 |
| 531 | Ga0501043_0552116 | 3300049579 | Bacteria | 856 |
| 532 | Ga0501046_0149851 | 3300049580 | Bacteria | 1760 |
| 533 | Ga0501046_0169436 | 3300049580 | Bacteria | 1639 |
| 534 | Ga0501047_0002342 | 3300049581 | Bacteria | 18113 |
| 535 | Ga0501047_0031512 | 3300049581 | Bacteria | 5113 |
| 536 | Ga0501047_0275407 | 3300049581 | Bacteria | 1528 |
| 537 | Ga0501067_0115396 | 3300049583 | Bacteria | 1494 |
| 538 | Ga0501068_0050151 | 3300049584 | Bacteria | 2523 |
| 539 | Ga0501068_0397373 | 3300049584 | Bacteria | 888 |
| 540 | Ga0501070_0009050 | 3300049586 | Bacteria | 8423 |
| 541 | Ga0501073_0001667 | 3300049589 | Bacteria | 16449 |
| 542 | Ga0501073_0015830 | 3300049589 | Bacteria | 5464 |
| 543 | Ga0501073_0048026 | 3300049589 | Bacteria | 2998 |
| 544 | Ga0501074_0026584 | 3300049590 | Bacteria | 4197 |
| 545 | Ga0501080_0003532 | 3300049742 | Bacteria | 13776 |
| 546 | Ga0501080_0012786 | 3300049742 | Bacteria | 7700 |
| 547 | Ga0501035_0061927 | 3300049822 | Bacteria | 3329 |
| 548 | Ga0501035_0402271 | 3300049822 | Bacteria | 1139 |
| 549 | Ga0501044_0004292 | 3300049823 | Bacteria | 15988 |
| 550 | Ga0501045_0142827 | 3300049824 | Bacteria | 1780 |
| 551 | nmdc:mga03683_27152_c1 | 3300050489 | Bacteria | 2264 |
| 552 | nmdc:mga00v17_244438_c1 | 3300050491 | Bacteria | 1164 |
| 553 | nmdc:mga00v17_61050_c1 | 3300050491 | Unclassified | 2316 |
| 554 | nmdc:mga05p37_621882_c1 | 3300050507 | Bacteria | 1215 |
| 555 | nmdc:mga05p37_6324_c1 | 3300050507 | Bacteria | 13950 |
| 556 | nmdc:mga05p37_77261_c1 | 3300050507 | Bacteria | 4099 |
| 557 | nmdc:mga09592_287347_c1 | 3300050508 | Bacteria | 1426 |
| 558 | nmdc:mga06r32_209371_c1 | 3300050510 | Bacteria | 1938 |
| 559 | nmdc:mga06r32_549937_c1 | 3300050510 | Unclassified | 1128 |
| 560 | nmdc:mga0n895_128628_c1 | 3300050512 | Bacteria | 2557 |
| 561 | nmdc:mga0n895_275690_c1 | 3300050512 | Bacteria | 1706 |
| 562 | nmdc:mga0n895_329498_c1 | 3300050512 | Bacteria | 1547 |
| 563 | nmdc:mga0n895_69171_c1 | 3300050512 | Bacteria | 3497 |
| 564 | nmdc:mga0rr50_318147_c1 | 3300050513 | Bacteria | 1304 |
| 565 | nmdc:mga0rr50_417877_c1 | 3300050513 | Bacteria | 1134 |
| 566 | nmdc:mga0rr50_735952_c1 | 3300050513 | Bacteria | 842 |
| 567 | nmdc:mga0a205_4732_c1 | 3300050515 | Bacteria | 12224 |
| 568 | nmdc:mga0a205_7668_c1 | 3300050515 | Bacteria | 9791 |
| 569 | Ga0500643_000032 | 3300053087 | Bacteria | 200350 |
| 570 | Ga0500643_000169 | 3300053087 | Bacteria | 64699 |
| 571 | Ga0500644_0038746 | 3300053088 | Bacteria | 1567 |
| 572 | Ga0500566_0014073 | 3300053094 | Bacteria | 4702 |
| 573 | Ga0500641_0029252 | 3300053096 | Bacteria | 2158 |
| 574 | Ga0500555_006629 | 3300053103 | Bacteria | 3291 |
| 575 | Ga0500555_049426 | 3300053103 | Bacteria | 1153 |
| 576 | Ga0500592_023369 | 3300053116 | Bacteria | 997 |
| 577 | Ga0500593_000998 | 3300053117 | Bacteria | 10283 |
| 578 | Ga0500595_035915 | 3300053119 | Bacteria | 1628 |
| 579 | Ga0500618_002128 | 3300053125 | Bacteria | 7817 |
| 580 | Ga0500642_0209155 | 3300053130 | Bacteria | 906 |
| 581 | Ga0500652_050300 | 3300053131 | Bacteria | 1700 |
| 582 | Ga0500652_171337 | 3300053131 | Bacteria | 893 |
| 583 | Ga0500658_0140815 | 3300053134 | Bacteria | 1082 |
| 584 | Ga0500658_0268564 | 3300053134 | Bacteria | 784 |
| 585 | Ga0500568_0026172 | 3300053139 | Unclassified | 2451 |
| 586 | Ga0500568_0045294 | 3300053139 | Bacteria | 1751 |
| 587 | Ga0500604_0088769 | 3300053151 | Bacteria | 1007 |
| 588 | Ga0500636_0000210 | 3300053177 | Bacteria | 31824 |
| 589 | Ga0501084_0066313 | 3300054114 | Bacteria | 3020 |
| 590 | Ga0501082_0015663 | 3300060353 | Bacteria | 6524 |
| 591 | Ga0530510_0675450 | 3300061734 | Bacteria | 787 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048923 | Ga0496120_0216298 | Ga0496120_0216298_389_901 | 165 |
| 2 | 3300053134 | Ga0500658_0140815 | Ga0500658_0140815_337_858 | 173 |
| 3 | 3300009553 | Ga0105249_10725112 | Ga0105249_107251121 | 174 |
| 4 | 3300041491 | Ga0451833_1175627 | Ga0451833_1175627_66_635 | 188 |
| 5 | 3300039447 | Ga0436361_0808386 | Ga0436361_0808386_77_688 | 190 |
| 6 | 3300046665 | Ga0495661_0033244 | Ga0495661_0033244_2524_3192 | 191 |
| 7 | 3300048923 | Ga0496120_0035504 | Ga0496120_0035504_607_1275 | 191 |
| 8 | 3300009147 | Ga0114129_10073669 | Ga0114129_100736696 | 195 |
| 9 | 3300026142 | Ga0207698_11051845 | Ga0207698_110518451 | 195 |
| 10 | 3300049572 | Ga0501036_0411919 | Ga0501036_0411919_421_1008 | 195 |
| 11 | 3300049573 | Ga0501037_0031570 | Ga0501037_0031570_1528_2115 | 195 |
| 12 | 3300049574 | Ga0501038_0044719 | Ga0501038_0044719_1425_2012 | 195 |
| 13 | 3300049580 | Ga0501046_0169436 | Ga0501046_0169436_933_1520 | 195 |
| 14 | 3300049581 | Ga0501047_0031512 | Ga0501047_0031512_16_603 | 195 |
| 15 | 3300049822 | Ga0501035_0061927 | Ga0501035_0061927_1785_2372 | 195 |
| 16 | 3300049823 | Ga0501044_0004292 | Ga0501044_0004292_7832_8419 | 195 |
| 17 | 3300050507 | nmdc:mga05p37_77261_c1 | nmdc:mga05p37_77261_c1_3262_3852 | 195 |
| 18 | iso_pu_bacteria | 2935908558 | 2935908895 | 195 |
| 19 | iso_pu_bacteria | 2935916978 | 2935919614 | 195 |
| 20 | iso_pu_bacteria | 2935926038 | 2935926531 | 195 |
| 21 | iso_pu_bacteria | 2935934488 | 2935934981 | 195 |
| 22 | iso_pu_bacteria | 2935942939 | 2935943431 | 195 |
| 23 | iso_pu_bacteria | 2935951376 | 2935951869 | 195 |
| 24 | iso_pu_bacteria | 2935967501 | 2935967994 | 195 |
| 25 | iso_pu_bacteria | 8019687851 | 8019690294 | 195 |
| 26 | 3300045836 | Ga0466958_0007106 | Ga0466958_0007106_1779_2378 | 196 |
| 27 | 3300005327 | Ga0070658_10254397 | Ga0070658_102543971 | 197 |
| 28 | 3300005339 | Ga0070660_100181564 | Ga0070660_1001815643 | 197 |
| 29 | 3300005539 | Ga0068853_100100679 | Ga0068853_1001006794 | 197 |
| 30 | 3300005548 | Ga0070665_100000668 | Ga0070665_1000006682 | 197 |
| 31 | 3300005563 | Ga0068855_100077030 | Ga0068855_1000770302 | 197 |
| 32 | 3300009093 | Ga0105240_10166641 | Ga0105240_101666415 | 197 |
| 33 | 3300009093 | Ga0105240_10231444 | Ga0105240_102314442 | 197 |
| 34 | 3300009551 | Ga0105238_10219823 | Ga0105238_102198232 | 197 |
| 35 | 3300009551 | Ga0105238_10309940 | Ga0105238_103099402 | 197 |
| 36 | 3300010375 | Ga0105239_10756739 | Ga0105239_107567392 | 197 |
| 37 | 3300013104 | Ga0157370_10130248 | Ga0157370_101302482 | 197 |
| 38 | 3300013104 | Ga0157370_10187390 | Ga0157370_101873903 | 197 |
| 39 | 3300025913 | Ga0207695_10851444 | Ga0207695_108514441 | 197 |
| 40 | 3300025919 | Ga0207657_10033930 | Ga0207657_100339303 | 197 |
| 41 | 3300025924 | Ga0207694_10220965 | Ga0207694_102209652 | 197 |
| 42 | 3300025924 | Ga0207694_10273723 | Ga0207694_102737231 | 197 |
| 43 | 3300025944 | Ga0207661_10348726 | Ga0207661_103487261 | 197 |
| 44 | 3300025949 | Ga0207667_10169632 | Ga0207667_101696324 | 197 |
| 45 | 3300025949 | Ga0207667_11131722 | Ga0207667_111317221 | 197 |
| 46 | 3300025981 | Ga0207640_10628997 | Ga0207640_106289972 | 197 |
| 47 | 3300028379 | Ga0268266_10003907 | Ga0268266_1000390713 | 197 |
| 48 | 3300028800 | Ga0265338_10045176 | Ga0265338_100451762 | 197 |
| 49 | 3300031238 | Ga0265332_10196800 | Ga0265332_101968002 | 197 |
| 50 | 3300031247 | Ga0265340_10033223 | Ga0265340_100332233 | 197 |
| 51 | 3300031250 | Ga0265331_10040995 | Ga0265331_100409952 | 197 |
| 52 | 3300031595 | Ga0265313_10074665 | Ga0265313_100746652 | 197 |
| 53 | 3300031711 | Ga0265314_10128459 | Ga0265314_101284592 | 197 |
| 54 | 3300037466 | Ga0395898_0012654 | Ga0395898_0012654_235_828 | 197 |
| 55 | 3300044842 | Ga0466957_0281194 | Ga0466957_0281194_139_738 | 197 |
| 56 | 3300048917 | Ga0496114_0840564 | Ga0496114_0840564_144_743 | 197 |
| 57 | 3300048929 | Ga0496126_0028834 | Ga0496126_0028834_637_1230 | 197 |
| 58 | 3300049589 | Ga0501073_0048026 | Ga0501073_0048026_1920_2513 | 197 |
| 59 | 3300053087 | Ga0500643_000169 | Ga0500643_000169_63594_64187 | 197 |
| 60 | 3300053134 | Ga0500658_0268564 | Ga0500658_0268564_75_668 | 197 |
| 61 | 3300053151 | Ga0500604_0088769 | Ga0500604_0088769_262_855 | 197 |
| 62 | iso_pu_bacteria | 2842775625 | 2842777977 | 197 |
| 63 | 3300021361 | Ga0213872_10068050 | Ga0213872_100680503 | 198 |
| 64 | 3300039447 | Ga0436361_0667408 | Ga0436361_0667408_619_1218 | 198 |
| 65 | 3300046460 | Ga0495638_0033535 | Ga0495638_0033535_2625_3221 | 198 |
| 66 | iso_pu_bacteria | 2511231002 | 2511244212 | 198 |
| 67 | 3300005339 | Ga0070660_100348026 | Ga0070660_1003480262 | 199 |
| 68 | 3300005616 | Ga0068852_100625075 | Ga0068852_1006250752 | 199 |
| 69 | 3300009551 | Ga0105238_10554736 | Ga0105238_105547361 | 199 |
| 70 | 3300009987 | Ga0105030_100615 | Ga0105030_1006153 | 199 |
| 71 | 3300010375 | Ga0105239_11024179 | Ga0105239_110241792 | 199 |
| 72 | 3300026041 | Ga0207639_10372876 | Ga0207639_103728762 | 199 |
| 73 | 3300026067 | Ga0207678_10049131 | Ga0207678_100491314 | 199 |
| 74 | 3300026142 | Ga0207698_10124950 | Ga0207698_101249502 | 199 |
| 75 | 3300041460 | Ga0451802_1684582 | Ga0451802_1684582_196_798 | 199 |
| 76 | 3300041463 | Ga0451804_0390599 | Ga0451804_0390599_122_724 | 199 |
| 77 | 3300041512 | Ga0451853_1431401 | Ga0451853_1431401_42_644 | 199 |
| 78 | 3300047320 | Ga0495672_0052289 | Ga0495672_0052289_1667_2266 | 199 |
| 79 | 3300049584 | Ga0501068_0397373 | Ga0501068_0397373_79_702 | 199 |
| 80 | 3300049589 | Ga0501073_0015830 | Ga0501073_0015830_3190_3813 | 199 |
| 81 | 3300049590 | Ga0501074_0026584 | Ga0501074_0026584_3346_3969 | 199 |
| 82 | 3300049742 | Ga0501080_0003532 | Ga0501080_0003532_7425_8048 | 199 |
| 83 | 3300053087 | Ga0500643_000032 | Ga0500643_000032_19612_20214 | 199 |
| 84 | 3300053094 | Ga0500566_0014073 | Ga0500566_0014073_2215_2817 | 199 |
| 85 | 3300053096 | Ga0500641_0029252 | Ga0500641_0029252_1314_1916 | 199 |
| 86 | 3300053103 | Ga0500555_006629 | Ga0500555_006629_662_1264 | 199 |
| 87 | 3300053116 | Ga0500592_023369 | Ga0500592_023369_150_752 | 199 |
| 88 | 3300053130 | Ga0500642_0209155 | Ga0500642_0209155_98_700 | 199 |
| 89 | 3300053131 | Ga0500652_171337 | Ga0500652_171337_54_656 | 199 |
| 90 | 3300053139 | Ga0500568_0045294 | Ga0500568_0045294_265_867 | 199 |
| 91 | 3300054114 | Ga0501084_0066313 | Ga0501084_0066313_682_1305 | 199 |
| 92 | 3300060353 | Ga0501082_0015663 | Ga0501082_0015663_128_751 | 199 |
| 93 | iso_pu_bacteria | 2643221603 | 2644029887 | 199 |
| 94 | 3300005327 | Ga0070658_10454845 | Ga0070658_104548451 | 200 |
| 95 | 3300005436 | Ga0070713_101291335 | Ga0070713_1012913351 | 200 |
| 96 | 3300005535 | Ga0070684_100322598 | Ga0070684_1003225982 | 200 |
| 97 | 3300005547 | Ga0070693_100021797 | Ga0070693_1000217973 | 200 |
| 98 | 3300005548 | Ga0070665_100016965 | Ga0070665_1000169655 | 200 |
| 99 | 3300006051 | Ga0075364_10155914 | Ga0075364_101559142 | 200 |
| 100 | 3300006358 | Ga0068871_100671846 | Ga0068871_1006718462 | 200 |
| 101 | 3300009093 | Ga0105240_10564349 | Ga0105240_105643491 | 200 |
| 102 | 3300009093 | Ga0105240_10674134 | Ga0105240_106741342 | 200 |
| 103 | 3300009177 | Ga0105248_10520022 | Ga0105248_105200221 | 200 |
| 104 | 3300009551 | Ga0105238_10092243 | Ga0105238_100922432 | 200 |
| 105 | 3300010375 | Ga0105239_10165491 | Ga0105239_101654912 | 200 |
| 106 | 3300014325 | Ga0163163_10244522 | Ga0163163_102445221 | 200 |
| 107 | 3300025924 | Ga0207694_10368246 | Ga0207694_103682462 | 200 |
| 108 | 3300025941 | Ga0207711_10610212 | Ga0207711_106102121 | 200 |
| 109 | 3300026023 | Ga0207677_10816423 | Ga0207677_108164231 | 200 |
| 110 | 3300028379 | Ga0268266_10012796 | Ga0268266_100127964 | 200 |
| 111 | 3300028794 | Ga0307515_10513481 | Ga0307515_105134811 | 200 |
| 112 | 3300031456 | Ga0307513_10489912 | Ga0307513_104899121 | 200 |
| 113 | 3300045976 | Ga0466967_0859285 | Ga0466967_0859285_16_621 | 200 |
| 114 | 3300046458 | Ga0495591_000604 | Ga0495591_000604_16172_16774 | 200 |
| 115 | 3300046519 | Ga0495632_0010313 | Ga0495632_0010313_109_711 | 200 |
| 116 | 3300046665 | Ga0495661_0000840 | Ga0495661_0000840_10519_11121 | 200 |
| 117 | 3300050491 | nmdc:mga00v17_61050_c1 | nmdc:mga00v17_61050_c1_686_1288 | 200 |
| 118 | 3300003214 | JGI25165J46597_1014494 | JGI25165J46597_10144942 | 201 |
| 119 | 3300003911 | JGI25405J52794_10049997 | JGI25405J52794_100499972 | 201 |
| 120 | 3300005341 | Ga0070691_10007124 | Ga0070691_100071244 | 201 |
| 121 | 3300005347 | Ga0070668_100539108 | Ga0070668_1005391082 | 201 |
| 122 | 3300005439 | Ga0070711_100546532 | Ga0070711_1005465321 | 201 |
| 123 | 3300005440 | Ga0070705_100131282 | Ga0070705_1001312823 | 201 |
| 124 | 3300005444 | Ga0070694_100105443 | Ga0070694_1001054433 | 201 |
| 125 | 3300005536 | Ga0070697_100307991 | Ga0070697_1003079913 | 201 |
| 126 | 3300005545 | Ga0070695_100020522 | Ga0070695_1000205226 | 201 |
| 127 | 3300005719 | Ga0068861_100028347 | Ga0068861_1000283476 | 201 |
| 128 | 3300005983 | Ga0081540_1025908 | Ga0081540_10259084 | 201 |
| 129 | 3300006173 | Ga0070716_100326977 | Ga0070716_1003269771 | 201 |
| 130 | 3300006844 | Ga0075428_100028395 | Ga0075428_1000283957 | 201 |
| 131 | 3300006852 | Ga0075433_10015394 | Ga0075433_100153946 | 201 |
| 132 | 3300006852 | Ga0075433_10240777 | Ga0075433_102407772 | 201 |
| 133 | 3300006871 | Ga0075434_100737499 | Ga0075434_1007374991 | 201 |
| 134 | 3300006880 | Ga0075429_100356766 | Ga0075429_1003567661 | 201 |
| 135 | 3300007076 | Ga0075435_100361130 | Ga0075435_1003611302 | 201 |
| 136 | 3300007076 | Ga0075435_100526087 | Ga0075435_1005260872 | 201 |
| 137 | 3300007265 | Ga0099794_10010503 | Ga0099794_100105032 | 201 |
| 138 | 3300009093 | Ga0105240_10377097 | Ga0105240_103770972 | 201 |
| 139 | 3300009094 | Ga0111539_10279910 | Ga0111539_102799102 | 201 |
| 140 | 3300009147 | Ga0114129_10001176 | Ga0114129_100011768 | 201 |
| 141 | 3300009147 | Ga0114129_10727649 | Ga0114129_107276492 | 201 |
| 142 | 3300009176 | Ga0105242_10733492 | Ga0105242_107334921 | 201 |
| 143 | 3300009545 | Ga0105237_10187479 | Ga0105237_101874793 | 201 |
| 144 | 3300009545 | Ga0105237_10313197 | Ga0105237_103131972 | 201 |
| 145 | 3300025261 | Ga0209233_1011340 | Ga0209233_10113402 | 201 |
| 146 | 3300025735 | Ga0207713_1055708 | Ga0207713_10557082 | 201 |
| 147 | 3300025914 | Ga0207671_10647953 | Ga0207671_106479531 | 201 |
| 148 | 3300025915 | Ga0207693_10062617 | Ga0207693_100626172 | 201 |
| 149 | 3300025916 | Ga0207663_10079962 | Ga0207663_100799622 | 201 |
| 150 | 3300025928 | Ga0207700_10569968 | Ga0207700_105699681 | 201 |
| 151 | 3300025939 | Ga0207665_10027516 | Ga0207665_100275162 | 201 |
| 152 | 3300026118 | Ga0207675_100018731 | Ga0207675_1000187314 | 201 |
| 153 | 3300031251 | Ga0265327_10000589 | Ga0265327_1000058918 | 201 |
| 154 | 3300031911 | Ga0307412_10164424 | Ga0307412_101644242 | 201 |
| 155 | 3300032002 | Ga0307416_100100479 | Ga0307416_1001004793 | 201 |
| 156 | 3300039453 | Ga0436362_0554176 | Ga0436362_0554176_77_682 | 201 |
| 157 | 3300042876 | Ga0451577_0203138 | Ga0451577_0203138_40_645 | 201 |
| 158 | 3300044901 | Ga0466960_0020410 | Ga0466960_0020410_818_1429 | 201 |
| 159 | 3300045051 | Ga0451576_0035746 | Ga0451576_0035746_4093_4698 | 201 |
| 160 | 3300048918 | Ga0496115_0273394 | Ga0496115_0273394_154_759 | 201 |
| 161 | 3300050507 | nmdc:mga05p37_621882_c1 | nmdc:mga05p37_621882_c1_354_962 | 201 |
| 162 | 3300050507 | nmdc:mga05p37_6324_c1 | nmdc:mga05p37_6324_c1_8880_9485 | 201 |
| 163 | 3300050508 | nmdc:mga09592_287347_c1 | nmdc:mga09592_287347_c1_551_1159 | 201 |
| 164 | 3300050512 | nmdc:mga0n895_69171_c1 | nmdc:mga0n895_69171_c1_2856_3461 | 201 |
| 165 | 3300050513 | nmdc:mga0rr50_318147_c1 | nmdc:mga0rr50_318147_c1_664_1269 | 201 |
| 166 | 3300050513 | nmdc:mga0rr50_735952_c1 | nmdc:mga0rr50_735952_c1_49_654 | 201 |
| 167 | 3300050515 | nmdc:mga0a205_4732_c1 | nmdc:mga0a205_4732_c1_11222_11827 | 201 |
| 168 | 3300002705 | JGI25156J39149_1000009 | JGI25156J39149_1000009202 | 202 |
| 169 | 3300002738 | JGI25154J39366_1000024 | JGI25154J39366_1000024202 | 202 |
| 170 | 3300002741 | JGI25157J39369_1000007 | JGI25157J39369_1000007202 | 202 |
| 171 | 3300002987 | JGI25159J45721_1000314 | JGI25159J45721_10003146 | 202 |
| 172 | 3300003354 | JGI25160J50197_1000131 | JGI25160J50197_100013151 | 202 |
| 173 | 3300003374 | JGI25161J50226_1000009 | JGI25161J50226_100000921 | 202 |
| 174 | 3300003773 | Ga0055537_1018448 | Ga0055537_10184482 | 202 |
| 175 | 3300003784 | Ga0055534_1017490 | Ga0055534_10174901 | 202 |
| 176 | 3300004625 | Ga0055543_1000122 | Ga0055543_100012244 | 202 |
| 177 | 3300005262 | Ga0065165_1009960 | Ga0065165_10099602 | 202 |
| 178 | 3300005262 | Ga0065165_1016071 | Ga0065165_10160711 | 202 |
| 179 | 3300005336 | Ga0070680_100028823 | Ga0070680_1000288232 | 202 |
| 180 | 3300005336 | Ga0070680_100505686 | Ga0070680_1005056862 | 202 |
| 181 | 3300005364 | Ga0070673_100539473 | Ga0070673_1005394731 | 202 |
| 182 | 3300005435 | Ga0070714_100005041 | Ga0070714_10000504110 | 202 |
| 183 | 3300005445 | Ga0070708_100414118 | Ga0070708_1004141181 | 202 |
| 184 | 3300005456 | Ga0070678_100001672 | Ga0070678_1000016729 | 202 |
| 185 | 3300005458 | Ga0070681_10020234 | Ga0070681_100202342 | 202 |
| 186 | 3300005467 | Ga0070706_100306308 | Ga0070706_1003063082 | 202 |
| 187 | 3300005468 | Ga0070707_100048186 | Ga0070707_1000481862 | 202 |
| 188 | 3300005530 | Ga0070679_100168250 | Ga0070679_1001682502 | 202 |
| 189 | 3300005530 | Ga0070679_100533327 | Ga0070679_1005333272 | 202 |
| 190 | 3300005536 | Ga0070697_100098379 | Ga0070697_1000983792 | 202 |
| 191 | 3300005543 | Ga0070672_100097277 | Ga0070672_1000972772 | 202 |
| 192 | 3300005545 | Ga0070695_100236566 | Ga0070695_1002365662 | 202 |
| 193 | 3300005549 | Ga0070704_100303538 | Ga0070704_1003035381 | 202 |
| 194 | 3300005616 | Ga0068852_100162455 | Ga0068852_1001624553 | 202 |
| 195 | 3300005618 | Ga0068864_100024569 | Ga0068864_1000245692 | 202 |
| 196 | 3300005834 | Ga0068851_10151867 | Ga0068851_101518672 | 202 |
| 197 | 3300006051 | Ga0075364_10093909 | Ga0075364_100939092 | 202 |
| 198 | 3300006177 | Ga0075362_10075384 | Ga0075362_100753843 | 202 |
| 199 | 3300006178 | Ga0075367_10087059 | Ga0075367_100870593 | 202 |
| 200 | 3300006195 | Ga0075366_10147545 | Ga0075366_101475452 | 202 |
| 201 | 3300006237 | Ga0097621_100161484 | Ga0097621_1001614843 | 202 |
| 202 | 3300006358 | Ga0068871_100232668 | Ga0068871_1002326682 | 202 |
| 203 | 3300006847 | Ga0075431_100392651 | Ga0075431_1003926512 | 202 |
| 204 | 3300007076 | Ga0075435_100347094 | Ga0075435_1003470942 | 202 |
| 205 | 3300009545 | Ga0105237_10350985 | Ga0105237_103509851 | 202 |
| 206 | 3300013307 | Ga0157372_10536790 | Ga0157372_105367901 | 202 |
| 207 | 3300013308 | Ga0157375_10273146 | Ga0157375_102731463 | 202 |
| 208 | 3300014325 | Ga0163163_10283086 | Ga0163163_102830862 | 202 |
| 209 | 3300014969 | Ga0157376_10001256 | Ga0157376_100012569 | 202 |
| 210 | 3300025206 | Ga0209435_100008 | Ga0209435_100008109 | 202 |
| 211 | 3300025208 | Ga0209436_111654 | Ga0209436_1116541 | 202 |
| 212 | 3300025245 | Ga0207425_1005696 | Ga0207425_10056963 | 202 |
| 213 | 3300025246 | Ga0209646_1000029 | Ga0209646_1000029169 | 202 |
| 214 | 3300025250 | Ga0209026_1000016 | Ga0209026_1000016169 | 202 |
| 215 | 3300025256 | Ga0209759_1000016 | Ga0209759_1000016169 | 202 |
| 216 | 3300025263 | Ga0209565_1001008 | Ga0209565_10010087 | 202 |
| 217 | 3300025284 | Ga0209130_1000014 | Ga0209130_1000014206 | 202 |
| 218 | 3300025291 | Ga0209675_1003887 | Ga0209675_10038872 | 202 |
| 219 | 3300025297 | Ga0209758_1053869 | Ga0209758_10538692 | 202 |
| 220 | 3300025298 | Ga0209050_1002656 | Ga0209050_100265612 | 202 |
| 221 | 3300025299 | Ga0209256_1014087 | Ga0209256_10140873 | 202 |
| 222 | 3300025302 | Ga0207426_1000242 | Ga0207426_100024293 | 202 |
| 223 | 3300025321 | Ga0207656_10108680 | Ga0207656_101086802 | 202 |
| 224 | 3300025909 | Ga0207705_10098841 | Ga0207705_100988412 | 202 |
| 225 | 3300025917 | Ga0207660_10224020 | Ga0207660_102240202 | 202 |
| 226 | 3300025922 | Ga0207646_10286788 | Ga0207646_102867882 | 202 |
| 227 | 3300025925 | Ga0207650_10022276 | Ga0207650_100222763 | 202 |
| 228 | 3300025926 | Ga0207659_10204089 | Ga0207659_102040892 | 202 |
| 229 | 3300025929 | Ga0207664_10016026 | Ga0207664_100160263 | 202 |
| 230 | 3300025931 | Ga0207644_10181925 | Ga0207644_101819252 | 202 |
| 231 | 3300025940 | Ga0207691_10023986 | Ga0207691_100239865 | 202 |
| 232 | 3300025960 | Ga0207651_10021021 | Ga0207651_100210211 | 202 |
| 233 | 3300026095 | Ga0207676_10017029 | Ga0207676_100170292 | 202 |
| 234 | 3300026142 | Ga0207698_10075803 | Ga0207698_100758033 | 202 |
| 235 | 3300028380 | Ga0268265_10570555 | Ga0268265_105705552 | 202 |
| 236 | 3300031247 | Ga0265340_10006688 | Ga0265340_100066883 | 202 |
| 237 | 3300031247 | Ga0265340_10145252 | Ga0265340_101452521 | 202 |
| 238 | 3300031456 | Ga0307513_10138812 | Ga0307513_101388123 | 202 |
| 239 | 3300031456 | Ga0307513_10494807 | Ga0307513_104948071 | 202 |
| 240 | 3300031824 | Ga0307413_10170935 | Ga0307413_101709352 | 202 |
| 241 | 3300031911 | Ga0307412_10427591 | Ga0307412_104275912 | 202 |
| 242 | 3300035111 | Ga0373923_0302380 | Ga0373923_0302380_30_638 | 202 |
| 243 | 3300035113 | Ga0373936_0078048 | Ga0373936_0078048_418_1071 | 202 |
| 244 | 3300036401 | Ga0373937_1012061 | Ga0373937_1012061_113_721 | 202 |
| 245 | 3300037471 | Ga0395905_0039569 | Ga0395905_0039569_3246_3854 | 202 |
| 246 | 3300041456 | Ga0451795_0568060 | Ga0451795_0568060_106_714 | 202 |
| 247 | 3300041505 | Ga0451849_1070750 | Ga0451849_1070750_190_798 | 202 |
| 248 | 3300044656 | Ga0466969_0007183 | Ga0466969_0007183_4745_5359 | 202 |
| 249 | 3300044683 | Ga0466965_0068166 | Ga0466965_0068166_189_803 | 202 |
| 250 | 3300044684 | Ga0466966_0008473 | Ga0466966_0008473_2626_3240 | 202 |
| 251 | 3300044693 | Ga0466961_0000034 | Ga0466961_0000034_4402_5016 | 202 |
| 252 | 3300044706 | Ga0466964_0266151 | Ga0466964_0266151_219_827 | 202 |
| 253 | 3300045049 | Ga0466959_0116595 | Ga0466959_0116595_971_1585 | 202 |
| 254 | 3300045051 | Ga0451576_0410082 | Ga0451576_0410082_370_990 | 202 |
| 255 | 3300046460 | Ga0495638_0093041 | Ga0495638_0093041_605_1213 | 202 |
| 256 | 3300046539 | Ga0495621_0167334 | Ga0495621_0167334_50_658 | 202 |
| 257 | 3300046674 | Ga0495588_0028521 | Ga0495588_0028521_905_1513 | 202 |
| 258 | 3300048090 | Ga0495615_0021045 | Ga0495615_0021045_158_766 | 202 |
| 259 | 3300048905 | Ga0496102_0193343 | Ga0496102_0193343_1219_1827 | 202 |
| 260 | 3300048905 | Ga0496102_0633901 | Ga0496102_0633901_20_628 | 202 |
| 261 | 3300049569 | Ga0501032_0208358 | Ga0501032_0208358_513_1127 | 202 |
| 262 | 3300049574 | Ga0501038_0154363 | Ga0501038_0154363_1201_1815 | 202 |
| 263 | 3300049574 | Ga0501038_0364837 | Ga0501038_0364837_237_845 | 202 |
| 264 | 3300049575 | Ga0501039_0154491 | Ga0501039_0154491_951_1565 | 202 |
| 265 | 3300049576 | Ga0501040_0167047 | Ga0501040_0167047_23_631 | 202 |
| 266 | 3300049581 | Ga0501047_0275407 | Ga0501047_0275407_558_1172 | 202 |
| 267 | 3300049589 | Ga0501073_0001667 | Ga0501073_0001667_9486_10097 | 202 |
| 268 | 3300049822 | Ga0501035_0402271 | Ga0501035_0402271_84_698 | 202 |
| 269 | 3300049824 | Ga0501045_0142827 | Ga0501045_0142827_684_1292 | 202 |
| 270 | 3300050489 | nmdc:mga03683_27152_c1 | nmdc:mga03683_27152_c1_371_979 | 202 |
| 271 | 3300050491 | nmdc:mga00v17_244438_c1 | nmdc:mga00v17_244438_c1_38_646 | 202 |
| 272 | 3300050510 | nmdc:mga06r32_549937_c1 | nmdc:mga06r32_549937_c1_238_852 | 202 |
| 273 | 3300050513 | nmdc:mga0rr50_417877_c1 | nmdc:mga0rr50_417877_c1_20_628 | 202 |
| 274 | 3300053088 | Ga0500644_0038746 | Ga0500644_0038746_731_1339 | 202 |
| 275 | 3300053117 | Ga0500593_000998 | Ga0500593_000998_4164_4772 | 202 |
| 276 | 3300053131 | Ga0500652_050300 | Ga0500652_050300_568_1176 | 202 |
| 277 | 3300053139 | Ga0500568_0026172 | Ga0500568_0026172_1367_1975 | 202 |
| 278 | 3300053177 | Ga0500636_0000210 | Ga0500636_0000210_20971_21579 | 202 |
| 279 | 3300003752 | Ga0055539_1000222 | Ga0055539_100022229 | 203 |
| 280 | 3300003756 | Ga0055533_1000016 | Ga0055533_1000016168 | 203 |
| 281 | 3300003759 | Ga0055525_1001185 | Ga0055525_10011855 | 203 |
| 282 | 3300005336 | Ga0070680_100759072 | Ga0070680_1007590721 | 203 |
| 283 | 3300005337 | Ga0070682_100500494 | Ga0070682_1005004942 | 203 |
| 284 | 3300005548 | Ga0070665_100183759 | Ga0070665_1001837593 | 203 |
| 285 | 3300006847 | Ga0075431_100017138 | Ga0075431_1000171389 | 203 |
| 286 | 3300009093 | Ga0105240_10289002 | Ga0105240_102890022 | 203 |
| 287 | 3300009174 | Ga0105241_10484985 | Ga0105241_104849852 | 203 |
| 288 | 3300009551 | Ga0105238_10048934 | Ga0105238_100489342 | 203 |
| 289 | 3300013307 | Ga0157372_10165705 | Ga0157372_101657053 | 203 |
| 290 | 3300021361 | Ga0213872_10002413 | Ga0213872_1000241310 | 203 |
| 291 | 3300025226 | Ga0209674_100041 | Ga0209674_100041218 | 203 |
| 292 | 3300025230 | Ga0209563_100043 | Ga0209563_100043218 | 203 |
| 293 | 3300025253 | Ga0209677_100096 | Ga0209677_10009649 | 203 |
| 294 | 3300025913 | Ga0207695_10283230 | Ga0207695_102832302 | 203 |
| 295 | 3300025924 | Ga0207694_10418347 | Ga0207694_104183471 | 203 |
| 296 | 3300026041 | Ga0207639_10802394 | Ga0207639_108023941 | 203 |
| 297 | 3300028379 | Ga0268266_10001450 | Ga0268266_1000145017 | 203 |
| 298 | 3300028380 | Ga0268265_10091107 | Ga0268265_100911073 | 203 |
| 299 | 3300039437 | Ga0436365_0856036 | Ga0436365_0856036_452_1063 | 203 |
| 300 | 3300039447 | Ga0436361_0108001 | Ga0436361_0108001_21937_22548 | 203 |
| 301 | 3300049573 | Ga0501037_0293802 | Ga0501037_0293802_89_703 | 203 |
| 302 | 3300050510 | nmdc:mga06r32_209371_c1 | nmdc:mga06r32_209371_c1_249_887 | 203 |
| 303 | 3300053119 | Ga0500595_035915 | Ga0500595_035915_623_1237 | 203 |
| 304 | 3300053125 | Ga0500618_002128 | Ga0500618_002128_2726_3340 | 203 |
| 305 | 3300005436 | Ga0070713_100074020 | Ga0070713_1000740202 | 204 |
| 306 | 3300005466 | Ga0070685_10008868 | Ga0070685_100088685 | 204 |
| 307 | 3300005549 | Ga0070704_100265986 | Ga0070704_1002659863 | 204 |
| 308 | 3300006028 | Ga0070717_10207124 | Ga0070717_102071241 | 204 |
| 309 | 3300025906 | Ga0207699_10012445 | Ga0207699_100124453 | 204 |
| 310 | 3300025928 | Ga0207700_10048811 | Ga0207700_100488112 | 204 |
| 311 | 3300033180 | Ga0307510_10000025 | Ga0307510_100000258 | 204 |
| 312 | 3300041503 | Ga0451847_0920145 | Ga0451847_0920145_21_650 | 204 |
| 313 | 3300047472 | Ga0495686_0030984 | Ga0495686_0030984_2109_2726 | 204 |
| 314 | 3300048906 | Ga0496103_0256854 | Ga0496103_0256854_482_1111 | 204 |
| 315 | 3300048908 | Ga0496105_0503275 | Ga0496105_0503275_134_763 | 204 |
| 316 | 3300048920 | Ga0496117_0000077 | Ga0496117_0000077_33911_34540 | 204 |
| 317 | 3300048921 | Ga0496118_0000026 | Ga0496118_0000026_81486_82115 | 204 |
| 318 | 3300048922 | Ga0496119_0013115 | Ga0496119_0013115_131_760 | 204 |
| 319 | 3300048923 | Ga0496120_0000648 | Ga0496120_0000648_40031_40660 | 204 |
| 320 | 3300048923 | Ga0496120_0015330 | Ga0496120_0015330_178_807 | 204 |
| 321 | 3300048924 | Ga0496121_0051696 | Ga0496121_0051696_2129_2758 | 204 |
| 322 | 3300048927 | Ga0496124_0030697 | Ga0496124_0030697_272_901 | 204 |
| 323 | 3300048928 | Ga0496125_0020338 | Ga0496125_0020338_4820_5449 | 204 |
| 324 | 3300001990 | JGI24737J22298_10000247 | JGI24737J22298_1000024720 | 205 |
| 325 | 3300001990 | JGI24737J22298_10001819 | JGI24737J22298_100018196 | 205 |
| 326 | 3300005327 | Ga0070658_10570517 | Ga0070658_105705171 | 205 |
| 327 | 3300005331 | Ga0070670_100071113 | Ga0070670_1000711134 | 205 |
| 328 | 3300005331 | Ga0070670_100090153 | Ga0070670_1000901533 | 205 |
| 329 | 3300005335 | Ga0070666_10043546 | Ga0070666_100435463 | 205 |
| 330 | 3300005335 | Ga0070666_10377990 | Ga0070666_103779902 | 205 |
| 331 | 3300005339 | Ga0070660_100408767 | Ga0070660_1004087671 | 205 |
| 332 | 3300005344 | Ga0070661_100022984 | Ga0070661_1000229845 | 205 |
| 333 | 3300005356 | Ga0070674_100029149 | Ga0070674_1000291494 | 205 |
| 334 | 3300005366 | Ga0070659_100005959 | Ga0070659_1000059592 | 205 |
| 335 | 3300005366 | Ga0070659_100010935 | Ga0070659_1000109355 | 205 |
| 336 | 3300005366 | Ga0070659_100094338 | Ga0070659_1000943383 | 205 |
| 337 | 3300005367 | Ga0070667_100022953 | Ga0070667_1000229534 | 205 |
| 338 | 3300005455 | Ga0070663_100778063 | Ga0070663_1007780631 | 205 |
| 339 | 3300005456 | Ga0070678_100157499 | Ga0070678_1001574993 | 205 |
| 340 | 3300005457 | Ga0070662_100014321 | Ga0070662_1000143216 | 205 |
| 341 | 3300005457 | Ga0070662_100430957 | Ga0070662_1004309572 | 205 |
| 342 | 3300005459 | Ga0068867_100017603 | Ga0068867_1000176031 | 205 |
| 343 | 3300005539 | Ga0068853_100044900 | Ga0068853_1000449004 | 205 |
| 344 | 3300005539 | Ga0068853_100058974 | Ga0068853_1000589745 | 205 |
| 345 | 3300005539 | Ga0068853_100174237 | Ga0068853_1001742372 | 205 |
| 346 | 3300005544 | Ga0070686_100893451 | Ga0070686_1008934511 | 205 |
| 347 | 3300005548 | Ga0070665_100532892 | Ga0070665_1005328922 | 205 |
| 348 | 3300005563 | Ga0068855_100475537 | Ga0068855_1004755372 | 205 |
| 349 | 3300005564 | Ga0070664_100061003 | Ga0070664_1000610031 | 205 |
| 350 | 3300005577 | Ga0068857_100020420 | Ga0068857_1000204205 | 205 |
| 351 | 3300005578 | Ga0068854_100530026 | Ga0068854_1005300262 | 205 |
| 352 | 3300005617 | Ga0068859_100330197 | Ga0068859_1003301971 | 205 |
| 353 | 3300005834 | Ga0068851_10176881 | Ga0068851_101768811 | 205 |
| 354 | 3300005841 | Ga0068863_100184990 | Ga0068863_1001849903 | 205 |
| 355 | 3300005841 | Ga0068863_100441190 | Ga0068863_1004411902 | 205 |
| 356 | 3300005844 | Ga0068862_100135614 | Ga0068862_1001356142 | 205 |
| 357 | 3300006195 | Ga0075366_10354479 | Ga0075366_103544791 | 205 |
| 358 | 3300006237 | Ga0097621_100570230 | Ga0097621_1005702301 | 205 |
| 359 | 3300006358 | Ga0068871_100234297 | Ga0068871_1002342972 | 205 |
| 360 | 3300006358 | Ga0068871_100367475 | Ga0068871_1003674751 | 205 |
| 361 | 3300006881 | Ga0068865_100438093 | Ga0068865_1004380932 | 205 |
| 362 | 3300006931 | Ga0097620_100330250 | Ga0097620_1003302501 | 205 |
| 363 | 3300009174 | Ga0105241_10015546 | Ga0105241_100155463 | 205 |
| 364 | 3300009174 | Ga0105241_10365390 | Ga0105241_103653901 | 205 |
| 365 | 3300009176 | Ga0105242_10009248 | Ga0105242_100092487 | 205 |
| 366 | 3300009176 | Ga0105242_10374164 | Ga0105242_103741641 | 205 |
| 367 | 3300009176 | Ga0105242_11286942 | Ga0105242_112869421 | 205 |
| 368 | 3300009177 | Ga0105248_10020605 | Ga0105248_100206055 | 205 |
| 369 | 3300009177 | Ga0105248_10266706 | Ga0105248_102667061 | 205 |
| 370 | 3300009177 | Ga0105248_10284800 | Ga0105248_102848002 | 205 |
| 371 | 3300009551 | Ga0105238_10009438 | Ga0105238_100094387 | 205 |
| 372 | 3300009553 | Ga0105249_10417750 | Ga0105249_104177502 | 205 |
| 373 | 3300009553 | Ga0105249_10552070 | Ga0105249_105520702 | 205 |
| 374 | 3300010375 | Ga0105239_10103428 | Ga0105239_101034283 | 205 |
| 375 | 3300011119 | Ga0105246_10042177 | Ga0105246_100421772 | 205 |
| 376 | 3300013102 | Ga0157371_10118730 | Ga0157371_101187304 | 205 |
| 377 | 3300013102 | Ga0157371_10167464 | Ga0157371_101674642 | 205 |
| 378 | 3300013105 | Ga0157369_10000680 | Ga0157369_1000068014 | 205 |
| 379 | 3300013296 | Ga0157374_10199729 | Ga0157374_101997292 | 205 |
| 380 | 3300013297 | Ga0157378_10299315 | Ga0157378_102993153 | 205 |
| 381 | 3300013306 | Ga0163162_10007030 | Ga0163162_100070306 | 205 |
| 382 | 3300013306 | Ga0163162_10018592 | Ga0163162_100185925 | 205 |
| 383 | 3300013306 | Ga0163162_10092133 | Ga0163162_100921334 | 205 |
| 384 | 3300013306 | Ga0163162_10115075 | Ga0163162_101150753 | 205 |
| 385 | 3300013307 | Ga0157372_10393264 | Ga0157372_103932642 | 205 |
| 386 | 3300013307 | Ga0157372_10611392 | Ga0157372_106113922 | 205 |
| 387 | 3300013308 | Ga0157375_10002438 | Ga0157375_100024382 | 205 |
| 388 | 3300013308 | Ga0157375_10694708 | Ga0157375_106947081 | 205 |
| 389 | 3300013308 | Ga0157375_11002925 | Ga0157375_110029252 | 205 |
| 390 | 3300014325 | Ga0163163_10098967 | Ga0163163_100989673 | 205 |
| 391 | 3300014325 | Ga0163163_10504616 | Ga0163163_105046162 | 205 |
| 392 | 3300014745 | Ga0157377_10354373 | Ga0157377_103543731 | 205 |
| 393 | 3300014968 | Ga0157379_10019588 | Ga0157379_100195882 | 205 |
| 394 | 3300014969 | Ga0157376_10000933 | Ga0157376_1000093310 | 205 |
| 395 | 3300014969 | Ga0157376_10677226 | Ga0157376_106772262 | 205 |
| 396 | 3300017792 | Ga0163161_10232231 | Ga0163161_102322312 | 205 |
| 397 | 3300020075 | Ga0206349_1918908 | Ga0206349_19189081 | 205 |
| 398 | 3300020076 | Ga0206355_1156896 | Ga0206355_11568961 | 205 |
| 399 | 3300020078 | Ga0206352_10848697 | Ga0206352_108486971 | 205 |
| 400 | 3300025901 | Ga0207688_10025745 | Ga0207688_100257452 | 205 |
| 401 | 3300025903 | Ga0207680_10225922 | Ga0207680_102259222 | 205 |
| 402 | 3300025903 | Ga0207680_10298062 | Ga0207680_102980622 | 205 |
| 403 | 3300025904 | Ga0207647_10017551 | Ga0207647_100175511 | 205 |
| 404 | 3300025904 | Ga0207647_10040973 | Ga0207647_100409735 | 205 |
| 405 | 3300025904 | Ga0207647_10361647 | Ga0207647_103616471 | 205 |
| 406 | 3300025907 | Ga0207645_10461123 | Ga0207645_104611231 | 205 |
| 407 | 3300025909 | Ga0207705_10302535 | Ga0207705_103025351 | 205 |
| 408 | 3300025911 | Ga0207654_10012866 | Ga0207654_100128663 | 205 |
| 409 | 3300025913 | Ga0207695_10045191 | Ga0207695_100451911 | 205 |
| 410 | 3300025914 | Ga0207671_10001068 | Ga0207671_1000106816 | 205 |
| 411 | 3300025919 | Ga0207657_10242576 | Ga0207657_102425762 | 205 |
| 412 | 3300025920 | Ga0207649_10030427 | Ga0207649_100304275 | 205 |
| 413 | 3300025924 | Ga0207694_10004006 | Ga0207694_100040064 | 205 |
| 414 | 3300025931 | Ga0207644_10318394 | Ga0207644_103183941 | 205 |
| 415 | 3300025932 | Ga0207690_10001436 | Ga0207690_100014362 | 205 |
| 416 | 3300025932 | Ga0207690_10011538 | Ga0207690_100115386 | 205 |
| 417 | 3300025933 | Ga0207706_10045635 | Ga0207706_100456355 | 205 |
| 418 | 3300025933 | Ga0207706_10073189 | Ga0207706_100731892 | 205 |
| 419 | 3300025934 | Ga0207686_10002538 | Ga0207686_100025386 | 205 |
| 420 | 3300025934 | Ga0207686_10431317 | Ga0207686_104313171 | 205 |
| 421 | 3300025937 | Ga0207669_10164287 | Ga0207669_101642874 | 205 |
| 422 | 3300025938 | Ga0207704_10433007 | Ga0207704_104330072 | 205 |
| 423 | 3300025941 | Ga0207711_10044392 | Ga0207711_100443923 | 205 |
| 424 | 3300025941 | Ga0207711_11111474 | Ga0207711_111114741 | 205 |
| 425 | 3300025942 | Ga0207689_10193233 | Ga0207689_101932332 | 205 |
| 426 | 3300025945 | Ga0207679_10065498 | Ga0207679_100654983 | 205 |
| 427 | 3300025986 | Ga0207658_10052377 | Ga0207658_100523774 | 205 |
| 428 | 3300026035 | Ga0207703_10716986 | Ga0207703_107169862 | 205 |
| 429 | 3300026041 | Ga0207639_10045893 | Ga0207639_100458932 | 205 |
| 430 | 3300026041 | Ga0207639_10256441 | Ga0207639_102564412 | 205 |
| 431 | 3300026088 | Ga0207641_10088121 | Ga0207641_100881215 | 205 |
| 432 | 3300026088 | Ga0207641_10252434 | Ga0207641_102524342 | 205 |
| 433 | 3300026089 | Ga0207648_10037439 | Ga0207648_100374391 | 205 |
| 434 | 3300026095 | Ga0207676_10138511 | Ga0207676_101385113 | 205 |
| 435 | 3300026116 | Ga0207674_10000271 | Ga0207674_1000027135 | 205 |
| 436 | 3300026121 | Ga0207683_10100792 | Ga0207683_101007923 | 205 |
| 437 | 3300028379 | Ga0268266_10296941 | Ga0268266_102969412 | 205 |
| 438 | 3300028381 | Ga0268264_10999311 | Ga0268264_109993112 | 205 |
| 439 | 3300031548 | Ga0307408_100282140 | Ga0307408_1002821402 | 205 |
| 440 | 3300031731 | Ga0307405_10390503 | Ga0307405_103905032 | 205 |
| 441 | 3300031824 | Ga0307413_10231159 | Ga0307413_102311593 | 205 |
| 442 | 3300031852 | Ga0307410_10001801 | Ga0307410_1000180110 | 205 |
| 443 | 3300031901 | Ga0307406_10122792 | Ga0307406_101227923 | 205 |
| 444 | 3300031903 | Ga0307407_10207383 | Ga0307407_102073833 | 205 |
| 445 | 3300031995 | Ga0307409_100008147 | Ga0307409_1000081474 | 205 |
| 446 | 3300032002 | Ga0307416_100006649 | Ga0307416_1000066495 | 205 |
| 447 | 3300032004 | Ga0307414_10107132 | Ga0307414_101071323 | 205 |
| 448 | 3300032005 | Ga0307411_10075330 | Ga0307411_100753302 | 205 |
| 449 | 3300032126 | Ga0307415_100050041 | Ga0307415_1000500413 | 205 |
| 450 | 3300032126 | Ga0307415_100972468 | Ga0307415_1009724681 | 205 |
| 451 | 3300032126 | Ga0307415_100981340 | Ga0307415_1009813401 | 205 |
| 452 | 3300036401 | Ga0373937_0057350 | Ga0373937_0057350_2851_3468 | 205 |
| 453 | 3300037418 | Ga0395900_0493053 | Ga0395900_0493053_168_785 | 205 |
| 454 | 3300037418 | Ga0395900_0759110 | Ga0395900_0759110_192_809 | 205 |
| 455 | 3300037471 | Ga0395905_0010861 | Ga0395905_0010861_5315_5932 | 205 |
| 456 | 3300038443 | Ga0395901_0002015 | Ga0395901_0002015_16638_17255 | 205 |
| 457 | 3300042012 | Ga0439455_0013240 | Ga0439455_0013240_631_1248 | 205 |
| 458 | 3300046473 | Ga0495582_0066129 | Ga0495582_0066129_1267_1884 | 205 |
| 459 | 3300046475 | Ga0495639_0025058 | Ga0495639_0025058_871_1488 | 205 |
| 460 | 3300046522 | Ga0495643_0073124 | Ga0495643_0073124_883_1500 | 205 |
| 461 | 3300046543 | Ga0495645_0025960 | Ga0495645_0025960_480_1097 | 205 |
| 462 | 3300046680 | Ga0495646_0186462 | Ga0495646_0186462_131_748 | 205 |
| 463 | 3300047315 | Ga0495581_0265721 | Ga0495581_0265721_17_634 | 205 |
| 464 | 3300047471 | Ga0495684_0569725 | Ga0495684_0569725_30_647 | 205 |
| 465 | 3300048907 | Ga0496104_0000005 | Ga0496104_0000005_277041_277658 | 205 |
| 466 | 3300048908 | Ga0496105_0000016 | Ga0496105_0000016_73834_74451 | 205 |
| 467 | 3300048910 | Ga0496107_0087734 | Ga0496107_0087734_432_1049 | 205 |
| 468 | 3300049531 | Ga0501315_029955 | Ga0501315_029955_146_763 | 205 |
| 469 | 3300053103 | Ga0500555_049426 | Ga0500555_049426_411_1037 | 205 |
| 470 | 3300005327 | Ga0070658_10387300 | Ga0070658_103873002 | 206 |
| 471 | 3300005539 | Ga0068853_100033923 | Ga0068853_1000339232 | 206 |
| 472 | 3300005616 | Ga0068852_100077928 | Ga0068852_1000779282 | 206 |
| 473 | 3300006871 | Ga0075434_100137884 | Ga0075434_1001378842 | 206 |
| 474 | 3300009098 | Ga0105245_10285487 | Ga0105245_102854872 | 206 |
| 475 | 3300013306 | Ga0163162_10000004 | Ga0163162_10000004367 | 206 |
| 476 | 3300013308 | Ga0157375_11173084 | Ga0157375_111730842 | 206 |
| 477 | 3300015262 | Ga0182007_10099949 | Ga0182007_100999492 | 206 |
| 478 | 3300025918 | Ga0207662_10316384 | Ga0207662_103163842 | 206 |
| 479 | 3300025927 | Ga0207687_10243292 | Ga0207687_102432922 | 206 |
| 480 | 3300026041 | Ga0207639_10015303 | Ga0207639_100153032 | 206 |
| 481 | 3300026142 | Ga0207698_10012482 | Ga0207698_100124823 | 206 |
| 482 | 3300031616 | Ga0307508_10018556 | Ga0307508_100185563 | 206 |
| 483 | 3300041406 | Ga0439439_0027398 | Ga0439439_0027398_311_931 | 206 |
| 484 | 3300048906 | Ga0496103_0521837 | Ga0496103_0521837_71_691 | 206 |
| 485 | 3300050512 | nmdc:mga0n895_128628_c1 | nmdc:mga0n895_128628_c1_553_1173 | 206 |
| 486 | 3300001904 | JGI24736J21556_1024787 | JGI24736J21556_10247872 | 207 |
| 487 | 3300002077 | JGI24744J21845_10010559 | JGI24744J21845_100105593 | 207 |
| 488 | 3300005327 | Ga0070658_10030271 | Ga0070658_100302713 | 207 |
| 489 | 3300005330 | Ga0070690_100129577 | Ga0070690_1001295772 | 207 |
| 490 | 3300005334 | Ga0068869_100128824 | Ga0068869_1001288243 | 207 |
| 491 | 3300005334 | Ga0068869_100367629 | Ga0068869_1003676292 | 207 |
| 492 | 3300005334 | Ga0068869_100575708 | Ga0068869_1005757081 | 207 |
| 493 | 3300005335 | Ga0070666_10001531 | Ga0070666_100015317 | 207 |
| 494 | 3300005335 | Ga0070666_10070654 | Ga0070666_100706543 | 207 |
| 495 | 3300005338 | Ga0068868_100530373 | Ga0068868_1005303732 | 207 |
| 496 | 3300005344 | Ga0070661_100035875 | Ga0070661_1000358753 | 207 |
| 497 | 3300005458 | Ga0070681_10289248 | Ga0070681_102892482 | 207 |
| 498 | 3300005459 | Ga0068867_100430130 | Ga0068867_1004301301 | 207 |
| 499 | 3300005530 | Ga0070679_100308138 | Ga0070679_1003081383 | 207 |
| 500 | 3300005539 | Ga0068853_100061839 | Ga0068853_1000618393 | 207 |
| 501 | 3300005539 | Ga0068853_100523249 | Ga0068853_1005232492 | 207 |
| 502 | 3300005549 | Ga0070704_100558771 | Ga0070704_1005587711 | 207 |
| 503 | 3300005563 | Ga0068855_100042779 | Ga0068855_1000427794 | 207 |
| 504 | 3300005577 | Ga0068857_100228283 | Ga0068857_1002282833 | 207 |
| 505 | 3300005614 | Ga0068856_100022335 | Ga0068856_1000223355 | 207 |
| 506 | 3300005614 | Ga0068856_100037193 | Ga0068856_1000371933 | 207 |
| 507 | 3300005616 | Ga0068852_100014128 | Ga0068852_1000141285 | 207 |
| 508 | 3300005616 | Ga0068852_100703446 | Ga0068852_1007034462 | 207 |
| 509 | 3300005616 | Ga0068852_100759915 | Ga0068852_1007599152 | 207 |
| 510 | 3300005617 | Ga0068859_101175913 | Ga0068859_1011759132 | 207 |
| 511 | 3300005618 | Ga0068864_100016572 | Ga0068864_1000165721 | 207 |
| 512 | 3300005618 | Ga0068864_100235965 | Ga0068864_1002359653 | 207 |
| 513 | 3300005840 | Ga0068870_10124133 | Ga0068870_101241332 | 207 |
| 514 | 3300005841 | Ga0068863_100004895 | Ga0068863_1000048959 | 207 |
| 515 | 3300005842 | Ga0068858_100129556 | Ga0068858_1001295562 | 207 |
| 516 | 3300005843 | Ga0068860_100034119 | Ga0068860_1000341193 | 207 |
| 517 | 3300006852 | Ga0075433_10224847 | Ga0075433_102248473 | 207 |
| 518 | 3300006871 | Ga0075434_100091795 | Ga0075434_1000917953 | 207 |
| 519 | 3300006871 | Ga0075434_100310522 | Ga0075434_1003105222 | 207 |
| 520 | 3300006931 | Ga0097620_101175865 | Ga0097620_1011758652 | 207 |
| 521 | 3300009093 | Ga0105240_10035211 | Ga0105240_100352115 | 207 |
| 522 | 3300009094 | Ga0111539_10068617 | Ga0111539_100686172 | 207 |
| 523 | 3300009098 | Ga0105245_10059159 | Ga0105245_100591592 | 207 |
| 524 | 3300009098 | Ga0105245_10096380 | Ga0105245_100963801 | 207 |
| 525 | 3300009148 | Ga0105243_10191883 | Ga0105243_101918833 | 207 |
| 526 | 3300009174 | Ga0105241_10005239 | Ga0105241_100052395 | 207 |
| 527 | 3300009174 | Ga0105241_10036994 | Ga0105241_100369943 | 207 |
| 528 | 3300009174 | Ga0105241_10097450 | Ga0105241_100974502 | 207 |
| 529 | 3300009174 | Ga0105241_10758095 | Ga0105241_107580952 | 207 |
| 530 | 3300009545 | Ga0105237_10002146 | Ga0105237_1000214622 | 207 |
| 531 | 3300009545 | Ga0105237_10309093 | Ga0105237_103090933 | 207 |
| 532 | 3300009551 | Ga0105238_10009034 | Ga0105238_100090346 | 207 |
| 533 | 3300010375 | Ga0105239_10036900 | Ga0105239_100369002 | 207 |
| 534 | 3300010375 | Ga0105239_10088739 | Ga0105239_100887392 | 207 |
| 535 | 3300013100 | Ga0157373_10080112 | Ga0157373_100801122 | 207 |
| 536 | 3300013104 | Ga0157370_10063842 | Ga0157370_100638423 | 207 |
| 537 | 3300013105 | Ga0157369_10002989 | Ga0157369_1000298918 | 207 |
| 538 | 3300013105 | Ga0157369_10008673 | Ga0157369_100086733 | 207 |
| 539 | 3300013297 | Ga0157378_10000064 | Ga0157378_1000006441 | 207 |
| 540 | 3300013297 | Ga0157378_10031796 | Ga0157378_100317963 | 207 |
| 541 | 3300013306 | Ga0163162_10319677 | Ga0163162_103196773 | 207 |
| 542 | 3300013307 | Ga0157372_10000277 | Ga0157372_1000027741 | 207 |
| 543 | 3300014325 | Ga0163163_10000105 | Ga0163163_1000010516 | 207 |
| 544 | 3300014325 | Ga0163163_10000927 | Ga0163163_100009275 | 207 |
| 545 | 3300014326 | Ga0157380_10254224 | Ga0157380_102542241 | 207 |
| 546 | 3300014497 | Ga0182008_10128920 | Ga0182008_101289202 | 207 |
| 547 | 3300014968 | Ga0157379_10004161 | Ga0157379_100041615 | 207 |
| 548 | 3300025899 | Ga0207642_10260893 | Ga0207642_102608932 | 207 |
| 549 | 3300025903 | Ga0207680_10000577 | Ga0207680_1000057711 | 207 |
| 550 | 3300025904 | Ga0207647_10001783 | Ga0207647_100017832 | 207 |
| 551 | 3300025911 | Ga0207654_10000432 | Ga0207654_1000043225 | 207 |
| 552 | 3300025911 | Ga0207654_10154827 | Ga0207654_101548273 | 207 |
| 553 | 3300025913 | Ga0207695_10000920 | Ga0207695_1000092031 | 207 |
| 554 | 3300025913 | Ga0207695_10149926 | Ga0207695_101499263 | 207 |
| 555 | 3300025914 | Ga0207671_10001915 | Ga0207671_100019153 | 207 |
| 556 | 3300025914 | Ga0207671_10027160 | Ga0207671_100271603 | 207 |
| 557 | 3300025919 | Ga0207657_10012705 | Ga0207657_100127053 | 207 |
| 558 | 3300025920 | Ga0207649_10002515 | Ga0207649_100025155 | 207 |
| 559 | 3300025921 | Ga0207652_10185116 | Ga0207652_101851163 | 207 |
| 560 | 3300025924 | Ga0207694_10107784 | Ga0207694_101077843 | 207 |
| 561 | 3300025927 | Ga0207687_10565602 | Ga0207687_105656022 | 207 |
| 562 | 3300025935 | Ga0207709_10072326 | Ga0207709_100723263 | 207 |
| 563 | 3300025941 | Ga0207711_10331861 | Ga0207711_103318612 | 207 |
| 564 | 3300025942 | Ga0207689_10317396 | Ga0207689_103173962 | 207 |
| 565 | 3300025942 | Ga0207689_10662429 | Ga0207689_106624291 | 207 |
| 566 | 3300025945 | Ga0207679_10139158 | Ga0207679_101391583 | 207 |
| 567 | 3300025949 | Ga0207667_10037846 | Ga0207667_100378463 | 207 |
| 568 | 3300025949 | Ga0207667_10506443 | Ga0207667_105064431 | 207 |
| 569 | 3300025981 | Ga0207640_10127557 | Ga0207640_101275573 | 207 |
| 570 | 3300026035 | Ga0207703_10046638 | Ga0207703_100466383 | 207 |
| 571 | 3300026035 | Ga0207703_10074159 | Ga0207703_100741592 | 207 |
| 572 | 3300026041 | Ga0207639_10039080 | Ga0207639_100390801 | 207 |
| 573 | 3300026041 | Ga0207639_10040521 | Ga0207639_100405215 | 207 |
| 574 | 3300026078 | Ga0207702_10005995 | Ga0207702_1000599511 | 207 |
| 575 | 3300026078 | Ga0207702_11024167 | Ga0207702_110241671 | 207 |
| 576 | 3300026088 | Ga0207641_10017105 | Ga0207641_100171053 | 207 |
| 577 | 3300026089 | Ga0207648_10566830 | Ga0207648_105668301 | 207 |
| 578 | 3300026116 | Ga0207674_10008203 | Ga0207674_100082034 | 207 |
| 579 | 3300026116 | Ga0207674_10150836 | Ga0207674_101508361 | 207 |
| 580 | 3300026142 | Ga0207698_10060920 | Ga0207698_100609203 | 207 |
| 581 | 3300028381 | Ga0268264_10009270 | Ga0268264_100092703 | 207 |
| 582 | 3300028381 | Ga0268264_10037579 | Ga0268264_100375793 | 207 |
| 583 | 3300037312 | Ga0395899_0339620 | Ga0395899_0339620_339_962 | 207 |
| 584 | 3300039438 | Ga0436360_1341053 | Ga0436360_1341053_2186_2812 | 207 |
| 585 | 3300041406 | Ga0439439_0029413 | Ga0439439_0029413_125_748 | 207 |
| 586 | 3300042015 | Ga0439462_0088863 | Ga0439462_0088863_121_744 | 207 |
| 587 | 3300042134 | Ga0450898_021201 | Ga0450898_021201_481_1104 | 207 |
| 588 | 3300042156 | Ga0439446_0007304 | Ga0439446_0007304_961_1584 | 207 |
| 589 | 3300042156 | Ga0439446_0008112 | Ga0439446_0008112_1566_2189 | 207 |
| 590 | 3300042184 | Ga0450908_004216 | Ga0450908_004216_1101_1724 | 207 |
| 591 | 3300042435 | Ga0439434_0000842 | Ga0439434_0000842_6172_6795 | 207 |
| 592 | 3300049579 | Ga0501043_0552116 | Ga0501043_0552116_160_792 | 207 |
| 593 | 3300049580 | Ga0501046_0149851 | Ga0501046_0149851_919_1551 | 207 |
| 594 | 3300049581 | Ga0501047_0002342 | Ga0501047_0002342_9326_9958 | 207 |
| 595 | 3300049583 | Ga0501067_0115396 | Ga0501067_0115396_213_836 | 207 |
| 596 | 3300049584 | Ga0501068_0050151 | Ga0501068_0050151_492_1115 | 207 |
| 597 | 3300049586 | Ga0501070_0009050 | Ga0501070_0009050_4580_5212 | 207 |
| 598 | 3300049742 | Ga0501080_0012786 | Ga0501080_0012786_4104_4736 | 207 |
| 599 | 3300050512 | nmdc:mga0n895_275690_c1 | nmdc:mga0n895_275690_c1_920_1543 | 207 |
| 600 | 3300050512 | nmdc:mga0n895_329498_c1 | nmdc:mga0n895_329498_c1_53_682 | 207 |
| 601 | 3300050515 | nmdc:mga0a205_7668_c1 | nmdc:mga0a205_7668_c1_8867_9490 | 207 |
| 602 | 3300061734 | Ga0530510_0675450 | Ga0530510_0675450_10_633 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dsa-assembly2.cif.gz_C | ternary complex of bphk, a bacterial gst | 0.9874 | 1 | 200 |
| 2dsa-assembly2.cif.gz_C | ternary complex of bphk, a bacterial gst | 0.9825 | 1 | 200 |
| 1pmt-assembly1.cif.gz_A | glutathione transferase from proteus mirabilis | 0.9824 | 1 | 201 |
| 3uap-assembly1.cif.gz_A | crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath | 0.9821 | 2 | 201 |
| 1pmt-assembly1.cif.gz_A | glutathione transferase from proteus mirabilis | 0.9776 | 1 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dsaC02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.987 | 83 | 188 | 1.20.1050.10 |
| af_P0A9D2_1_80_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9866 | 1 | 76 | 3.40.30.10 |
| 2dsaA02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9864 | 83 | 188 | 1.20.1050.10 |
| 2dsaD02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9843 | 83 | 188 | 1.20.1050.10 |
| 2gdrF02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9828 | 83 | 188 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R0EES6-F1-model_v4 | Glutathione S-transferase | 0.9922 | 1 | 202 |
GO:0016740
|
| AF-A9EQL0-F1-model_v4 | Gst9 protein (EC 2.5.1.18) | 0.9916 | 2 | 199 |
GO:0004364
|
| AF-A0A1Y0BMM0-F1-model_v4 | J355 | 0.9907 | 1 | 201 |
|
| AF-A0A6I2LWT9-F1-model_v4 | Glutathione transferase GstA (EC 2.5.1.18) | 0.9893 | 1 | 201 |
GO:0004364
|
| AF-A0A853SIG2-F1-model_v4 | deleted | 0.9888 | 1 | 198 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar