F468169

General Info

Members Datasets Scaffolds Average Seq Length
602 349 591 204

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10015546|Ga0105241_100155463
Length 245
Sequence VRPAAGYDPNVDSLEVATTYAQWAIEPMGHPIRRSIKENRMKLYFSPEACSLSPHIVLNELGLPFTTVNVDTKTKKTADGRDFLRINPKGYVPALELDDGEVLSEGPAIVQYLADLKPEKKLAPANGTLERARLQEWLNFITSELHKSYSPLFSPAMPAAAKAIFKDKLEQRYAFIAKTLDRQDYLLGAHFTVADAYLFVVTRWARHFDIDLNQWPSLAKFMERVGARAAVKLALNAESQAKKAA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
4 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
5 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
6 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
7 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
8 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
9 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
10 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
135 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
138 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
241 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
247 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
248 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
249 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
250 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
251 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
252 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
253 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
256 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
257 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
258 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
259 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
260 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
335 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
336 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
337 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
338 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
339 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
340 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
341 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
342 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
349 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0.66
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.97
Nodule 1.33
Rhizoplane 2.16
Rhizosphere 82.39
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1024787 3300001904 Bacteria 934
2 JGI24737J22298_10000247 3300001990 Bacteria 17946
3 JGI24737J22298_10001819 3300001990 Bacteria 7643
4 JGI24744J21845_10010559 3300002077 Bacteria 1892
5 JGI25156J39149_1000009 3300002705 Bacteria 224379
6 JGI25154J39366_1000024 3300002738 Bacteria 211372
7 JGI25157J39369_1000007 3300002741 Bacteria 224377
8 JGI25159J45721_1000314 3300002987 Bacteria 22609
9 JGI25165J46597_1014494 3300003214 Bacteria 1072
10 JGI25160J50197_1000131 3300003354 Bacteria 67778
11 JGI25161J50226_1000009 3300003374 Bacteria 224699
12 Ga0055539_1000222 3300003752 Bacteria 40292
13 Ga0055533_1000016 3300003756 Bacteria 396179
14 Ga0055525_1001185 3300003759 Bacteria 5883
15 Ga0055537_1018448 3300003773 Bacteria 1114
16 Ga0055534_1017490 3300003784 Bacteria 1266
17 JGI25405J52794_10049997 3300003911 Bacteria 895
18 Ga0055543_1000122 3300004625 Bacteria 65110
19 Ga0065165_1009960 3300005262 Bacteria 4182
20 Ga0065165_1016071 3300005262 Bacteria 2820
21 Ga0070658_10030271 3300005327 Bacteria 4350
22 Ga0070658_10254397 3300005327 Bacteria 1490
23 Ga0070658_10387300 3300005327 Bacteria 1200
24 Ga0070658_10454845 3300005327 Bacteria 1103
25 Ga0070658_10570517 3300005327 Bacteria 980
26 Ga0070690_100129577 3300005330 Bacteria 1702
27 Ga0070670_100071113 3300005331 Bacteria 2987
28 Ga0070670_100090153 3300005331 Bacteria 2635
29 Ga0068869_100128824 3300005334 Bacteria 1943
30 Ga0068869_100367629 3300005334 Bacteria 1176
31 Ga0068869_100575708 3300005334 Bacteria 949
32 Ga0070666_10001531 3300005335 Bacteria 14034
33 Ga0070666_10043546 3300005335 Bacteria 3006
34 Ga0070666_10070654 3300005335 Bacteria 2375
35 Ga0070666_10377990 3300005335 Bacteria 1017
36 Ga0070680_100028823 3300005336 Bacteria 4455
37 Ga0070680_100505686 3300005336 Unclassified 1034
38 Ga0070680_100759072 3300005336 Bacteria 835
39 Ga0070682_100500494 3300005337 Bacteria 941
40 Ga0068868_100530373 3300005338 Bacteria 1035
41 Ga0070660_100181564 3300005339 Bacteria 1703
42 Ga0070660_100348026 3300005339 Bacteria 1220
43 Ga0070660_100408767 3300005339 Bacteria 1123
44 Ga0070691_10007124 3300005341 Bacteria 5127
45 Ga0070661_100022984 3300005344 Bacteria 4466
46 Ga0070661_100035875 3300005344 Bacteria 3604
47 Ga0070668_100539108 3300005347 Unclassified 1014
48 Ga0070674_100029149 3300005356 Bacteria 3632
49 Ga0070673_100539473 3300005364 Bacteria 1059
50 Ga0070659_100005959 3300005366 Bacteria 8788
51 Ga0070659_100010935 3300005366 Bacteria 6698
52 Ga0070659_100094338 3300005366 Bacteria 2403
53 Ga0070667_100022953 3300005367 Bacteria 5173
54 Ga0070714_100005041 3300005435 Bacteria 10044
55 Ga0070713_100074020 3300005436 Bacteria 2885
56 Ga0070713_101291335 3300005436 Bacteria 707
57 Ga0070711_100546532 3300005439 Bacteria 960
58 Ga0070705_100131282 3300005440 Bacteria 1634
59 Ga0070694_100105443 3300005444 Bacteria 2000
60 Ga0070708_100414118 3300005445 Bacteria 1271
61 Ga0070663_100778063 3300005455 Bacteria 819
62 Ga0070678_100001672 3300005456 Bacteria 11879
63 Ga0070678_100157499 3300005456 Bacteria 1836
64 Ga0070662_100014321 3300005457 Bacteria 5296
65 Ga0070662_100430957 3300005457 Bacteria 1092
66 Ga0070681_10020234 3300005458 Bacteria 6671
67 Ga0070681_10289248 3300005458 Bacteria 1549
68 Ga0068867_100017603 3300005459 Bacteria 5075
69 Ga0068867_100430130 3300005459 Unclassified 1120
70 Ga0070685_10008868 3300005466 Bacteria 5186
71 Ga0070706_100306308 3300005467 Bacteria 1482
72 Ga0070707_100048186 3300005468 Bacteria 4081
73 Ga0070679_100168250 3300005530 Bacteria 2165
74 Ga0070679_100308138 3300005530 Bacteria 1533
75 Ga0070679_100533327 3300005530 Unclassified 1118
76 Ga0070684_100322598 3300005535 Bacteria 1419
77 Ga0070697_100098379 3300005536 Unclassified 2428
78 Ga0070697_100307991 3300005536 Bacteria 1362
79 Ga0068853_100033923 3300005539 Bacteria 4330
80 Ga0068853_100044900 3300005539 Bacteria 3784
81 Ga0068853_100058974 3300005539 Bacteria 3315
82 Ga0068853_100061839 3300005539 Bacteria 3239
83 Ga0068853_100100679 3300005539 Unclassified 2555
84 Ga0068853_100174237 3300005539 Bacteria 1948
85 Ga0068853_100523249 3300005539 Bacteria 1121
86 Ga0070672_100097277 3300005543 Bacteria 2383
87 Ga0070686_100893451 3300005544 Bacteria 722
88 Ga0070695_100020522 3300005545 Bacteria 4034
89 Ga0070695_100236566 3300005545 Bacteria 1323
90 Ga0070693_100021797 3300005547 Bacteria 3398
91 Ga0070665_100000668 3300005548 Bacteria 46152
92 Ga0070665_100016965 3300005548 Bacteria 7301
93 Ga0070665_100183759 3300005548 Bacteria 2091
94 Ga0070665_100532892 3300005548 Bacteria 1186
95 Ga0070704_100265986 3300005549 Unclassified 1414
96 Ga0070704_100303538 3300005549 Bacteria 1331
97 Ga0070704_100558771 3300005549 Bacteria 1001
98 Ga0068855_100042779 3300005563 Bacteria 5367
99 Ga0068855_100077030 3300005563 Bacteria 3869
100 Ga0068855_100475537 3300005563 Bacteria 1361
101 Ga0070664_100061003 3300005564 Bacteria 3213
102 Ga0068857_100020420 3300005577 Bacteria 5825
103 Ga0068857_100228283 3300005577 Bacteria 1702
104 Ga0068854_100530026 3300005578 Bacteria 996
105 Ga0068856_100022335 3300005614 Bacteria 6149
106 Ga0068856_100037193 3300005614 Bacteria 4775
107 Ga0068852_100014128 3300005616 Bacteria 6132
108 Ga0068852_100077928 3300005616 Bacteria 2931
109 Ga0068852_100162455 3300005616 Bacteria 2087
110 Ga0068852_100625075 3300005616 Bacteria 1083
111 Ga0068852_100703446 3300005616 Bacteria 1021
112 Ga0068852_100759915 3300005616 Bacteria 982
113 Ga0068859_100330197 3300005617 Bacteria 1619
114 Ga0068859_101175913 3300005617 Bacteria 844
115 Ga0068864_100016572 3300005618 Bacteria 6134
116 Ga0068864_100024569 3300005618 Bacteria 5071
117 Ga0068864_100235965 3300005618 Bacteria 1693
118 Ga0068861_100028347 3300005719 Bacteria 4085
119 Ga0068851_10151867 3300005834 Bacteria 1266
120 Ga0068851_10176881 3300005834 Bacteria 1180
121 Ga0068870_10124133 3300005840 Bacteria 1491
122 Ga0068863_100004895 3300005841 Bacteria 13197
123 Ga0068863_100184990 3300005841 Bacteria 2001
124 Ga0068863_100441190 3300005841 Bacteria 1277
125 Ga0068858_100129556 3300005842 Bacteria 2364
126 Ga0068860_100034119 3300005843 Bacteria 4880
127 Ga0068862_100135614 3300005844 Bacteria 2181
128 Ga0081540_1025908 3300005983 Bacteria 3361
129 Ga0070717_10207124 3300006028 Bacteria 1720
130 Ga0075364_10093909 3300006051 Bacteria 1992
131 Ga0075364_10155914 3300006051 Unclassified 1540
132 Ga0070716_100326977 3300006173 Bacteria 1076
133 Ga0075362_10075384 3300006177 Bacteria 1547
134 Ga0075367_10087059 3300006178 Bacteria 1897
135 Ga0075366_10147545 3300006195 Bacteria 1424
136 Ga0075366_10354479 3300006195 Bacteria 901
137 Ga0097621_100161484 3300006237 Bacteria 1926
138 Ga0097621_100570230 3300006237 Bacteria 1032
139 Ga0068871_100232668 3300006358 Bacteria 1600
140 Ga0068871_100234297 3300006358 Bacteria 1594
141 Ga0068871_100367475 3300006358 Bacteria 1275
142 Ga0068871_100671846 3300006358 Unclassified 947
143 Ga0075428_100028395 3300006844 Bacteria 6189
144 Ga0075431_100017138 3300006847 Bacteria 7365
145 Ga0075431_100392651 3300006847 Bacteria 1390
146 Ga0075433_10015394 3300006852 Bacteria 6272
147 Ga0075433_10224847 3300006852 Bacteria 1667
148 Ga0075433_10240777 3300006852 Bacteria 1606
149 Ga0075434_100091795 3300006871 Bacteria 3038
150 Ga0075434_100137884 3300006871 Bacteria 2459
151 Ga0075434_100310522 3300006871 Bacteria 1597
152 Ga0075434_100737499 3300006871 Unclassified 1002
153 Ga0075429_100356766 3300006880 Bacteria 1280
154 Ga0068865_100438093 3300006881 Bacteria 1078
155 Ga0097620_100330250 3300006931 Bacteria 1619
156 Ga0097620_101175865 3300006931 Bacteria 844
157 Ga0075435_100347094 3300007076 Bacteria 1272
158 Ga0075435_100361130 3300007076 Bacteria 1246
159 Ga0075435_100526087 3300007076 Bacteria 1023
160 Ga0099794_10010503 3300007265 Bacteria 3933
161 Ga0105240_10035211 3300009093 Bacteria 6453
162 Ga0105240_10166641 3300009093 Bacteria 2613
163 Ga0105240_10231444 3300009093 Bacteria 2147
164 Ga0105240_10289002 3300009093 Bacteria 1880
165 Ga0105240_10377097 3300009093 Bacteria 1602
166 Ga0105240_10564349 3300009093 Bacteria 1258
167 Ga0105240_10674134 3300009093 Unclassified 1131
168 Ga0111539_10068617 3300009094 Bacteria 4186
169 Ga0111539_10279910 3300009094 Bacteria 1941
170 Ga0105245_10059159 3300009098 Bacteria 3450
171 Ga0105245_10096380 3300009098 Bacteria 2730
172 Ga0105245_10285487 3300009098 Bacteria 1615
173 Ga0114129_10001176 3300009147 Bacteria 34702
174 Ga0114129_10073669 3300009147 Bacteria 4757
175 Ga0114129_10727649 3300009147 Bacteria 1273
176 Ga0105243_10191883 3300009148 Bacteria 1785
177 Ga0105241_10005239 3300009174 Bacteria 9578
178 Ga0105241_10015546 3300009174 Bacteria 5578
179 Ga0105241_10036994 3300009174 Bacteria 3675
180 Ga0105241_10097450 3300009174 Bacteria 2332
181 Ga0105241_10365390 3300009174 Bacteria 1257
182 Ga0105241_10484985 3300009174 Bacteria 1099
183 Ga0105241_10758095 3300009174 Bacteria 891
184 Ga0105242_10009248 3300009176 Bacteria 7562
185 Ga0105242_10374164 3300009176 Bacteria 1322
186 Ga0105242_10733492 3300009176 Unclassified 970
187 Ga0105242_11286942 3300009176 Bacteria 754
188 Ga0105248_10020605 3300009177 Bacteria 7308
189 Ga0105248_10266706 3300009177 Bacteria 1927
190 Ga0105248_10284800 3300009177 Bacteria 1861
191 Ga0105248_10520022 3300009177 Bacteria 1342
192 Ga0105237_10002146 3300009545 Bacteria 24848
193 Ga0105237_10187479 3300009545 Bacteria 2068
194 Ga0105237_10309093 3300009545 Bacteria 1584
195 Ga0105237_10313197 3300009545 Unclassified 1573
196 Ga0105237_10350985 3300009545 Bacteria 1479
197 Ga0105238_10009034 3300009551 Bacteria 9971
198 Ga0105238_10009438 3300009551 Bacteria 9767
199 Ga0105238_10048934 3300009551 Bacteria 4259
200 Ga0105238_10092243 3300009551 Bacteria 3016
201 Ga0105238_10219823 3300009551 Bacteria 1876
202 Ga0105238_10309940 3300009551 Bacteria 1563
203 Ga0105238_10554736 3300009551 Bacteria 1154
204 Ga0105249_10417750 3300009553 Bacteria 1374
205 Ga0105249_10552070 3300009553 Bacteria 1203
206 Ga0105249_10725112 3300009553 Bacteria 1055
207 Ga0105030_100615 3300009987 Bacteria 3183
208 Ga0105239_10036900 3300010375 Bacteria 5362
209 Ga0105239_10088739 3300010375 Bacteria 3410
210 Ga0105239_10103428 3300010375 Bacteria 3152
211 Ga0105239_10165491 3300010375 Bacteria 2473
212 Ga0105239_10756739 3300010375 Bacteria 1112
213 Ga0105239_11024179 3300010375 Bacteria 949
214 Ga0105246_10042177 3300011119 Bacteria 3089
215 Ga0157373_10080112 3300013100 Bacteria 2303
216 Ga0157371_10118730 3300013102 Bacteria 1880
217 Ga0157371_10167464 3300013102 Bacteria 1570
218 Ga0157370_10063842 3300013104 Bacteria 3487
219 Ga0157370_10130248 3300013104 Bacteria 2347
220 Ga0157370_10187390 3300013104 Bacteria 1921
221 Ga0157369_10000680 3300013105 Bacteria 43893
222 Ga0157369_10002989 3300013105 Bacteria 20239
223 Ga0157369_10008673 3300013105 Bacteria 11655
224 Ga0157374_10199729 3300013296 Bacteria 1958
225 Ga0157378_10000064 3300013297 Bacteria 93614
226 Ga0157378_10031796 3300013297 Bacteria 4661
227 Ga0157378_10299315 3300013297 Bacteria 1556
228 Ga0163162_10000004 3300013306 Bacteria 505593
229 Ga0163162_10007030 3300013306 Bacteria 10914
230 Ga0163162_10018592 3300013306 Bacteria 6809
231 Ga0163162_10092133 3300013306 Bacteria 3114
232 Ga0163162_10115075 3300013306 Bacteria 2789
233 Ga0163162_10319677 3300013306 Bacteria 1685
234 Ga0157372_10000277 3300013307 Bacteria 56848
235 Ga0157372_10165705 3300013307 Bacteria 2555
236 Ga0157372_10393264 3300013307 Bacteria 1615
237 Ga0157372_10536790 3300013307 Bacteria 1363
238 Ga0157372_10611392 3300013307 Bacteria 1270
239 Ga0157375_10002438 3300013308 Bacteria 16095
240 Ga0157375_10273146 3300013308 Bacteria 1853
241 Ga0157375_10694708 3300013308 Bacteria 1171
242 Ga0157375_11002925 3300013308 Bacteria 975
243 Ga0157375_11173084 3300013308 Bacteria 900
244 Ga0163163_10000105 3300014325 Bacteria 89594
245 Ga0163163_10000927 3300014325 Bacteria 24855
246 Ga0163163_10098967 3300014325 Bacteria 2938
247 Ga0163163_10244522 3300014325 Bacteria 1844
248 Ga0163163_10283086 3300014325 Bacteria 1710
249 Ga0163163_10504616 3300014325 Bacteria 1272
250 Ga0157380_10254224 3300014326 Bacteria 1592
251 Ga0182008_10128920 3300014497 Bacteria 1261
252 Ga0157377_10354373 3300014745 Bacteria 986
253 Ga0157379_10004161 3300014968 Bacteria 12351
254 Ga0157379_10019588 3300014968 Bacteria 5977
255 Ga0157376_10000933 3300014969 Bacteria 18990
256 Ga0157376_10001256 3300014969 Bacteria 16697
257 Ga0157376_10677226 3300014969 Bacteria 1034
258 Ga0182007_10099949 3300015262 Bacteria 960
259 Ga0163161_10232231 3300017792 Bacteria 1432
260 Ga0206349_1918908 3300020075 Bacteria 729
261 Ga0206355_1156896 3300020076 Bacteria 693
262 Ga0206352_10848697 3300020078 Bacteria 729
263 Ga0213872_10002413 3300021361 Bacteria 11019
264 Ga0213872_10068050 3300021361 Bacteria 1607
265 Ga0209435_100008 3300025206 Bacteria 503644
266 Ga0209436_111654 3300025208 Bacteria 1533
267 Ga0209674_100041 3300025226 Bacteria 396231
268 Ga0209563_100043 3300025230 Bacteria 397271
269 Ga0207425_1005696 3300025245 Bacteria 3512
270 Ga0209646_1000029 3300025246 Bacteria 386414
271 Ga0209026_1000016 3300025250 Bacteria 386457
272 Ga0209677_100096 3300025253 Bacteria 99089
273 Ga0209759_1000016 3300025256 Bacteria 386414
274 Ga0209233_1011340 3300025261 Bacteria 2629
275 Ga0209565_1001008 3300025263 Bacteria 14453
276 Ga0209130_1000014 3300025284 Bacteria 412039
277 Ga0209675_1003887 3300025291 Bacteria 6873
278 Ga0209758_1053869 3300025297 Bacteria 1378
279 Ga0209050_1002656 3300025298 Bacteria 14623
280 Ga0209256_1014087 3300025299 Bacteria 2910
281 Ga0207426_1000242 3300025302 Bacteria 122839
282 Ga0207656_10108680 3300025321 Bacteria 1279
283 Ga0207713_1055708 3300025735 Bacteria 1541
284 Ga0207642_10260893 3300025899 Bacteria 988
285 Ga0207688_10025745 3300025901 Bacteria 3233
286 Ga0207680_10000577 3300025903 Bacteria 17317
287 Ga0207680_10225922 3300025903 Bacteria 1285
288 Ga0207680_10298062 3300025903 Bacteria 1123
289 Ga0207647_10001783 3300025904 Bacteria 16497
290 Ga0207647_10017551 3300025904 Bacteria 4864
291 Ga0207647_10040973 3300025904 Bacteria 2914
292 Ga0207647_10361647 3300025904 Bacteria 821
293 Ga0207699_10012445 3300025906 Bacteria 4329
294 Ga0207645_10461123 3300025907 Bacteria 858
295 Ga0207705_10098841 3300025909 Bacteria 2145
296 Ga0207705_10302535 3300025909 Bacteria 1227
297 Ga0207654_10000432 3300025911 Bacteria 24010
298 Ga0207654_10012866 3300025911 Bacteria 4293
299 Ga0207654_10154827 3300025911 Bacteria 1475
300 Ga0207695_10000920 3300025913 Bacteria 52662
301 Ga0207695_10045191 3300025913 Bacteria 4678
302 Ga0207695_10149926 3300025913 Bacteria 2272
303 Ga0207695_10283230 3300025913 Bacteria 1551
304 Ga0207695_10851444 3300025913 Bacteria 792
305 Ga0207671_10001068 3300025914 Bacteria 33289
306 Ga0207671_10001915 3300025914 Bacteria 23107
307 Ga0207671_10027160 3300025914 Bacteria 4281
308 Ga0207671_10647953 3300025914 Bacteria 841
309 Ga0207693_10062617 3300025915 Bacteria 2914
310 Ga0207663_10079962 3300025916 Bacteria 2136
311 Ga0207660_10224020 3300025917 Bacteria 1477
312 Ga0207662_10316384 3300025918 Bacteria 1041
313 Ga0207657_10012705 3300025919 Bacteria 8296
314 Ga0207657_10033930 3300025919 Bacteria 4595
315 Ga0207657_10242576 3300025919 Bacteria 1438
316 Ga0207649_10002515 3300025920 Bacteria 10221
317 Ga0207649_10030427 3300025920 Bacteria 3197
318 Ga0207652_10185116 3300025921 Bacteria 1872
319 Ga0207646_10286788 3300025922 Bacteria 1488
320 Ga0207694_10004006 3300025924 Bacteria 11612
321 Ga0207694_10107784 3300025924 Bacteria 2214
322 Ga0207694_10220965 3300025924 Bacteria 1545
323 Ga0207694_10273723 3300025924 Bacteria 1385
324 Ga0207694_10368246 3300025924 Bacteria 1191
325 Ga0207694_10418347 3300025924 Bacteria 1116
326 Ga0207650_10022276 3300025925 Bacteria 4483
327 Ga0207659_10204089 3300025926 Bacteria 1580
328 Ga0207687_10243292 3300025927 Bacteria 1427
329 Ga0207687_10565602 3300025927 Bacteria 955
330 Ga0207700_10048811 3300025928 Bacteria 3145
331 Ga0207700_10569968 3300025928 Bacteria 1006
332 Ga0207664_10016026 3300025929 Bacteria 5459
333 Ga0207644_10181925 3300025931 Bacteria 1648
334 Ga0207644_10318394 3300025931 Bacteria 1257
335 Ga0207690_10001436 3300025932 Bacteria 14907
336 Ga0207690_10011538 3300025932 Bacteria 5278
337 Ga0207706_10045635 3300025933 Bacteria 3882
338 Ga0207706_10073189 3300025933 Bacteria 3013
339 Ga0207686_10002538 3300025934 Bacteria 9913
340 Ga0207686_10431317 3300025934 Bacteria 1010
341 Ga0207709_10072326 3300025935 Bacteria 2193
342 Ga0207669_10164287 3300025937 Unclassified 1572
343 Ga0207704_10433007 3300025938 Bacteria 1046
344 Ga0207665_10027516 3300025939 Bacteria 3756
345 Ga0207691_10023986 3300025940 Bacteria 5739
346 Ga0207711_10044392 3300025941 Bacteria 3794
347 Ga0207711_10331861 3300025941 Bacteria 1407
348 Ga0207711_10610212 3300025941 Bacteria 1018
349 Ga0207711_11111474 3300025941 Bacteria 731
350 Ga0207689_10193233 3300025942 Bacteria 1679
351 Ga0207689_10317396 3300025942 Bacteria 1293
352 Ga0207689_10662429 3300025942 Bacteria 880
353 Ga0207661_10348726 3300025944 Bacteria 1335
354 Ga0207679_10065498 3300025945 Bacteria 2719
355 Ga0207679_10139158 3300025945 Bacteria 1960
356 Ga0207667_10037846 3300025949 Bacteria 5157
357 Ga0207667_10169632 3300025949 Bacteria 2243
358 Ga0207667_10506443 3300025949 Bacteria 1224
359 Ga0207667_11131722 3300025949 Bacteria 765
360 Ga0207651_10021021 3300025960 Bacteria 3955
361 Ga0207640_10127557 3300025981 Bacteria 1834
362 Ga0207640_10628997 3300025981 Bacteria 912
363 Ga0207658_10052377 3300025986 Bacteria 3011
364 Ga0207677_10816423 3300026023 Bacteria 836
365 Ga0207703_10046638 3300026035 Bacteria 3491
366 Ga0207703_10074159 3300026035 Bacteria 2817
367 Ga0207703_10716986 3300026035 Bacteria 952
368 Ga0207639_10015303 3300026041 Bacteria 5409
369 Ga0207639_10039080 3300026041 Bacteria 3533
370 Ga0207639_10040521 3300026041 Bacteria 3477
371 Ga0207639_10045893 3300026041 Bacteria 3294
372 Ga0207639_10256441 3300026041 Bacteria 1527
373 Ga0207639_10372876 3300026041 Bacteria 1280
374 Ga0207639_10802394 3300026041 Bacteria 877
375 Ga0207678_10049131 3300026067 Bacteria 3645
376 Ga0207702_10005995 3300026078 Bacteria 10550
377 Ga0207702_11024167 3300026078 Bacteria 819
378 Ga0207641_10017105 3300026088 Bacteria 5932
379 Ga0207641_10088121 3300026088 Bacteria 2709
380 Ga0207641_10252434 3300026088 Bacteria 1648
381 Ga0207648_10037439 3300026089 Bacteria 4273
382 Ga0207648_10566830 3300026089 Unclassified 1044
383 Ga0207676_10017029 3300026095 Bacteria 5265
384 Ga0207676_10138511 3300026095 Bacteria 2080
385 Ga0207674_10000271 3300026116 Bacteria 65366
386 Ga0207674_10008203 3300026116 Bacteria 12103
387 Ga0207674_10150836 3300026116 Bacteria 2282
388 Ga0207675_100018731 3300026118 Bacteria 6462
389 Ga0207683_10100792 3300026121 Bacteria 2578
390 Ga0207698_10012482 3300026142 Bacteria 5561
391 Ga0207698_10060920 3300026142 Bacteria 2937
392 Ga0207698_10075803 3300026142 Bacteria 2690
393 Ga0207698_10124950 3300026142 Bacteria 2186
394 Ga0207698_11051845 3300026142 Bacteria 826
395 Ga0268266_10001450 3300028379 Bacteria 28199
396 Ga0268266_10003907 3300028379 Bacteria 14482
397 Ga0268266_10012796 3300028379 Bacteria 7248
398 Ga0268266_10296941 3300028379 Bacteria 1506
399 Ga0268265_10091107 3300028380 Bacteria 2437
400 Ga0268265_10570555 3300028380 Bacteria 1077
401 Ga0268264_10009270 3300028381 Bacteria 8151
402 Ga0268264_10037579 3300028381 Bacteria 3993
403 Ga0268264_10999311 3300028381 Bacteria 843
404 Ga0307515_10513481 3300028794 Bacteria 808
405 Ga0265338_10045176 3300028800 Bacteria 4054
406 Ga0265332_10196800 3300031238 Bacteria 838
407 Ga0265340_10006688 3300031247 Bacteria 6317
408 Ga0265340_10033223 3300031247 Bacteria 2570
409 Ga0265340_10145252 3300031247 Bacteria 1083
410 Ga0265331_10040995 3300031250 Bacteria 2251
411 Ga0265327_10000589 3300031251 Bacteria 60929
412 Ga0307513_10138812 3300031456 Bacteria 2361
413 Ga0307513_10489912 3300031456 Bacteria 948
414 Ga0307513_10494807 3300031456 Bacteria 941
415 Ga0307408_100282140 3300031548 Bacteria 1384
416 Ga0265313_10074665 3300031595 Bacteria 1554
417 Ga0307508_10018556 3300031616 Bacteria 6322
418 Ga0265314_10128459 3300031711 Bacteria 1584
419 Ga0307405_10390503 3300031731 Bacteria 1086
420 Ga0307413_10170935 3300031824 Bacteria 1538
421 Ga0307413_10231159 3300031824 Bacteria 1358
422 Ga0307410_10001801 3300031852 Bacteria 9933
423 Ga0307406_10122792 3300031901 Bacteria 1809
424 Ga0307407_10207383 3300031903 Bacteria 1317
425 Ga0307412_10164424 3300031911 Bacteria 1653
426 Ga0307412_10427591 3300031911 Bacteria 1085
427 Ga0307409_100008147 3300031995 Bacteria 6332
428 Ga0307416_100006649 3300032002 Bacteria 7256
429 Ga0307416_100100479 3300032002 Bacteria 2516
430 Ga0307414_10107132 3300032004 Bacteria 2117
431 Ga0307411_10075330 3300032005 Bacteria 2303
432 Ga0307415_100050041 3300032126 Bacteria 2829
433 Ga0307415_100972468 3300032126 Bacteria 787
434 Ga0307415_100981340 3300032126 Bacteria 784
435 Ga0307510_10000025 3300033180 Bacteria 132169
436 Ga0373923_0302380 3300035111 Bacteria 757
437 Ga0373936_0078048 3300035113 Bacteria 1374
438 Ga0373937_0057350 3300036401 Bacteria 3577
439 Ga0373937_1012061 3300036401 Bacteria 780
440 Ga0395899_0339620 3300037312 Bacteria 1007
441 Ga0395900_0493053 3300037418 Bacteria 1176
442 Ga0395900_0759110 3300037418 Bacteria 900
443 Ga0395898_0012654 3300037466 Bacteria 8722
444 Ga0395905_0010861 3300037471 Bacteria 8821
445 Ga0395905_0039569 3300037471 Bacteria 4423
446 Ga0395901_0002015 3300038443 Bacteria 20901
447 Ga0436365_0856036 3300039437 Bacteria 1096
448 Ga0436360_1341053 3300039438 Bacteria 3245
449 Ga0436361_0108001 3300039447 Bacteria 112244
450 Ga0436361_0667408 3300039447 Bacteria 1724
451 Ga0436361_0808386 3300039447 Bacteria 2615
452 Ga0436362_0554176 3300039453 Bacteria 728
453 Ga0439439_0027398 3300041406 Bacteria 1440
454 Ga0439439_0029413 3300041406 Bacteria 1394
455 Ga0451795_0568060 3300041456 Bacteria 1034
456 Ga0451802_1684582 3300041460 Bacteria 1091
457 Ga0451804_0390599 3300041463 Bacteria 910
458 Ga0451833_1175627 3300041491 Bacteria 705
459 Ga0451847_0920145 3300041503 Bacteria 707
460 Ga0451849_1070750 3300041505 Bacteria 1506
461 Ga0451853_1431401 3300041512 Bacteria 1594
462 Ga0439455_0013240 3300042012 Bacteria 1865
463 Ga0439462_0088863 3300042015 Bacteria 847
464 Ga0450898_021201 3300042134 Bacteria 1143
465 Ga0439446_0007304 3300042156 Bacteria 2903
466 Ga0439446_0008112 3300042156 Bacteria 2779
467 Ga0450908_004216 3300042184 Bacteria 2781
468 Ga0439434_0000842 3300042435 Bacteria 8840
469 Ga0451577_0203138 3300042876 Bacteria 1789
470 Ga0466969_0007183 3300044656 Bacteria 5924
471 Ga0466965_0068166 3300044683 Bacteria 1786
472 Ga0466966_0008473 3300044684 Bacteria 6807
473 Ga0466961_0000034 3300044693 Bacteria 84993
474 Ga0466964_0266151 3300044706 Bacteria 851
475 Ga0466957_0281194 3300044842 Bacteria 1114
476 Ga0466960_0020410 3300044901 Bacteria 2934
477 Ga0466959_0116595 3300045049 Bacteria 1901
478 Ga0451576_0035746 3300045051 Bacteria 5269
479 Ga0451576_0410082 3300045051 Bacteria 1421
480 Ga0466958_0007106 3300045836 Bacteria 6131
481 Ga0466967_0859285 3300045976 Bacteria 902
482 Ga0495591_000604 3300046458 Bacteria 27206
483 Ga0495638_0033535 3300046460 Bacteria 3284
484 Ga0495638_0093041 3300046460 Bacteria 1814
485 Ga0495582_0066129 3300046473 Bacteria 1997
486 Ga0495639_0025058 3300046475 Bacteria 2629
487 Ga0495632_0010313 3300046519 Bacteria 5544
488 Ga0495643_0073124 3300046522 Bacteria 1797
489 Ga0495621_0167334 3300046539 Bacteria 872
490 Ga0495645_0025960 3300046543 Bacteria 4253
491 Ga0495661_0000840 3300046665 Bacteria 28644
492 Ga0495661_0033244 3300046665 Eukaryota 3254
493 Ga0495588_0028521 3300046674 Bacteria 2794
494 Ga0495646_0186462 3300046680 Bacteria 1136
495 Ga0495581_0265721 3300047315 Bacteria 1003
496 Ga0495672_0052289 3300047320 Bacteria 2400
497 Ga0495684_0569725 3300047471 Bacteria 768
498 Ga0495686_0030984 3300047472 Bacteria 3471
499 Ga0495615_0021045 3300048090 Bacteria 1468
500 Ga0496102_0193343 3300048905 Bacteria 1917
501 Ga0496102_0633901 3300048905 Bacteria 992
502 Ga0496103_0256854 3300048906 Unclassified 1124
503 Ga0496103_0521837 3300048906 Bacteria 759
504 Ga0496104_0000005 3300048907 Bacteria 620360
505 Ga0496105_0000016 3300048908 Bacteria 212909
506 Ga0496105_0503275 3300048908 Unclassified 951
507 Ga0496107_0087734 3300048910 Bacteria 2271
508 Ga0496114_0840564 3300048917 Bacteria 798
509 Ga0496115_0273394 3300048918 Bacteria 1388
510 Ga0496117_0000077 3300048920 Bacteria 227735
511 Ga0496118_0000026 3300048921 Bacteria 375725
512 Ga0496119_0013115 3300048922 Bacteria 6637
513 Ga0496120_0000648 3300048923 Bacteria 51270
514 Ga0496120_0015330 3300048923 Bacteria 5061
515 Ga0496120_0035504 3300048923 Eukaryota 2977
516 Ga0496120_0216298 3300048923 Bacteria 918
517 Ga0496121_0051696 3300048924 Bacteria 3458
518 Ga0496124_0030697 3300048927 Bacteria 4765
519 Ga0496125_0020338 3300048928 Bacteria 6229
520 Ga0496126_0028834 3300048929 Bacteria 5282
521 Ga0501315_029955 3300049531 Bacteria 779
522 Ga0501032_0208358 3300049569 Bacteria 1275
523 Ga0501036_0411919 3300049572 Bacteria 1127
524 Ga0501037_0031570 3300049573 Bacteria 3911
525 Ga0501037_0293802 3300049573 Bacteria 1130
526 Ga0501038_0044719 3300049574 Bacteria 3846
527 Ga0501038_0154363 3300049574 Bacteria 1870
528 Ga0501038_0364837 3300049574 Bacteria 1123
529 Ga0501039_0154491 3300049575 Bacteria 1803
530 Ga0501040_0167047 3300049576 Bacteria 1557
531 Ga0501043_0552116 3300049579 Bacteria 856
532 Ga0501046_0149851 3300049580 Bacteria 1760
533 Ga0501046_0169436 3300049580 Bacteria 1639
534 Ga0501047_0002342 3300049581 Bacteria 18113
535 Ga0501047_0031512 3300049581 Bacteria 5113
536 Ga0501047_0275407 3300049581 Bacteria 1528
537 Ga0501067_0115396 3300049583 Bacteria 1494
538 Ga0501068_0050151 3300049584 Bacteria 2523
539 Ga0501068_0397373 3300049584 Bacteria 888
540 Ga0501070_0009050 3300049586 Bacteria 8423
541 Ga0501073_0001667 3300049589 Bacteria 16449
542 Ga0501073_0015830 3300049589 Bacteria 5464
543 Ga0501073_0048026 3300049589 Bacteria 2998
544 Ga0501074_0026584 3300049590 Bacteria 4197
545 Ga0501080_0003532 3300049742 Bacteria 13776
546 Ga0501080_0012786 3300049742 Bacteria 7700
547 Ga0501035_0061927 3300049822 Bacteria 3329
548 Ga0501035_0402271 3300049822 Bacteria 1139
549 Ga0501044_0004292 3300049823 Bacteria 15988
550 Ga0501045_0142827 3300049824 Bacteria 1780
551 nmdc:mga03683_27152_c1 3300050489 Bacteria 2264
552 nmdc:mga00v17_244438_c1 3300050491 Bacteria 1164
553 nmdc:mga00v17_61050_c1 3300050491 Unclassified 2316
554 nmdc:mga05p37_621882_c1 3300050507 Bacteria 1215
555 nmdc:mga05p37_6324_c1 3300050507 Bacteria 13950
556 nmdc:mga05p37_77261_c1 3300050507 Bacteria 4099
557 nmdc:mga09592_287347_c1 3300050508 Bacteria 1426
558 nmdc:mga06r32_209371_c1 3300050510 Bacteria 1938
559 nmdc:mga06r32_549937_c1 3300050510 Unclassified 1128
560 nmdc:mga0n895_128628_c1 3300050512 Bacteria 2557
561 nmdc:mga0n895_275690_c1 3300050512 Bacteria 1706
562 nmdc:mga0n895_329498_c1 3300050512 Bacteria 1547
563 nmdc:mga0n895_69171_c1 3300050512 Bacteria 3497
564 nmdc:mga0rr50_318147_c1 3300050513 Bacteria 1304
565 nmdc:mga0rr50_417877_c1 3300050513 Bacteria 1134
566 nmdc:mga0rr50_735952_c1 3300050513 Bacteria 842
567 nmdc:mga0a205_4732_c1 3300050515 Bacteria 12224
568 nmdc:mga0a205_7668_c1 3300050515 Bacteria 9791
569 Ga0500643_000032 3300053087 Bacteria 200350
570 Ga0500643_000169 3300053087 Bacteria 64699
571 Ga0500644_0038746 3300053088 Bacteria 1567
572 Ga0500566_0014073 3300053094 Bacteria 4702
573 Ga0500641_0029252 3300053096 Bacteria 2158
574 Ga0500555_006629 3300053103 Bacteria 3291
575 Ga0500555_049426 3300053103 Bacteria 1153
576 Ga0500592_023369 3300053116 Bacteria 997
577 Ga0500593_000998 3300053117 Bacteria 10283
578 Ga0500595_035915 3300053119 Bacteria 1628
579 Ga0500618_002128 3300053125 Bacteria 7817
580 Ga0500642_0209155 3300053130 Bacteria 906
581 Ga0500652_050300 3300053131 Bacteria 1700
582 Ga0500652_171337 3300053131 Bacteria 893
583 Ga0500658_0140815 3300053134 Bacteria 1082
584 Ga0500658_0268564 3300053134 Bacteria 784
585 Ga0500568_0026172 3300053139 Unclassified 2451
586 Ga0500568_0045294 3300053139 Bacteria 1751
587 Ga0500604_0088769 3300053151 Bacteria 1007
588 Ga0500636_0000210 3300053177 Bacteria 31824
589 Ga0501084_0066313 3300054114 Bacteria 3020
590 Ga0501082_0015663 3300060353 Bacteria 6524
591 Ga0530510_0675450 3300061734 Bacteria 787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048923 Ga0496120_0216298 Ga0496120_0216298_389_901 165
2 3300053134 Ga0500658_0140815 Ga0500658_0140815_337_858 173
3 3300009553 Ga0105249_10725112 Ga0105249_107251121 174
4 3300041491 Ga0451833_1175627 Ga0451833_1175627_66_635 188
5 3300039447 Ga0436361_0808386 Ga0436361_0808386_77_688 190
6 3300046665 Ga0495661_0033244 Ga0495661_0033244_2524_3192 191
7 3300048923 Ga0496120_0035504 Ga0496120_0035504_607_1275 191
8 3300009147 Ga0114129_10073669 Ga0114129_100736696 195
9 3300026142 Ga0207698_11051845 Ga0207698_110518451 195
10 3300049572 Ga0501036_0411919 Ga0501036_0411919_421_1008 195
11 3300049573 Ga0501037_0031570 Ga0501037_0031570_1528_2115 195
12 3300049574 Ga0501038_0044719 Ga0501038_0044719_1425_2012 195
13 3300049580 Ga0501046_0169436 Ga0501046_0169436_933_1520 195
14 3300049581 Ga0501047_0031512 Ga0501047_0031512_16_603 195
15 3300049822 Ga0501035_0061927 Ga0501035_0061927_1785_2372 195
16 3300049823 Ga0501044_0004292 Ga0501044_0004292_7832_8419 195
17 3300050507 nmdc:mga05p37_77261_c1 nmdc:mga05p37_77261_c1_3262_3852 195
18 iso_pu_bacteria 2935908558 2935908895 195
19 iso_pu_bacteria 2935916978 2935919614 195
20 iso_pu_bacteria 2935926038 2935926531 195
21 iso_pu_bacteria 2935934488 2935934981 195
22 iso_pu_bacteria 2935942939 2935943431 195
23 iso_pu_bacteria 2935951376 2935951869 195
24 iso_pu_bacteria 2935967501 2935967994 195
25 iso_pu_bacteria 8019687851 8019690294 195
26 3300045836 Ga0466958_0007106 Ga0466958_0007106_1779_2378 196
27 3300005327 Ga0070658_10254397 Ga0070658_102543971 197
28 3300005339 Ga0070660_100181564 Ga0070660_1001815643 197
29 3300005539 Ga0068853_100100679 Ga0068853_1001006794 197
30 3300005548 Ga0070665_100000668 Ga0070665_1000006682 197
31 3300005563 Ga0068855_100077030 Ga0068855_1000770302 197
32 3300009093 Ga0105240_10166641 Ga0105240_101666415 197
33 3300009093 Ga0105240_10231444 Ga0105240_102314442 197
34 3300009551 Ga0105238_10219823 Ga0105238_102198232 197
35 3300009551 Ga0105238_10309940 Ga0105238_103099402 197
36 3300010375 Ga0105239_10756739 Ga0105239_107567392 197
37 3300013104 Ga0157370_10130248 Ga0157370_101302482 197
38 3300013104 Ga0157370_10187390 Ga0157370_101873903 197
39 3300025913 Ga0207695_10851444 Ga0207695_108514441 197
40 3300025919 Ga0207657_10033930 Ga0207657_100339303 197
41 3300025924 Ga0207694_10220965 Ga0207694_102209652 197
42 3300025924 Ga0207694_10273723 Ga0207694_102737231 197
43 3300025944 Ga0207661_10348726 Ga0207661_103487261 197
44 3300025949 Ga0207667_10169632 Ga0207667_101696324 197
45 3300025949 Ga0207667_11131722 Ga0207667_111317221 197
46 3300025981 Ga0207640_10628997 Ga0207640_106289972 197
47 3300028379 Ga0268266_10003907 Ga0268266_1000390713 197
48 3300028800 Ga0265338_10045176 Ga0265338_100451762 197
49 3300031238 Ga0265332_10196800 Ga0265332_101968002 197
50 3300031247 Ga0265340_10033223 Ga0265340_100332233 197
51 3300031250 Ga0265331_10040995 Ga0265331_100409952 197
52 3300031595 Ga0265313_10074665 Ga0265313_100746652 197
53 3300031711 Ga0265314_10128459 Ga0265314_101284592 197
54 3300037466 Ga0395898_0012654 Ga0395898_0012654_235_828 197
55 3300044842 Ga0466957_0281194 Ga0466957_0281194_139_738 197
56 3300048917 Ga0496114_0840564 Ga0496114_0840564_144_743 197
57 3300048929 Ga0496126_0028834 Ga0496126_0028834_637_1230 197
58 3300049589 Ga0501073_0048026 Ga0501073_0048026_1920_2513 197
59 3300053087 Ga0500643_000169 Ga0500643_000169_63594_64187 197
60 3300053134 Ga0500658_0268564 Ga0500658_0268564_75_668 197
61 3300053151 Ga0500604_0088769 Ga0500604_0088769_262_855 197
62 iso_pu_bacteria 2842775625 2842777977 197
63 3300021361 Ga0213872_10068050 Ga0213872_100680503 198
64 3300039447 Ga0436361_0667408 Ga0436361_0667408_619_1218 198
65 3300046460 Ga0495638_0033535 Ga0495638_0033535_2625_3221 198
66 iso_pu_bacteria 2511231002 2511244212 198
67 3300005339 Ga0070660_100348026 Ga0070660_1003480262 199
68 3300005616 Ga0068852_100625075 Ga0068852_1006250752 199
69 3300009551 Ga0105238_10554736 Ga0105238_105547361 199
70 3300009987 Ga0105030_100615 Ga0105030_1006153 199
71 3300010375 Ga0105239_11024179 Ga0105239_110241792 199
72 3300026041 Ga0207639_10372876 Ga0207639_103728762 199
73 3300026067 Ga0207678_10049131 Ga0207678_100491314 199
74 3300026142 Ga0207698_10124950 Ga0207698_101249502 199
75 3300041460 Ga0451802_1684582 Ga0451802_1684582_196_798 199
76 3300041463 Ga0451804_0390599 Ga0451804_0390599_122_724 199
77 3300041512 Ga0451853_1431401 Ga0451853_1431401_42_644 199
78 3300047320 Ga0495672_0052289 Ga0495672_0052289_1667_2266 199
79 3300049584 Ga0501068_0397373 Ga0501068_0397373_79_702 199
80 3300049589 Ga0501073_0015830 Ga0501073_0015830_3190_3813 199
81 3300049590 Ga0501074_0026584 Ga0501074_0026584_3346_3969 199
82 3300049742 Ga0501080_0003532 Ga0501080_0003532_7425_8048 199
83 3300053087 Ga0500643_000032 Ga0500643_000032_19612_20214 199
84 3300053094 Ga0500566_0014073 Ga0500566_0014073_2215_2817 199
85 3300053096 Ga0500641_0029252 Ga0500641_0029252_1314_1916 199
86 3300053103 Ga0500555_006629 Ga0500555_006629_662_1264 199
87 3300053116 Ga0500592_023369 Ga0500592_023369_150_752 199
88 3300053130 Ga0500642_0209155 Ga0500642_0209155_98_700 199
89 3300053131 Ga0500652_171337 Ga0500652_171337_54_656 199
90 3300053139 Ga0500568_0045294 Ga0500568_0045294_265_867 199
91 3300054114 Ga0501084_0066313 Ga0501084_0066313_682_1305 199
92 3300060353 Ga0501082_0015663 Ga0501082_0015663_128_751 199
93 iso_pu_bacteria 2643221603 2644029887 199
94 3300005327 Ga0070658_10454845 Ga0070658_104548451 200
95 3300005436 Ga0070713_101291335 Ga0070713_1012913351 200
96 3300005535 Ga0070684_100322598 Ga0070684_1003225982 200
97 3300005547 Ga0070693_100021797 Ga0070693_1000217973 200
98 3300005548 Ga0070665_100016965 Ga0070665_1000169655 200
99 3300006051 Ga0075364_10155914 Ga0075364_101559142 200
100 3300006358 Ga0068871_100671846 Ga0068871_1006718462 200
101 3300009093 Ga0105240_10564349 Ga0105240_105643491 200
102 3300009093 Ga0105240_10674134 Ga0105240_106741342 200
103 3300009177 Ga0105248_10520022 Ga0105248_105200221 200
104 3300009551 Ga0105238_10092243 Ga0105238_100922432 200
105 3300010375 Ga0105239_10165491 Ga0105239_101654912 200
106 3300014325 Ga0163163_10244522 Ga0163163_102445221 200
107 3300025924 Ga0207694_10368246 Ga0207694_103682462 200
108 3300025941 Ga0207711_10610212 Ga0207711_106102121 200
109 3300026023 Ga0207677_10816423 Ga0207677_108164231 200
110 3300028379 Ga0268266_10012796 Ga0268266_100127964 200
111 3300028794 Ga0307515_10513481 Ga0307515_105134811 200
112 3300031456 Ga0307513_10489912 Ga0307513_104899121 200
113 3300045976 Ga0466967_0859285 Ga0466967_0859285_16_621 200
114 3300046458 Ga0495591_000604 Ga0495591_000604_16172_16774 200
115 3300046519 Ga0495632_0010313 Ga0495632_0010313_109_711 200
116 3300046665 Ga0495661_0000840 Ga0495661_0000840_10519_11121 200
117 3300050491 nmdc:mga00v17_61050_c1 nmdc:mga00v17_61050_c1_686_1288 200
118 3300003214 JGI25165J46597_1014494 JGI25165J46597_10144942 201
119 3300003911 JGI25405J52794_10049997 JGI25405J52794_100499972 201
120 3300005341 Ga0070691_10007124 Ga0070691_100071244 201
121 3300005347 Ga0070668_100539108 Ga0070668_1005391082 201
122 3300005439 Ga0070711_100546532 Ga0070711_1005465321 201
123 3300005440 Ga0070705_100131282 Ga0070705_1001312823 201
124 3300005444 Ga0070694_100105443 Ga0070694_1001054433 201
125 3300005536 Ga0070697_100307991 Ga0070697_1003079913 201
126 3300005545 Ga0070695_100020522 Ga0070695_1000205226 201
127 3300005719 Ga0068861_100028347 Ga0068861_1000283476 201
128 3300005983 Ga0081540_1025908 Ga0081540_10259084 201
129 3300006173 Ga0070716_100326977 Ga0070716_1003269771 201
130 3300006844 Ga0075428_100028395 Ga0075428_1000283957 201
131 3300006852 Ga0075433_10015394 Ga0075433_100153946 201
132 3300006852 Ga0075433_10240777 Ga0075433_102407772 201
133 3300006871 Ga0075434_100737499 Ga0075434_1007374991 201
134 3300006880 Ga0075429_100356766 Ga0075429_1003567661 201
135 3300007076 Ga0075435_100361130 Ga0075435_1003611302 201
136 3300007076 Ga0075435_100526087 Ga0075435_1005260872 201
137 3300007265 Ga0099794_10010503 Ga0099794_100105032 201
138 3300009093 Ga0105240_10377097 Ga0105240_103770972 201
139 3300009094 Ga0111539_10279910 Ga0111539_102799102 201
140 3300009147 Ga0114129_10001176 Ga0114129_100011768 201
141 3300009147 Ga0114129_10727649 Ga0114129_107276492 201
142 3300009176 Ga0105242_10733492 Ga0105242_107334921 201
143 3300009545 Ga0105237_10187479 Ga0105237_101874793 201
144 3300009545 Ga0105237_10313197 Ga0105237_103131972 201
145 3300025261 Ga0209233_1011340 Ga0209233_10113402 201
146 3300025735 Ga0207713_1055708 Ga0207713_10557082 201
147 3300025914 Ga0207671_10647953 Ga0207671_106479531 201
148 3300025915 Ga0207693_10062617 Ga0207693_100626172 201
149 3300025916 Ga0207663_10079962 Ga0207663_100799622 201
150 3300025928 Ga0207700_10569968 Ga0207700_105699681 201
151 3300025939 Ga0207665_10027516 Ga0207665_100275162 201
152 3300026118 Ga0207675_100018731 Ga0207675_1000187314 201
153 3300031251 Ga0265327_10000589 Ga0265327_1000058918 201
154 3300031911 Ga0307412_10164424 Ga0307412_101644242 201
155 3300032002 Ga0307416_100100479 Ga0307416_1001004793 201
156 3300039453 Ga0436362_0554176 Ga0436362_0554176_77_682 201
157 3300042876 Ga0451577_0203138 Ga0451577_0203138_40_645 201
158 3300044901 Ga0466960_0020410 Ga0466960_0020410_818_1429 201
159 3300045051 Ga0451576_0035746 Ga0451576_0035746_4093_4698 201
160 3300048918 Ga0496115_0273394 Ga0496115_0273394_154_759 201
161 3300050507 nmdc:mga05p37_621882_c1 nmdc:mga05p37_621882_c1_354_962 201
162 3300050507 nmdc:mga05p37_6324_c1 nmdc:mga05p37_6324_c1_8880_9485 201
163 3300050508 nmdc:mga09592_287347_c1 nmdc:mga09592_287347_c1_551_1159 201
164 3300050512 nmdc:mga0n895_69171_c1 nmdc:mga0n895_69171_c1_2856_3461 201
165 3300050513 nmdc:mga0rr50_318147_c1 nmdc:mga0rr50_318147_c1_664_1269 201
166 3300050513 nmdc:mga0rr50_735952_c1 nmdc:mga0rr50_735952_c1_49_654 201
167 3300050515 nmdc:mga0a205_4732_c1 nmdc:mga0a205_4732_c1_11222_11827 201
168 3300002705 JGI25156J39149_1000009 JGI25156J39149_1000009202 202
169 3300002738 JGI25154J39366_1000024 JGI25154J39366_1000024202 202
170 3300002741 JGI25157J39369_1000007 JGI25157J39369_1000007202 202
171 3300002987 JGI25159J45721_1000314 JGI25159J45721_10003146 202
172 3300003354 JGI25160J50197_1000131 JGI25160J50197_100013151 202
173 3300003374 JGI25161J50226_1000009 JGI25161J50226_100000921 202
174 3300003773 Ga0055537_1018448 Ga0055537_10184482 202
175 3300003784 Ga0055534_1017490 Ga0055534_10174901 202
176 3300004625 Ga0055543_1000122 Ga0055543_100012244 202
177 3300005262 Ga0065165_1009960 Ga0065165_10099602 202
178 3300005262 Ga0065165_1016071 Ga0065165_10160711 202
179 3300005336 Ga0070680_100028823 Ga0070680_1000288232 202
180 3300005336 Ga0070680_100505686 Ga0070680_1005056862 202
181 3300005364 Ga0070673_100539473 Ga0070673_1005394731 202
182 3300005435 Ga0070714_100005041 Ga0070714_10000504110 202
183 3300005445 Ga0070708_100414118 Ga0070708_1004141181 202
184 3300005456 Ga0070678_100001672 Ga0070678_1000016729 202
185 3300005458 Ga0070681_10020234 Ga0070681_100202342 202
186 3300005467 Ga0070706_100306308 Ga0070706_1003063082 202
187 3300005468 Ga0070707_100048186 Ga0070707_1000481862 202
188 3300005530 Ga0070679_100168250 Ga0070679_1001682502 202
189 3300005530 Ga0070679_100533327 Ga0070679_1005333272 202
190 3300005536 Ga0070697_100098379 Ga0070697_1000983792 202
191 3300005543 Ga0070672_100097277 Ga0070672_1000972772 202
192 3300005545 Ga0070695_100236566 Ga0070695_1002365662 202
193 3300005549 Ga0070704_100303538 Ga0070704_1003035381 202
194 3300005616 Ga0068852_100162455 Ga0068852_1001624553 202
195 3300005618 Ga0068864_100024569 Ga0068864_1000245692 202
196 3300005834 Ga0068851_10151867 Ga0068851_101518672 202
197 3300006051 Ga0075364_10093909 Ga0075364_100939092 202
198 3300006177 Ga0075362_10075384 Ga0075362_100753843 202
199 3300006178 Ga0075367_10087059 Ga0075367_100870593 202
200 3300006195 Ga0075366_10147545 Ga0075366_101475452 202
201 3300006237 Ga0097621_100161484 Ga0097621_1001614843 202
202 3300006358 Ga0068871_100232668 Ga0068871_1002326682 202
203 3300006847 Ga0075431_100392651 Ga0075431_1003926512 202
204 3300007076 Ga0075435_100347094 Ga0075435_1003470942 202
205 3300009545 Ga0105237_10350985 Ga0105237_103509851 202
206 3300013307 Ga0157372_10536790 Ga0157372_105367901 202
207 3300013308 Ga0157375_10273146 Ga0157375_102731463 202
208 3300014325 Ga0163163_10283086 Ga0163163_102830862 202
209 3300014969 Ga0157376_10001256 Ga0157376_100012569 202
210 3300025206 Ga0209435_100008 Ga0209435_100008109 202
211 3300025208 Ga0209436_111654 Ga0209436_1116541 202
212 3300025245 Ga0207425_1005696 Ga0207425_10056963 202
213 3300025246 Ga0209646_1000029 Ga0209646_1000029169 202
214 3300025250 Ga0209026_1000016 Ga0209026_1000016169 202
215 3300025256 Ga0209759_1000016 Ga0209759_1000016169 202
216 3300025263 Ga0209565_1001008 Ga0209565_10010087 202
217 3300025284 Ga0209130_1000014 Ga0209130_1000014206 202
218 3300025291 Ga0209675_1003887 Ga0209675_10038872 202
219 3300025297 Ga0209758_1053869 Ga0209758_10538692 202
220 3300025298 Ga0209050_1002656 Ga0209050_100265612 202
221 3300025299 Ga0209256_1014087 Ga0209256_10140873 202
222 3300025302 Ga0207426_1000242 Ga0207426_100024293 202
223 3300025321 Ga0207656_10108680 Ga0207656_101086802 202
224 3300025909 Ga0207705_10098841 Ga0207705_100988412 202
225 3300025917 Ga0207660_10224020 Ga0207660_102240202 202
226 3300025922 Ga0207646_10286788 Ga0207646_102867882 202
227 3300025925 Ga0207650_10022276 Ga0207650_100222763 202
228 3300025926 Ga0207659_10204089 Ga0207659_102040892 202
229 3300025929 Ga0207664_10016026 Ga0207664_100160263 202
230 3300025931 Ga0207644_10181925 Ga0207644_101819252 202
231 3300025940 Ga0207691_10023986 Ga0207691_100239865 202
232 3300025960 Ga0207651_10021021 Ga0207651_100210211 202
233 3300026095 Ga0207676_10017029 Ga0207676_100170292 202
234 3300026142 Ga0207698_10075803 Ga0207698_100758033 202
235 3300028380 Ga0268265_10570555 Ga0268265_105705552 202
236 3300031247 Ga0265340_10006688 Ga0265340_100066883 202
237 3300031247 Ga0265340_10145252 Ga0265340_101452521 202
238 3300031456 Ga0307513_10138812 Ga0307513_101388123 202
239 3300031456 Ga0307513_10494807 Ga0307513_104948071 202
240 3300031824 Ga0307413_10170935 Ga0307413_101709352 202
241 3300031911 Ga0307412_10427591 Ga0307412_104275912 202
242 3300035111 Ga0373923_0302380 Ga0373923_0302380_30_638 202
243 3300035113 Ga0373936_0078048 Ga0373936_0078048_418_1071 202
244 3300036401 Ga0373937_1012061 Ga0373937_1012061_113_721 202
245 3300037471 Ga0395905_0039569 Ga0395905_0039569_3246_3854 202
246 3300041456 Ga0451795_0568060 Ga0451795_0568060_106_714 202
247 3300041505 Ga0451849_1070750 Ga0451849_1070750_190_798 202
248 3300044656 Ga0466969_0007183 Ga0466969_0007183_4745_5359 202
249 3300044683 Ga0466965_0068166 Ga0466965_0068166_189_803 202
250 3300044684 Ga0466966_0008473 Ga0466966_0008473_2626_3240 202
251 3300044693 Ga0466961_0000034 Ga0466961_0000034_4402_5016 202
252 3300044706 Ga0466964_0266151 Ga0466964_0266151_219_827 202
253 3300045049 Ga0466959_0116595 Ga0466959_0116595_971_1585 202
254 3300045051 Ga0451576_0410082 Ga0451576_0410082_370_990 202
255 3300046460 Ga0495638_0093041 Ga0495638_0093041_605_1213 202
256 3300046539 Ga0495621_0167334 Ga0495621_0167334_50_658 202
257 3300046674 Ga0495588_0028521 Ga0495588_0028521_905_1513 202
258 3300048090 Ga0495615_0021045 Ga0495615_0021045_158_766 202
259 3300048905 Ga0496102_0193343 Ga0496102_0193343_1219_1827 202
260 3300048905 Ga0496102_0633901 Ga0496102_0633901_20_628 202
261 3300049569 Ga0501032_0208358 Ga0501032_0208358_513_1127 202
262 3300049574 Ga0501038_0154363 Ga0501038_0154363_1201_1815 202
263 3300049574 Ga0501038_0364837 Ga0501038_0364837_237_845 202
264 3300049575 Ga0501039_0154491 Ga0501039_0154491_951_1565 202
265 3300049576 Ga0501040_0167047 Ga0501040_0167047_23_631 202
266 3300049581 Ga0501047_0275407 Ga0501047_0275407_558_1172 202
267 3300049589 Ga0501073_0001667 Ga0501073_0001667_9486_10097 202
268 3300049822 Ga0501035_0402271 Ga0501035_0402271_84_698 202
269 3300049824 Ga0501045_0142827 Ga0501045_0142827_684_1292 202
270 3300050489 nmdc:mga03683_27152_c1 nmdc:mga03683_27152_c1_371_979 202
271 3300050491 nmdc:mga00v17_244438_c1 nmdc:mga00v17_244438_c1_38_646 202
272 3300050510 nmdc:mga06r32_549937_c1 nmdc:mga06r32_549937_c1_238_852 202
273 3300050513 nmdc:mga0rr50_417877_c1 nmdc:mga0rr50_417877_c1_20_628 202
274 3300053088 Ga0500644_0038746 Ga0500644_0038746_731_1339 202
275 3300053117 Ga0500593_000998 Ga0500593_000998_4164_4772 202
276 3300053131 Ga0500652_050300 Ga0500652_050300_568_1176 202
277 3300053139 Ga0500568_0026172 Ga0500568_0026172_1367_1975 202
278 3300053177 Ga0500636_0000210 Ga0500636_0000210_20971_21579 202
279 3300003752 Ga0055539_1000222 Ga0055539_100022229 203
280 3300003756 Ga0055533_1000016 Ga0055533_1000016168 203
281 3300003759 Ga0055525_1001185 Ga0055525_10011855 203
282 3300005336 Ga0070680_100759072 Ga0070680_1007590721 203
283 3300005337 Ga0070682_100500494 Ga0070682_1005004942 203
284 3300005548 Ga0070665_100183759 Ga0070665_1001837593 203
285 3300006847 Ga0075431_100017138 Ga0075431_1000171389 203
286 3300009093 Ga0105240_10289002 Ga0105240_102890022 203
287 3300009174 Ga0105241_10484985 Ga0105241_104849852 203
288 3300009551 Ga0105238_10048934 Ga0105238_100489342 203
289 3300013307 Ga0157372_10165705 Ga0157372_101657053 203
290 3300021361 Ga0213872_10002413 Ga0213872_1000241310 203
291 3300025226 Ga0209674_100041 Ga0209674_100041218 203
292 3300025230 Ga0209563_100043 Ga0209563_100043218 203
293 3300025253 Ga0209677_100096 Ga0209677_10009649 203
294 3300025913 Ga0207695_10283230 Ga0207695_102832302 203
295 3300025924 Ga0207694_10418347 Ga0207694_104183471 203
296 3300026041 Ga0207639_10802394 Ga0207639_108023941 203
297 3300028379 Ga0268266_10001450 Ga0268266_1000145017 203
298 3300028380 Ga0268265_10091107 Ga0268265_100911073 203
299 3300039437 Ga0436365_0856036 Ga0436365_0856036_452_1063 203
300 3300039447 Ga0436361_0108001 Ga0436361_0108001_21937_22548 203
301 3300049573 Ga0501037_0293802 Ga0501037_0293802_89_703 203
302 3300050510 nmdc:mga06r32_209371_c1 nmdc:mga06r32_209371_c1_249_887 203
303 3300053119 Ga0500595_035915 Ga0500595_035915_623_1237 203
304 3300053125 Ga0500618_002128 Ga0500618_002128_2726_3340 203
305 3300005436 Ga0070713_100074020 Ga0070713_1000740202 204
306 3300005466 Ga0070685_10008868 Ga0070685_100088685 204
307 3300005549 Ga0070704_100265986 Ga0070704_1002659863 204
308 3300006028 Ga0070717_10207124 Ga0070717_102071241 204
309 3300025906 Ga0207699_10012445 Ga0207699_100124453 204
310 3300025928 Ga0207700_10048811 Ga0207700_100488112 204
311 3300033180 Ga0307510_10000025 Ga0307510_100000258 204
312 3300041503 Ga0451847_0920145 Ga0451847_0920145_21_650 204
313 3300047472 Ga0495686_0030984 Ga0495686_0030984_2109_2726 204
314 3300048906 Ga0496103_0256854 Ga0496103_0256854_482_1111 204
315 3300048908 Ga0496105_0503275 Ga0496105_0503275_134_763 204
316 3300048920 Ga0496117_0000077 Ga0496117_0000077_33911_34540 204
317 3300048921 Ga0496118_0000026 Ga0496118_0000026_81486_82115 204
318 3300048922 Ga0496119_0013115 Ga0496119_0013115_131_760 204
319 3300048923 Ga0496120_0000648 Ga0496120_0000648_40031_40660 204
320 3300048923 Ga0496120_0015330 Ga0496120_0015330_178_807 204
321 3300048924 Ga0496121_0051696 Ga0496121_0051696_2129_2758 204
322 3300048927 Ga0496124_0030697 Ga0496124_0030697_272_901 204
323 3300048928 Ga0496125_0020338 Ga0496125_0020338_4820_5449 204
324 3300001990 JGI24737J22298_10000247 JGI24737J22298_1000024720 205
325 3300001990 JGI24737J22298_10001819 JGI24737J22298_100018196 205
326 3300005327 Ga0070658_10570517 Ga0070658_105705171 205
327 3300005331 Ga0070670_100071113 Ga0070670_1000711134 205
328 3300005331 Ga0070670_100090153 Ga0070670_1000901533 205
329 3300005335 Ga0070666_10043546 Ga0070666_100435463 205
330 3300005335 Ga0070666_10377990 Ga0070666_103779902 205
331 3300005339 Ga0070660_100408767 Ga0070660_1004087671 205
332 3300005344 Ga0070661_100022984 Ga0070661_1000229845 205
333 3300005356 Ga0070674_100029149 Ga0070674_1000291494 205
334 3300005366 Ga0070659_100005959 Ga0070659_1000059592 205
335 3300005366 Ga0070659_100010935 Ga0070659_1000109355 205
336 3300005366 Ga0070659_100094338 Ga0070659_1000943383 205
337 3300005367 Ga0070667_100022953 Ga0070667_1000229534 205
338 3300005455 Ga0070663_100778063 Ga0070663_1007780631 205
339 3300005456 Ga0070678_100157499 Ga0070678_1001574993 205
340 3300005457 Ga0070662_100014321 Ga0070662_1000143216 205
341 3300005457 Ga0070662_100430957 Ga0070662_1004309572 205
342 3300005459 Ga0068867_100017603 Ga0068867_1000176031 205
343 3300005539 Ga0068853_100044900 Ga0068853_1000449004 205
344 3300005539 Ga0068853_100058974 Ga0068853_1000589745 205
345 3300005539 Ga0068853_100174237 Ga0068853_1001742372 205
346 3300005544 Ga0070686_100893451 Ga0070686_1008934511 205
347 3300005548 Ga0070665_100532892 Ga0070665_1005328922 205
348 3300005563 Ga0068855_100475537 Ga0068855_1004755372 205
349 3300005564 Ga0070664_100061003 Ga0070664_1000610031 205
350 3300005577 Ga0068857_100020420 Ga0068857_1000204205 205
351 3300005578 Ga0068854_100530026 Ga0068854_1005300262 205
352 3300005617 Ga0068859_100330197 Ga0068859_1003301971 205
353 3300005834 Ga0068851_10176881 Ga0068851_101768811 205
354 3300005841 Ga0068863_100184990 Ga0068863_1001849903 205
355 3300005841 Ga0068863_100441190 Ga0068863_1004411902 205
356 3300005844 Ga0068862_100135614 Ga0068862_1001356142 205
357 3300006195 Ga0075366_10354479 Ga0075366_103544791 205
358 3300006237 Ga0097621_100570230 Ga0097621_1005702301 205
359 3300006358 Ga0068871_100234297 Ga0068871_1002342972 205
360 3300006358 Ga0068871_100367475 Ga0068871_1003674751 205
361 3300006881 Ga0068865_100438093 Ga0068865_1004380932 205
362 3300006931 Ga0097620_100330250 Ga0097620_1003302501 205
363 3300009174 Ga0105241_10015546 Ga0105241_100155463 205
364 3300009174 Ga0105241_10365390 Ga0105241_103653901 205
365 3300009176 Ga0105242_10009248 Ga0105242_100092487 205
366 3300009176 Ga0105242_10374164 Ga0105242_103741641 205
367 3300009176 Ga0105242_11286942 Ga0105242_112869421 205
368 3300009177 Ga0105248_10020605 Ga0105248_100206055 205
369 3300009177 Ga0105248_10266706 Ga0105248_102667061 205
370 3300009177 Ga0105248_10284800 Ga0105248_102848002 205
371 3300009551 Ga0105238_10009438 Ga0105238_100094387 205
372 3300009553 Ga0105249_10417750 Ga0105249_104177502 205
373 3300009553 Ga0105249_10552070 Ga0105249_105520702 205
374 3300010375 Ga0105239_10103428 Ga0105239_101034283 205
375 3300011119 Ga0105246_10042177 Ga0105246_100421772 205
376 3300013102 Ga0157371_10118730 Ga0157371_101187304 205
377 3300013102 Ga0157371_10167464 Ga0157371_101674642 205
378 3300013105 Ga0157369_10000680 Ga0157369_1000068014 205
379 3300013296 Ga0157374_10199729 Ga0157374_101997292 205
380 3300013297 Ga0157378_10299315 Ga0157378_102993153 205
381 3300013306 Ga0163162_10007030 Ga0163162_100070306 205
382 3300013306 Ga0163162_10018592 Ga0163162_100185925 205
383 3300013306 Ga0163162_10092133 Ga0163162_100921334 205
384 3300013306 Ga0163162_10115075 Ga0163162_101150753 205
385 3300013307 Ga0157372_10393264 Ga0157372_103932642 205
386 3300013307 Ga0157372_10611392 Ga0157372_106113922 205
387 3300013308 Ga0157375_10002438 Ga0157375_100024382 205
388 3300013308 Ga0157375_10694708 Ga0157375_106947081 205
389 3300013308 Ga0157375_11002925 Ga0157375_110029252 205
390 3300014325 Ga0163163_10098967 Ga0163163_100989673 205
391 3300014325 Ga0163163_10504616 Ga0163163_105046162 205
392 3300014745 Ga0157377_10354373 Ga0157377_103543731 205
393 3300014968 Ga0157379_10019588 Ga0157379_100195882 205
394 3300014969 Ga0157376_10000933 Ga0157376_1000093310 205
395 3300014969 Ga0157376_10677226 Ga0157376_106772262 205
396 3300017792 Ga0163161_10232231 Ga0163161_102322312 205
397 3300020075 Ga0206349_1918908 Ga0206349_19189081 205
398 3300020076 Ga0206355_1156896 Ga0206355_11568961 205
399 3300020078 Ga0206352_10848697 Ga0206352_108486971 205
400 3300025901 Ga0207688_10025745 Ga0207688_100257452 205
401 3300025903 Ga0207680_10225922 Ga0207680_102259222 205
402 3300025903 Ga0207680_10298062 Ga0207680_102980622 205
403 3300025904 Ga0207647_10017551 Ga0207647_100175511 205
404 3300025904 Ga0207647_10040973 Ga0207647_100409735 205
405 3300025904 Ga0207647_10361647 Ga0207647_103616471 205
406 3300025907 Ga0207645_10461123 Ga0207645_104611231 205
407 3300025909 Ga0207705_10302535 Ga0207705_103025351 205
408 3300025911 Ga0207654_10012866 Ga0207654_100128663 205
409 3300025913 Ga0207695_10045191 Ga0207695_100451911 205
410 3300025914 Ga0207671_10001068 Ga0207671_1000106816 205
411 3300025919 Ga0207657_10242576 Ga0207657_102425762 205
412 3300025920 Ga0207649_10030427 Ga0207649_100304275 205
413 3300025924 Ga0207694_10004006 Ga0207694_100040064 205
414 3300025931 Ga0207644_10318394 Ga0207644_103183941 205
415 3300025932 Ga0207690_10001436 Ga0207690_100014362 205
416 3300025932 Ga0207690_10011538 Ga0207690_100115386 205
417 3300025933 Ga0207706_10045635 Ga0207706_100456355 205
418 3300025933 Ga0207706_10073189 Ga0207706_100731892 205
419 3300025934 Ga0207686_10002538 Ga0207686_100025386 205
420 3300025934 Ga0207686_10431317 Ga0207686_104313171 205
421 3300025937 Ga0207669_10164287 Ga0207669_101642874 205
422 3300025938 Ga0207704_10433007 Ga0207704_104330072 205
423 3300025941 Ga0207711_10044392 Ga0207711_100443923 205
424 3300025941 Ga0207711_11111474 Ga0207711_111114741 205
425 3300025942 Ga0207689_10193233 Ga0207689_101932332 205
426 3300025945 Ga0207679_10065498 Ga0207679_100654983 205
427 3300025986 Ga0207658_10052377 Ga0207658_100523774 205
428 3300026035 Ga0207703_10716986 Ga0207703_107169862 205
429 3300026041 Ga0207639_10045893 Ga0207639_100458932 205
430 3300026041 Ga0207639_10256441 Ga0207639_102564412 205
431 3300026088 Ga0207641_10088121 Ga0207641_100881215 205
432 3300026088 Ga0207641_10252434 Ga0207641_102524342 205
433 3300026089 Ga0207648_10037439 Ga0207648_100374391 205
434 3300026095 Ga0207676_10138511 Ga0207676_101385113 205
435 3300026116 Ga0207674_10000271 Ga0207674_1000027135 205
436 3300026121 Ga0207683_10100792 Ga0207683_101007923 205
437 3300028379 Ga0268266_10296941 Ga0268266_102969412 205
438 3300028381 Ga0268264_10999311 Ga0268264_109993112 205
439 3300031548 Ga0307408_100282140 Ga0307408_1002821402 205
440 3300031731 Ga0307405_10390503 Ga0307405_103905032 205
441 3300031824 Ga0307413_10231159 Ga0307413_102311593 205
442 3300031852 Ga0307410_10001801 Ga0307410_1000180110 205
443 3300031901 Ga0307406_10122792 Ga0307406_101227923 205
444 3300031903 Ga0307407_10207383 Ga0307407_102073833 205
445 3300031995 Ga0307409_100008147 Ga0307409_1000081474 205
446 3300032002 Ga0307416_100006649 Ga0307416_1000066495 205
447 3300032004 Ga0307414_10107132 Ga0307414_101071323 205
448 3300032005 Ga0307411_10075330 Ga0307411_100753302 205
449 3300032126 Ga0307415_100050041 Ga0307415_1000500413 205
450 3300032126 Ga0307415_100972468 Ga0307415_1009724681 205
451 3300032126 Ga0307415_100981340 Ga0307415_1009813401 205
452 3300036401 Ga0373937_0057350 Ga0373937_0057350_2851_3468 205
453 3300037418 Ga0395900_0493053 Ga0395900_0493053_168_785 205
454 3300037418 Ga0395900_0759110 Ga0395900_0759110_192_809 205
455 3300037471 Ga0395905_0010861 Ga0395905_0010861_5315_5932 205
456 3300038443 Ga0395901_0002015 Ga0395901_0002015_16638_17255 205
457 3300042012 Ga0439455_0013240 Ga0439455_0013240_631_1248 205
458 3300046473 Ga0495582_0066129 Ga0495582_0066129_1267_1884 205
459 3300046475 Ga0495639_0025058 Ga0495639_0025058_871_1488 205
460 3300046522 Ga0495643_0073124 Ga0495643_0073124_883_1500 205
461 3300046543 Ga0495645_0025960 Ga0495645_0025960_480_1097 205
462 3300046680 Ga0495646_0186462 Ga0495646_0186462_131_748 205
463 3300047315 Ga0495581_0265721 Ga0495581_0265721_17_634 205
464 3300047471 Ga0495684_0569725 Ga0495684_0569725_30_647 205
465 3300048907 Ga0496104_0000005 Ga0496104_0000005_277041_277658 205
466 3300048908 Ga0496105_0000016 Ga0496105_0000016_73834_74451 205
467 3300048910 Ga0496107_0087734 Ga0496107_0087734_432_1049 205
468 3300049531 Ga0501315_029955 Ga0501315_029955_146_763 205
469 3300053103 Ga0500555_049426 Ga0500555_049426_411_1037 205
470 3300005327 Ga0070658_10387300 Ga0070658_103873002 206
471 3300005539 Ga0068853_100033923 Ga0068853_1000339232 206
472 3300005616 Ga0068852_100077928 Ga0068852_1000779282 206
473 3300006871 Ga0075434_100137884 Ga0075434_1001378842 206
474 3300009098 Ga0105245_10285487 Ga0105245_102854872 206
475 3300013306 Ga0163162_10000004 Ga0163162_10000004367 206
476 3300013308 Ga0157375_11173084 Ga0157375_111730842 206
477 3300015262 Ga0182007_10099949 Ga0182007_100999492 206
478 3300025918 Ga0207662_10316384 Ga0207662_103163842 206
479 3300025927 Ga0207687_10243292 Ga0207687_102432922 206
480 3300026041 Ga0207639_10015303 Ga0207639_100153032 206
481 3300026142 Ga0207698_10012482 Ga0207698_100124823 206
482 3300031616 Ga0307508_10018556 Ga0307508_100185563 206
483 3300041406 Ga0439439_0027398 Ga0439439_0027398_311_931 206
484 3300048906 Ga0496103_0521837 Ga0496103_0521837_71_691 206
485 3300050512 nmdc:mga0n895_128628_c1 nmdc:mga0n895_128628_c1_553_1173 206
486 3300001904 JGI24736J21556_1024787 JGI24736J21556_10247872 207
487 3300002077 JGI24744J21845_10010559 JGI24744J21845_100105593 207
488 3300005327 Ga0070658_10030271 Ga0070658_100302713 207
489 3300005330 Ga0070690_100129577 Ga0070690_1001295772 207
490 3300005334 Ga0068869_100128824 Ga0068869_1001288243 207
491 3300005334 Ga0068869_100367629 Ga0068869_1003676292 207
492 3300005334 Ga0068869_100575708 Ga0068869_1005757081 207
493 3300005335 Ga0070666_10001531 Ga0070666_100015317 207
494 3300005335 Ga0070666_10070654 Ga0070666_100706543 207
495 3300005338 Ga0068868_100530373 Ga0068868_1005303732 207
496 3300005344 Ga0070661_100035875 Ga0070661_1000358753 207
497 3300005458 Ga0070681_10289248 Ga0070681_102892482 207
498 3300005459 Ga0068867_100430130 Ga0068867_1004301301 207
499 3300005530 Ga0070679_100308138 Ga0070679_1003081383 207
500 3300005539 Ga0068853_100061839 Ga0068853_1000618393 207
501 3300005539 Ga0068853_100523249 Ga0068853_1005232492 207
502 3300005549 Ga0070704_100558771 Ga0070704_1005587711 207
503 3300005563 Ga0068855_100042779 Ga0068855_1000427794 207
504 3300005577 Ga0068857_100228283 Ga0068857_1002282833 207
505 3300005614 Ga0068856_100022335 Ga0068856_1000223355 207
506 3300005614 Ga0068856_100037193 Ga0068856_1000371933 207
507 3300005616 Ga0068852_100014128 Ga0068852_1000141285 207
508 3300005616 Ga0068852_100703446 Ga0068852_1007034462 207
509 3300005616 Ga0068852_100759915 Ga0068852_1007599152 207
510 3300005617 Ga0068859_101175913 Ga0068859_1011759132 207
511 3300005618 Ga0068864_100016572 Ga0068864_1000165721 207
512 3300005618 Ga0068864_100235965 Ga0068864_1002359653 207
513 3300005840 Ga0068870_10124133 Ga0068870_101241332 207
514 3300005841 Ga0068863_100004895 Ga0068863_1000048959 207
515 3300005842 Ga0068858_100129556 Ga0068858_1001295562 207
516 3300005843 Ga0068860_100034119 Ga0068860_1000341193 207
517 3300006852 Ga0075433_10224847 Ga0075433_102248473 207
518 3300006871 Ga0075434_100091795 Ga0075434_1000917953 207
519 3300006871 Ga0075434_100310522 Ga0075434_1003105222 207
520 3300006931 Ga0097620_101175865 Ga0097620_1011758652 207
521 3300009093 Ga0105240_10035211 Ga0105240_100352115 207
522 3300009094 Ga0111539_10068617 Ga0111539_100686172 207
523 3300009098 Ga0105245_10059159 Ga0105245_100591592 207
524 3300009098 Ga0105245_10096380 Ga0105245_100963801 207
525 3300009148 Ga0105243_10191883 Ga0105243_101918833 207
526 3300009174 Ga0105241_10005239 Ga0105241_100052395 207
527 3300009174 Ga0105241_10036994 Ga0105241_100369943 207
528 3300009174 Ga0105241_10097450 Ga0105241_100974502 207
529 3300009174 Ga0105241_10758095 Ga0105241_107580952 207
530 3300009545 Ga0105237_10002146 Ga0105237_1000214622 207
531 3300009545 Ga0105237_10309093 Ga0105237_103090933 207
532 3300009551 Ga0105238_10009034 Ga0105238_100090346 207
533 3300010375 Ga0105239_10036900 Ga0105239_100369002 207
534 3300010375 Ga0105239_10088739 Ga0105239_100887392 207
535 3300013100 Ga0157373_10080112 Ga0157373_100801122 207
536 3300013104 Ga0157370_10063842 Ga0157370_100638423 207
537 3300013105 Ga0157369_10002989 Ga0157369_1000298918 207
538 3300013105 Ga0157369_10008673 Ga0157369_100086733 207
539 3300013297 Ga0157378_10000064 Ga0157378_1000006441 207
540 3300013297 Ga0157378_10031796 Ga0157378_100317963 207
541 3300013306 Ga0163162_10319677 Ga0163162_103196773 207
542 3300013307 Ga0157372_10000277 Ga0157372_1000027741 207
543 3300014325 Ga0163163_10000105 Ga0163163_1000010516 207
544 3300014325 Ga0163163_10000927 Ga0163163_100009275 207
545 3300014326 Ga0157380_10254224 Ga0157380_102542241 207
546 3300014497 Ga0182008_10128920 Ga0182008_101289202 207
547 3300014968 Ga0157379_10004161 Ga0157379_100041615 207
548 3300025899 Ga0207642_10260893 Ga0207642_102608932 207
549 3300025903 Ga0207680_10000577 Ga0207680_1000057711 207
550 3300025904 Ga0207647_10001783 Ga0207647_100017832 207
551 3300025911 Ga0207654_10000432 Ga0207654_1000043225 207
552 3300025911 Ga0207654_10154827 Ga0207654_101548273 207
553 3300025913 Ga0207695_10000920 Ga0207695_1000092031 207
554 3300025913 Ga0207695_10149926 Ga0207695_101499263 207
555 3300025914 Ga0207671_10001915 Ga0207671_100019153 207
556 3300025914 Ga0207671_10027160 Ga0207671_100271603 207
557 3300025919 Ga0207657_10012705 Ga0207657_100127053 207
558 3300025920 Ga0207649_10002515 Ga0207649_100025155 207
559 3300025921 Ga0207652_10185116 Ga0207652_101851163 207
560 3300025924 Ga0207694_10107784 Ga0207694_101077843 207
561 3300025927 Ga0207687_10565602 Ga0207687_105656022 207
562 3300025935 Ga0207709_10072326 Ga0207709_100723263 207
563 3300025941 Ga0207711_10331861 Ga0207711_103318612 207
564 3300025942 Ga0207689_10317396 Ga0207689_103173962 207
565 3300025942 Ga0207689_10662429 Ga0207689_106624291 207
566 3300025945 Ga0207679_10139158 Ga0207679_101391583 207
567 3300025949 Ga0207667_10037846 Ga0207667_100378463 207
568 3300025949 Ga0207667_10506443 Ga0207667_105064431 207
569 3300025981 Ga0207640_10127557 Ga0207640_101275573 207
570 3300026035 Ga0207703_10046638 Ga0207703_100466383 207
571 3300026035 Ga0207703_10074159 Ga0207703_100741592 207
572 3300026041 Ga0207639_10039080 Ga0207639_100390801 207
573 3300026041 Ga0207639_10040521 Ga0207639_100405215 207
574 3300026078 Ga0207702_10005995 Ga0207702_1000599511 207
575 3300026078 Ga0207702_11024167 Ga0207702_110241671 207
576 3300026088 Ga0207641_10017105 Ga0207641_100171053 207
577 3300026089 Ga0207648_10566830 Ga0207648_105668301 207
578 3300026116 Ga0207674_10008203 Ga0207674_100082034 207
579 3300026116 Ga0207674_10150836 Ga0207674_101508361 207
580 3300026142 Ga0207698_10060920 Ga0207698_100609203 207
581 3300028381 Ga0268264_10009270 Ga0268264_100092703 207
582 3300028381 Ga0268264_10037579 Ga0268264_100375793 207
583 3300037312 Ga0395899_0339620 Ga0395899_0339620_339_962 207
584 3300039438 Ga0436360_1341053 Ga0436360_1341053_2186_2812 207
585 3300041406 Ga0439439_0029413 Ga0439439_0029413_125_748 207
586 3300042015 Ga0439462_0088863 Ga0439462_0088863_121_744 207
587 3300042134 Ga0450898_021201 Ga0450898_021201_481_1104 207
588 3300042156 Ga0439446_0007304 Ga0439446_0007304_961_1584 207
589 3300042156 Ga0439446_0008112 Ga0439446_0008112_1566_2189 207
590 3300042184 Ga0450908_004216 Ga0450908_004216_1101_1724 207
591 3300042435 Ga0439434_0000842 Ga0439434_0000842_6172_6795 207
592 3300049579 Ga0501043_0552116 Ga0501043_0552116_160_792 207
593 3300049580 Ga0501046_0149851 Ga0501046_0149851_919_1551 207
594 3300049581 Ga0501047_0002342 Ga0501047_0002342_9326_9958 207
595 3300049583 Ga0501067_0115396 Ga0501067_0115396_213_836 207
596 3300049584 Ga0501068_0050151 Ga0501068_0050151_492_1115 207
597 3300049586 Ga0501070_0009050 Ga0501070_0009050_4580_5212 207
598 3300049742 Ga0501080_0012786 Ga0501080_0012786_4104_4736 207
599 3300050512 nmdc:mga0n895_275690_c1 nmdc:mga0n895_275690_c1_920_1543 207
600 3300050512 nmdc:mga0n895_329498_c1 nmdc:mga0n895_329498_c1_53_682 207
601 3300050515 nmdc:mga0a205_7668_c1 nmdc:mga0a205_7668_c1_8867_9490 207
602 3300061734 Ga0530510_0675450 Ga0530510_0675450_10_633 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

39

115

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

49

116

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

44

121

0.88

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

140

229

0.87

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

158

224

0.86

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

143

238

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.9874 1 200
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.9825 1 200
1pmt-assembly1.cif.gz_A glutathione transferase from proteus mirabilis 0.9824 1 201
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.9821 2 201
1pmt-assembly1.cif.gz_A glutathione transferase from proteus mirabilis 0.9776 1 201
ID Description Score Start End Superfamily
2dsaC02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.987 83 188 1.20.1050.10
af_P0A9D2_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9866 1 76 3.40.30.10
2dsaA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9864 83 188 1.20.1050.10
2dsaD02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9843 83 188 1.20.1050.10
2gdrF02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9828 83 188 1.20.1050.10
ID Description Score Start End GO Terms
AF-R0EES6-F1-model_v4 Glutathione S-transferase 0.9922 1 202 GO:0016740
AF-A9EQL0-F1-model_v4 Gst9 protein (EC 2.5.1.18) 0.9916 2 199 GO:0004364
AF-A0A1Y0BMM0-F1-model_v4 J355 0.9907 1 201
AF-A0A6I2LWT9-F1-model_v4 Glutathione transferase GstA (EC 2.5.1.18) 0.9893 1 201 GO:0004364
AF-A0A853SIG2-F1-model_v4 deleted 0.9888 1 198

Feature Viewer

pLDDT pTM Quality
96.68 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map