F468137

General Info

Members Datasets Scaffolds Average Seq Length
602 301 1204 260

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100206714|Ga0070680_1002067142
Length 273
Sequence MDRHEFTLTGWNDRDVRLVSPTVEQVLGFCAEAPIERVFLEDIARRGLGRFSALEDDGRLVSLCHVGANVVPSGVRCATFADATVRGHARMIIGEERAVDELWGAAAFRMPAPRDDRPGQPVYVLDEPPEPGETGLRPATLADLDVLVPACAAAHREEIGIDPLRRDPDGFRWRTKAQIEEGRSWVWIEDGVIRFKAEASAWTPSAVQLQQVWVDPEARRRGHASRALRDLCRLLLEHVPTVCLFVRPENAPALALYDSIGMRRQLHYRSLIF

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
186 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
187 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 4.98
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 20.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100206714 3300005336 Bacteria 1656
2 Ga0070658_10007803 3300005327 Bacteria 8622
3 Ga0070658_10142602 3300005327 Bacteria 2002
4 Ga0070658_10285509 3300005327 Bacteria 1405
5 Ga0070683_100000523 3300005329 Bacteria 26938
6 Ga0070683_100027799 3300005329 Bacteria 5104
7 Ga0070683_100171814 3300005329 Bacteria 2057
8 Ga0070683_100194767 3300005329 Bacteria 1924
9 Ga0070670_100087049 3300005331 Unclassified 2684
10 Ga0070670_100382871 3300005331 Bacteria 1239
11 Ga0070666_10467695 3300005335 Bacteria 912
12 Ga0070680_100015427 3300005336 Bacteria 5989
13 Ga0070682_100057281 3300005337 Unclassified 2454
14 Ga0070682_100351172 3300005337 Unclassified 1099
15 Ga0070660_100013105 3300005339 Bacteria 5937
16 Ga0070660_100124076 3300005339 Unclassified 2063
17 Ga0070660_100442915 3300005339 Unclassified 1077
18 Ga0070691_10017548 3300005341 Bacteria 3293
19 Ga0070687_100252193 3300005343 Bacteria 1097
20 Ga0070661_100132151 3300005344 Unclassified 1876
21 Ga0070692_10017946 3300005345 Bacteria 3393
22 Ga0070668_100071505 3300005347 Bacteria 2703
23 Ga0070675_100823849 3300005354 Bacteria 849
24 Ga0070674_100016106 3300005356 Bacteria 4683
25 Ga0070674_100346927 3300005356 Bacteria 1198
26 Ga0070688_100151943 3300005365 Bacteria 1583
27 Ga0070659_100049824 3300005366 Unclassified 3293
28 Ga0070709_10134791 3300005434 Unclassified 1690
29 Ga0070709_10227581 3300005434 Unclassified 1333
30 Ga0070709_10495935 3300005434 Unclassified 927
31 Ga0070714_100004907 3300005435 Bacteria 10160
32 Ga0070714_100029834 3300005435 Bacteria 4536
33 Ga0070714_100050023 3300005435 Bacteria 3559
34 Ga0070714_100477873 3300005435 Bacteria 1186
35 Ga0070713_100098221 3300005436 Bacteria 2532
36 Ga0070713_100672177 3300005436 Bacteria 987
37 Ga0070705_100009579 3300005440 Unclassified 4821
38 Ga0070705_100070967 3300005440 Bacteria 2105
39 Ga0070663_100268749 3300005455 Bacteria 1355
40 Ga0070663_100285728 3300005455 Unclassified 1316
41 Ga0070678_100033057 3300005456 Unclassified 3587
42 Ga0070678_100237392 3300005456 Unclassified 1522
43 Ga0070662_100057327 3300005457 Bacteria 2831
44 Ga0070662_100077119 3300005457 Bacteria 2473
45 Ga0068867_100155678 3300005459 Bacteria 1798
46 Ga0068867_100221481 3300005459 Bacteria 1525
47 Ga0070706_100053596 3300005467 Bacteria 3723
48 Ga0070706_100061701 3300005467 Unclassified 3462
49 Ga0070706_100206002 3300005467 Bacteria 1837
50 Ga0070706_100658178 3300005467 Bacteria 972
51 Ga0070707_100053266 3300005468 Bacteria 3878
52 Ga0070707_100357255 3300005468 Bacteria 1419
53 Ga0070707_100543342 3300005468 Bacteria 1124
54 Ga0070698_100025665 3300005471 Bacteria 6139
55 Ga0070698_100037762 3300005471 Bacteria 4979
56 Ga0070698_100101172 3300005471 Bacteria 2853
57 Ga0070698_100112064 3300005471 Bacteria 2693
58 Ga0070698_100202658 3300005471 Unclassified 1919
59 Ga0070699_100020721 3300005518 Bacteria 5671
60 Ga0070699_100049834 3300005518 Bacteria 3624
61 Ga0070699_100118090 3300005518 Bacteria 2331
62 Ga0070699_100297885 3300005518 Bacteria 1447
63 Ga0070679_100067376 3300005530 Bacteria 3570
64 Ga0070679_100094656 3300005530 Unclassified 2974
65 Ga0070684_100014629 3300005535 Bacteria 6363
66 Ga0070684_100017563 3300005535 Bacteria 5876
67 Ga0070684_100028863 3300005535 Bacteria 4696
68 Ga0070684_100093161 3300005535 Unclassified 2681
69 Ga0070684_100140231 3300005535 Unclassified 2186
70 Ga0070684_100167398 3300005535 Unclassified 1995
71 Ga0070684_100206544 3300005535 Bacteria 1790
72 Ga0070684_100375239 3300005535 Bacteria 1309
73 Ga0070697_100223732 3300005536 Bacteria 1604
74 Ga0070695_100040948 3300005545 Unclassified 2935
75 Ga0070695_100117778 3300005545 Unclassified 1813
76 Ga0070696_100011479 3300005546 Bacteria 5934
77 Ga0070693_100005821 3300005547 Bacteria 5954
78 Ga0070693_100174580 3300005547 Bacteria 1379
79 Ga0070665_100013370 3300005548 Bacteria 8260
80 Ga0070704_100182234 3300005549 Bacteria 1681
81 Ga0068855_100050832 3300005563 Bacteria 4883
82 Ga0068855_100080104 3300005563 Bacteria 3787
83 Ga0070664_100068336 3300005564 Unclassified 3038
84 Ga0070664_100134118 3300005564 Bacteria 2176
85 Ga0070664_100228650 3300005564 Bacteria 1667
86 Ga0068857_100005143 3300005577 Bacteria 11124
87 Ga0068857_100516160 3300005577 Bacteria 1123
88 Ga0068854_100107840 3300005578 Bacteria 2097
89 Ga0068854_100275339 3300005578 Bacteria 1353
90 Ga0068856_100151522 3300005614 Unclassified 2328
91 Ga0070702_100117492 3300005615 Bacteria 1659
92 Ga0070702_100319155 3300005615 Bacteria 1082
93 Ga0068852_100120035 3300005616 Bacteria 2405
94 Ga0068852_100591186 3300005616 Bacteria 1113
95 Ga0068852_100639065 3300005616 Bacteria 1071
96 Ga0068859_100059808 3300005617 Unclassified 3839
97 Ga0068866_10075494 3300005718 Unclassified 1795
98 Ga0068861_100112186 3300005719 Bacteria 2186
99 Ga0068870_10039090 3300005840 Unclassified 2453
100 Ga0068870_10227741 3300005840 Bacteria 1144
101 Ga0068858_100013364 3300005842 Bacteria 7746
102 Ga0081455_10020553 3300005937 Bacteria 6212
103 Ga0081455_10025791 3300005937 Bacteria 5419
104 Ga0081455_10117444 3300005937 Unclassified 2102
105 Ga0081455_10342198 3300005937 Bacteria 1058
106 Ga0081538_10008791 3300005981 Bacteria 8515
107 Ga0081539_10000433 3300005985 Bacteria 89118
108 Ga0070717_10224256 3300006028 Bacteria 1653
109 Ga0070717_10536814 3300006028 Bacteria 1059
110 Ga0075364_10060151 3300006051 Bacteria 2491
111 Ga0075432_10068081 3300006058 Bacteria 1276
112 Ga0075432_10070999 3300006058 Bacteria 1251
113 Ga0070715_10097732 3300006163 Unclassified 1364
114 Ga0070716_100010378 3300006173 Bacteria 4667
115 Ga0070716_100157795 3300006173 Bacteria 1467
116 Ga0070712_100390476 3300006175 Unclassified 1147
117 Ga0075428_100033810 3300006844 Bacteria 5642
118 Ga0075428_100101694 3300006844 Bacteria 3133
119 Ga0075430_100099729 3300006846 Bacteria 2426
120 Ga0075431_100162140 3300006847 Bacteria 2299
121 Ga0075433_10028863 3300006852 Bacteria 4720
122 Ga0075433_10179168 3300006852 Bacteria 1885
123 Ga0075434_100052890 3300006871 Bacteria 4036
124 Ga0075434_100304356 3300006871 Unclassified 1614
125 Ga0075429_100275627 3300006880 Bacteria 1473
126 Ga0068865_100098922 3300006881 Bacteria 2132
127 Ga0075436_100072891 3300006914 Unclassified 2376
128 Ga0097620_100059802 3300006931 Unclassified 3839
129 Ga0075435_100041990 3300007076 Bacteria 3657
130 Ga0075435_100373802 3300007076 Unclassified 1224
131 Ga0105240_10136014 3300009093 Bacteria 2943
132 Ga0111539_10012380 3300009094 Bacteria 10697
133 Ga0111539_10114366 3300009094 Unclassified 3165
134 Ga0111539_10427896 3300009094 Bacteria 1542
135 Ga0105245_10029708 3300009098 Bacteria 4832
136 Ga0105245_10040856 3300009098 Bacteria 4133
137 Ga0105245_10132686 3300009098 Bacteria 2338
138 Ga0105247_10017681 3300009101 Unclassified 4276
139 Ga0114129_10005186 3300009147 Bacteria 18350
140 Ga0114129_10033307 3300009147 Bacteria 7281
141 Ga0114129_10039597 3300009147 Bacteria 6645
142 Ga0114129_10178225 3300009147 Bacteria 2893
143 Ga0114129_10380647 3300009147 Unclassified 1864
144 Ga0114129_10452851 3300009147 Unclassified 1683
145 Ga0105243_10040776 3300009148 Bacteria 3628
146 Ga0105243_10041272 3300009148 Unclassified 3608
147 Ga0105243_10100255 3300009148 Bacteria 2402
148 Ga0105243_10623682 3300009148 Unclassified 1041
149 Ga0105242_10058291 3300009176 Bacteria 3165
150 Ga0105248_10035508 3300009177 Bacteria 5577
151 Ga0105237_10723414 3300009545 Bacteria 1002
152 Ga0105238_10368404 3300009551 Bacteria 1427
153 Ga0105238_10581393 3300009551 Unclassified 1126
154 Ga0105249_10051563 3300009553 Bacteria 3754
155 Ga0105249_10080535 3300009553 Unclassified 3025
156 Ga0105249_10293211 3300009553 Bacteria 1629
157 Ga0105239_10013563 3300010375 Bacteria 9046
158 Ga0105239_10212107 3300010375 Unclassified 2171
159 Ga0105239_10302213 3300010375 Bacteria 1802
160 Ga0105246_10052067 3300011119 Unclassified 2812
161 Ga0105246_10052505 3300011119 Bacteria 2803
162 Ga0105246_10360647 3300011119 Bacteria 1194
163 Ga0157370_10050383 3300013104 Bacteria 3980
164 Ga0157370_10057103 3300013104 Bacteria 3713
165 Ga0157369_10036233 3300013105 Bacteria 5405
166 Ga0157369_10045651 3300013105 Bacteria 4763
167 Ga0157369_10172799 3300013105 Bacteria 2276
168 Ga0157369_10211564 3300013105 Bacteria 2032
169 Ga0163162_10350738 3300013306 Unclassified 1608
170 Ga0163163_10228141 3300014325 Bacteria 1911
171 Ga0157377_10097665 3300014745 Unclassified 1745
172 Ga0157377_10138583 3300014745 Bacteria 1493
173 Ga0157377_10150570 3300014745 Unclassified 1438
174 Ga0157379_10027872 3300014968 Bacteria 5027
175 Ga0206356_10537382 3300020070 Bacteria 1956
176 Ga0207653_10007908 3300025885 Unclassified 3314
177 Ga0207688_10034742 3300025901 Unclassified 2792
178 Ga0207699_10103080 3300025906 Unclassified 1814
179 Ga0207645_10193343 3300025907 Unclassified 1337
180 Ga0207643_10310108 3300025908 Unclassified 983
181 Ga0207705_10021630 3300025909 Bacteria 4590
182 Ga0207705_10249959 3300025909 Bacteria 1352
183 Ga0207684_10163714 3300025910 Bacteria 1916
184 Ga0207684_10234128 3300025910 Bacteria 1585
185 Ga0207684_10381616 3300025910 Bacteria 1212
186 Ga0207695_10057395 3300025913 Bacteria 4044
187 Ga0207695_10073223 3300025913 Bacteria 3492
188 Ga0207693_10052149 3300025915 Bacteria 3209
189 Ga0207663_10100953 3300025916 Bacteria 1938
190 Ga0207663_10246807 3300025916 Bacteria 1312
191 Ga0207660_10012867 3300025917 Bacteria 5479
192 Ga0207660_10338754 3300025917 Bacteria 1204
193 Ga0207657_10095840 3300025919 Unclassified 2469
194 Ga0207657_10233325 3300025919 Bacteria 1471
195 Ga0207649_10059474 3300025920 Unclassified 2398
196 Ga0207652_10001978 3300025921 Bacteria 17727
197 Ga0207652_10021225 3300025921 Bacteria 5359
198 Ga0207652_10156174 3300025921 Bacteria 2044
199 Ga0207652_10317617 3300025921 Bacteria 1406
200 Ga0207646_10302702 3300025922 Bacteria 1444
201 Ga0207694_10097456 3300025924 Unclassified 2327
202 Ga0207650_10476390 3300025925 Bacteria 1041
203 Ga0207650_10489277 3300025925 Bacteria 1027
204 Ga0207659_10411874 3300025926 Bacteria 1132
205 Ga0207687_10017642 3300025927 Bacteria 4702
206 Ga0207687_10074872 3300025927 Bacteria 2428
207 Ga0207687_10082273 3300025927 Bacteria 2329
208 Ga0207687_10126858 3300025927 Bacteria 1917
209 Ga0207664_10085145 3300025929 Bacteria 2579
210 Ga0207664_10108885 3300025929 Unclassified 2301
211 Ga0207644_10057014 3300025931 Bacteria 2820
212 Ga0207690_10124856 3300025932 Unclassified 1875
213 Ga0207706_10039090 3300025933 Bacteria 4207
214 Ga0207686_10057903 3300025934 Bacteria 2441
215 Ga0207670_10522725 3300025936 Bacteria 966
216 Ga0207704_10148124 3300025938 Bacteria 1652
217 Ga0207665_10033144 3300025939 Bacteria 3422
218 Ga0207689_10028579 3300025942 Bacteria 4663
219 Ga0207689_10094338 3300025942 Unclassified 2458
220 Ga0207689_10205981 3300025942 Bacteria 1624
221 Ga0207661_10002757 3300025944 Bacteria 12095
222 Ga0207661_10005380 3300025944 Bacteria 9019
223 Ga0207661_10042170 3300025944 Bacteria 3597
224 Ga0207661_10063820 3300025944 Bacteria 2984
225 Ga0207679_10170026 3300025945 Bacteria 1793
226 Ga0207679_10191700 3300025945 Bacteria 1700
227 Ga0207679_10239403 3300025945 Bacteria 1537
228 Ga0207679_10503119 3300025945 Unclassified 1081
229 Ga0207679_10544665 3300025945 Bacteria 1040
230 Ga0207667_10713180 3300025949 Bacteria 1005
231 Ga0207651_10144095 3300025960 Unclassified 1845
232 Ga0207712_10023123 3300025961 Bacteria 4099
233 Ga0207712_10147705 3300025961 Bacteria 1812
234 Ga0207668_10110184 3300025972 Unclassified 2064
235 Ga0207640_10045029 3300025981 Bacteria 2831
236 Ga0207640_10133815 3300025981 Bacteria 1796
237 Ga0207677_10032908 3300026023 Bacteria 3338
238 Ga0207677_10424528 3300026023 Bacteria 1133
239 Ga0207703_10031892 3300026035 Unclassified 4169
240 Ga0207678_10225926 3300026067 Bacteria 1603
241 Ga0207702_10009674 3300026078 Bacteria 8093
242 Ga0207702_10187657 3300026078 Unclassified 1908
243 Ga0207641_10015119 3300026088 Bacteria 6325
244 Ga0207641_10543185 3300026088 Bacteria 1133
245 Ga0207648_10229248 3300026089 Unclassified 1652
246 Ga0207648_10264509 3300026089 Archaea 1535
247 Ga0207648_10560547 3300026089 Bacteria 1050
248 Ga0207676_10345700 3300026095 Bacteria 1374
249 Ga0207674_10010741 3300026116 Bacteria 10337
250 Ga0207674_10069973 3300026116 Unclassified 3528
251 Ga0207675_100212300 3300026118 Bacteria 1862
252 Ga0207675_100496332 3300026118 Unclassified 1215
253 Ga0207683_10009996 3300026121 Bacteria 8097
254 Ga0207683_10290918 3300026121 Unclassified 1494
255 Ga0207698_10068430 3300026142 Unclassified 2803
256 Ga0207698_10277866 3300026142 Bacteria 1547
257 Ga0207698_10492317 3300026142 Unclassified 1191
258 Ga0209966_1012742 3300027695 Bacteria 1548
259 Ga0207428_10041278 3300027907 Bacteria 3736
260 Ga0207428_10065940 3300027907 Bacteria 2854
261 Ga0207428_10115010 3300027907 Bacteria 2067
262 Ga0207428_10134604 3300027907 Bacteria 1890
263 Ga0268266_10087010 3300028379 Bacteria 2733
264 Ga0268264_10475457 3300028381 Bacteria 1215
265 Ga0265319_1006553 3300028563 Bacteria 5377
266 Ga0265334_10034700 3300028573 Unclassified 2001
267 Ga0265318_10000286 3300028577 Bacteria 41428
268 Ga0265318_10007801 3300028577 Bacteria 4811
269 Ga0265322_10004433 3300028654 Bacteria 4184
270 Ga0265336_10004057 3300028666 Bacteria 5579
271 Ga0265336_10022074 3300028666 Bacteria 2028
272 Ga0265338_10004582 3300028800 Bacteria 18589
273 Ga0265338_10032499 3300028800 Bacteria 5088
274 Ga0265338_10054962 3300028800 Bacteria 3545
275 Ga0265330_10000170 3300031235 Bacteria 51357
276 Ga0265330_10017953 3300031235 Bacteria 3252
277 Ga0265332_10001371 3300031238 Bacteria 13785
278 Ga0265332_10038469 3300031238 Bacteria 2073
279 Ga0265328_10000396 3300031239 Bacteria 20417
280 Ga0265320_10013367 3300031240 Bacteria 4726
281 Ga0265320_10014683 3300031240 Bacteria 4447
282 Ga0265320_10116433 3300031240 Bacteria 1221
283 Ga0265325_10000058 3300031241 Bacteria 76250
284 Ga0265325_10156781 3300031241 Unclassified 1073
285 Ga0265329_10001018 3300031242 Bacteria 13981
286 Ga0265329_10009366 3300031242 Bacteria 3661
287 Ga0265329_10040225 3300031242 Bacteria 1500
288 Ga0265340_10001302 3300031247 Bacteria 14295
289 Ga0265339_10001168 3300031249 Bacteria 19822
290 Ga0265339_10002081 3300031249 Bacteria 14653
291 Ga0265339_10034397 3300031249 Unclassified 2848
292 Ga0265339_10081364 3300031249 Unclassified 1711
293 Ga0265331_10000568 3300031250 Bacteria 33224
294 Ga0265327_10004500 3300031251 Bacteria 12303
295 Ga0265327_10061966 3300031251 Bacteria 1906
296 Ga0265327_10071078 3300031251 Bacteria 1742
297 Ga0265327_10136333 3300031251 Bacteria 1150
298 Ga0265327_10149927 3300031251 Bacteria 1084
299 Ga0265327_10158158 3300031251 Bacteria 1048
300 Ga0265316_10000700 3300031344 Bacteria 37322
301 Ga0265316_10009407 3300031344 Bacteria 9002
302 Ga0307408_100197050 3300031548 Bacteria 1627
303 Ga0307408_100586012 3300031548 Bacteria 989
304 Ga0265313_10000754 3300031595 Bacteria 33060
305 Ga0265313_10096279 3300031595 Bacteria 1320
306 Ga0265314_10000982 3300031711 Bacteria 33556
307 Ga0265314_10006552 3300031711 Bacteria 10270
308 Ga0265314_10009563 3300031711 Bacteria 8168
309 Ga0265314_10138707 3300031711 Bacteria 1506
310 Ga0265342_10001473 3300031712 Bacteria 21888
311 Ga0307405_10022721 3300031731 Bacteria 3551
312 Ga0307413_10005658 3300031824 Bacteria 5607
313 Ga0307406_10520144 3300031901 Unclassified 968
314 Ga0307407_10006366 3300031903 Bacteria 5235
315 Ga0307409_100099558 3300031995 Bacteria 2407
316 Ga0307416_100006095 3300032002 Bacteria 7507
317 Ga0307414_10022307 3300032004 Bacteria 3991
318 Ga0307411_10018117 3300032005 Bacteria 4032
319 Ga0307415_100016377 3300032126 Bacteria 4418
320 Ga0373948_0021533 3300034817 Bacteria 1235
321 Ga0373929_0025597 3300035085 Bacteria 1227
322 Ga0373960_0006877 3300035121 Bacteria 2679
323 Ga0373933_0138898 3300035724 Unclassified 1533
324 Ga0373937_0348784 3300036401 Bacteria 1402
325 Ga0395899_0041616 3300037312 Bacteria 3433
326 Ga0395899_0171422 3300037312 Bacteria 1528
327 Ga0395900_0181598 3300037418 Bacteria 2138
328 Ga0395900_0306465 3300037418 Bacteria 1573
329 Ga0395900_0485737 3300037418 Viruses 1187
330 Ga0395898_0012539 3300037466 Bacteria 8766
331 Ga0395898_0041700 3300037466 Bacteria 4532
332 Ga0395898_0517719 3300037466 Bacteria 1134
333 Ga0395905_0049922 3300037471 Bacteria 3921
334 Ga0395905_0063424 3300037471 Bacteria 3457
335 Ga0395905_0315992 3300037471 Bacteria 1451
336 Ga0395901_0003433 3300038443 Bacteria 15969
337 Ga0395901_0005374 3300038443 Bacteria 12953
338 Ga0395901_0183307 3300038443 Bacteria 2196
339 Ga0242420_003538 3300038996 Bacteria 2310
340 Ga0436360_1034011 3300039438 Unclassified 1306
341 Ga0439453_0019626 3300041408 Bacteria 1205
342 Ga0451789_0068614 3300041443 Bacteria 1726
343 Ga0451800_0111257 3300041459 Bacteria 1699
344 Ga0451802_1690725 3300041460 Unclassified 1129
345 Ga0451807_2629204 3300041486 Unclassified 1374
346 Ga0451835_0070927 3300041492 Bacteria 2522
347 Ga0451839_0131532 3300041496 Bacteria 1806
348 Ga0451855_2003555 3300041511 Bacteria 1815
349 Ga0451853_1182808 3300041512 Unclassified 1582
350 Ga0439441_008684 3300042001 Unclassified 1666
351 Ga0450920_012623 3300042122 Bacteria 1586
352 Ga0439458_0025548 3300042157 Bacteria 1386
353 Ga0466966_0021021 3300044684 Bacteria 4288
354 Ga0466961_0222852 3300044693 Bacteria 1162
355 Ga0466963_0029963 3300044694 Bacteria 3507
356 Ga0466963_0045069 3300044694 Bacteria 2904
357 Ga0466963_0073676 3300044694 Bacteria 2302
358 Ga0466964_0083887 3300044706 Bacteria 1373
359 Ga0466971_0022908 3300044719 Bacteria 2784
360 Ga0466957_0038706 3300044842 Bacteria 2874
361 Ga0466957_0329014 3300044842 Unclassified 1032
362 Ga0466959_0008653 3300045049 Bacteria 7204
363 Ga0466959_0135165 3300045049 Bacteria 1746
364 Ga0466958_0057855 3300045836 Bacteria 2356
365 Ga0466958_0148577 3300045836 Bacteria 1478
366 Ga0466967_0014542 3300045976 Bacteria 6135
367 Ga0466967_0033729 3300045976 Bacteria 4337
368 Ga0466967_0146115 3300045976 Bacteria 2206
369 Ga0466967_0155248 3300045976 Bacteria 2143
370 Ga0466967_0158329 3300045976 Bacteria 2124
371 Ga0495603_0030972 3300046455 Bacteria 3221
372 Ga0495641_0152205 3300046461 Bacteria 1034
373 Ga0495651_0055130 3300046462 Unclassified 3055
374 Ga0495605_0064635 3300046474 Bacteria 1742
375 Ga0495584_0092768 3300046491 Unclassified 1523
376 Ga0495594_0173920 3300046499 Bacteria 1225
377 Ga0495596_0024074 3300046500 Unclassified 2469
378 Ga0495616_0036803 3300046513 Bacteria 2523
379 Ga0495616_0125441 3300046513 Bacteria 1181
380 Ga0495618_0237270 3300046514 Unclassified 1147
381 Ga0495628_0128100 3300046516 Bacteria 1943
382 Ga0495631_0079246 3300046518 Unclassified 1418
383 Ga0495637_0028724 3300046520 Bacteria 2481
384 Ga0495637_0108498 3300046520 Unclassified 1078
385 Ga0495644_0087033 3300046523 Unclassified 1178
386 Ga0495663_0026644 3300046525 Unclassified 1693
387 Ga0495642_0063642 3300046528 Bacteria 1533
388 Ga0495652_0203563 3300046529 Bacteria 1500
389 Ga0495640_0249942 3300046533 Bacteria 1111
390 Ga0495587_0104847 3300046536 Unclassified 1627
391 Ga0495598_0016203 3300046537 Bacteria 1898
392 Ga0495609_0027826 3300046538 Bacteria 2582
393 Ga0495609_0079918 3300046538 Bacteria 1430
394 Ga0495597_0104461 3300046542 Bacteria 1192
395 Ga0495645_0077748 3300046543 Bacteria 2385
396 Ga0495667_0012883 3300046559 Bacteria 5667
397 Ga0495656_0086727 3300046615 Bacteria 1424
398 Ga0495656_0123072 3300046615 Bacteria 1226
399 Ga0495668_0033532 3300046616 Bacteria 2885
400 Ga0495634_0003820 3300046642 Bacteria 11962
401 Ga0495611_0109761 3300046648 Bacteria 1284
402 Ga0495635_0036470 3300046663 Unclassified 3408
403 Ga0495635_0102418 3300046663 Bacteria 1957
404 Ga0495659_0020021 3300046664 Bacteria 2243
405 Ga0495599_0106149 3300046678 Bacteria 1750
406 Ga0495658_0232929 3300046683 Bacteria 1155
407 Ga0495670_0174720 3300046691 Bacteria 1132
408 Ga0495589_0054548 3300046794 Bacteria 1971
409 Ga0495589_0103793 3300046794 Unclassified 1374
410 Ga0495674_0383393 3300047319 Bacteria 1137
411 Ga0495680_0003282 3300047322 Bacteria 16027
412 Ga0495680_0110528 3300047322 Bacteria 2037
413 Ga0495680_0200802 3300047322 Bacteria 1430
414 Ga0495677_0028005 3300047445 Bacteria 2045
415 Ga0495684_0095875 3300047471 Bacteria 2245
416 Ga0495602_0235161 3300048088 Bacteria 1374
417 Ga0495626_0116774 3300048091 Bacteria 1151
418 Ga0496100_0060590 3300048903 Unclassified 2491
419 Ga0496100_0149735 3300048903 Unclassified 1663
420 Ga0496101_0220318 3300048904 Unclassified 1472
421 Ga0496102_0007452 3300048905 Bacteria 9349
422 Ga0496102_0462134 3300048905 Bacteria 1190
423 Ga0496105_0163011 3300048908 Unclassified 1830
424 Ga0496107_0046639 3300048910 Unclassified 3119
425 Ga0496107_0223351 3300048910 Bacteria 1401
426 Ga0496108_0014918 3300048911 Bacteria 6342
427 Ga0496108_0219324 3300048911 Bacteria 1652
428 Ga0496109_0012800 3300048912 Bacteria 7252
429 Ga0496109_0182260 3300048912 Bacteria 1973
430 Ga0496109_0210337 3300048912 Bacteria 1829
431 Ga0496110_0005208 3300048913 Bacteria 10175
432 Ga0496110_0098908 3300048913 Unclassified 2615
433 Ga0496110_0493532 3300048913 Unclassified 1115
434 Ga0496111_0001090 3300048914 Bacteria 15007
435 Ga0496111_0011296 3300048914 Bacteria 6011
436 Ga0496111_0051345 3300048914 Unclassified 2976
437 Ga0496111_0286501 3300048914 Unclassified 1222
438 Ga0496112_0220945 3300048915 Bacteria 1851
439 Ga0496112_0328107 3300048915 Unclassified 1474
440 Ga0496112_0340623 3300048915 Bacteria 1443
441 Ga0496113_0209865 3300048916 Unclassified 1550
442 Ga0496114_0026697 3300048917 Unclassified 4729
443 Ga0496115_0038139 3300048918 Bacteria 3812
444 Ga0501031_0010423 3300049568 Bacteria 6053
445 Ga0501031_0017419 3300049568 Bacteria 4668
446 Ga0501031_0026588 3300049568 Bacteria 3772
447 Ga0501032_0049700 3300049569 Bacteria 2829
448 Ga0501032_0148379 3300049569 Bacteria 1543
449 Ga0501033_0022998 3300049570 Bacteria 4699
450 Ga0501033_0043337 3300049570 Bacteria 3351
451 Ga0501033_0348687 3300049570 Unclassified 1037
452 Ga0501033_0403409 3300049570 Bacteria 953
453 Ga0501034_0005913 3300049571 Bacteria 13279
454 Ga0501034_0014992 3300049571 Bacteria 7973
455 Ga0501036_0015680 3300049572 Bacteria 6328
456 Ga0501036_0015960 3300049572 Bacteria 6273
457 Ga0501036_0047636 3300049572 Bacteria 3629
458 Ga0501036_0139664 3300049572 Bacteria 2045
459 Ga0501036_0181211 3300049572 Unclassified 1773
460 Ga0501036_0231004 3300049572 Bacteria 1552
461 Ga0501037_0015806 3300049573 Bacteria 5554
462 Ga0501037_0033201 3300049573 Bacteria 3812
463 Ga0501038_0005341 3300049574 Bacteria 11929
464 Ga0501038_0015360 3300049574 Bacteria 6961
465 Ga0501038_0063765 3300049574 Bacteria 3144
466 Ga0501038_0093232 3300049574 Bacteria 2520
467 Ga0501038_0107248 3300049574 Unclassified 2317
468 Ga0501039_0015111 3300049575 Bacteria 5907
469 Ga0501039_0016582 3300049575 Bacteria 5643
470 Ga0501039_0017330 3300049575 Bacteria 5526
471 Ga0501039_0035028 3300049575 Bacteria 3874
472 Ga0501039_0109453 3300049575 Unclassified 2160
473 Ga0501040_0005058 3300049576 Bacteria 8521
474 Ga0501040_0009515 3300049576 Bacteria 6337
475 Ga0501040_0037211 3300049576 Bacteria 3305
476 Ga0501040_0105088 3300049576 Bacteria 1972
477 Ga0501041_0006242 3300049577 Bacteria 6968
478 Ga0501041_0008251 3300049577 Bacteria 6126
479 Ga0501041_0013318 3300049577 Bacteria 4873
480 Ga0501041_0117265 3300049577 Unclassified 1653
481 Ga0501042_0007362 3300049578 Bacteria 7207
482 Ga0501042_0021070 3300049578 Bacteria 4540
483 Ga0501042_0090455 3300049578 Bacteria 2196
484 Ga0501043_0052521 3300049579 Bacteria 3200
485 Ga0501043_0121755 3300049579 Bacteria 2046
486 Ga0501043_0353885 3300049579 Bacteria 1115
487 Ga0501046_0005025 3300049580 Bacteria 11873
488 Ga0501046_0022076 3300049580 Bacteria 5247
489 Ga0501046_0022930 3300049580 Bacteria 5140
490 Ga0501046_0234073 3300049580 Unclassified 1356
491 Ga0501047_0626358 3300049581 Bacteria 896
492 Ga0501048_0007167 3300049582 Bacteria 8469
493 Ga0501048_0046034 3300049582 Bacteria 3114
494 Ga0501048_0063684 3300049582 Bacteria 2607
495 Ga0501048_0190430 3300049582 Bacteria 1453
496 Ga0501067_0007804 3300049583 Bacteria 5951
497 Ga0501067_0013328 3300049583 Bacteria 4552
498 Ga0501067_0175401 3300049583 Bacteria 1194
499 Ga0501068_0008992 3300049584 Bacteria 5574
500 Ga0501068_0023006 3300049584 Bacteria 3650
501 Ga0501068_0067500 3300049584 Bacteria 2179
502 Ga0501069_0009252 3300049585 Bacteria 5200
503 Ga0501069_0035678 3300049585 Bacteria 2740
504 Ga0501070_0002071 3300049586 Bacteria 17606
505 Ga0501070_0006123 3300049586 Bacteria 10253
506 Ga0501070_0021493 3300049586 Bacteria 5414
507 Ga0501070_0077415 3300049586 Unclassified 2753
508 Ga0501071_0005145 3300049587 Bacteria 8380
509 Ga0501071_0007588 3300049587 Bacteria 7142
510 Ga0501071_0039797 3300049587 Bacteria 3363
511 Ga0501072_0009054 3300049588 Bacteria 7565
512 Ga0501072_0012104 3300049588 Bacteria 6590
513 Ga0501072_0385251 3300049588 Bacteria 1112
514 Ga0501073_0009579 3300049589 Bacteria 7144
515 Ga0501073_0010184 3300049589 Bacteria 6906
516 Ga0501073_0013640 3300049589 Bacteria 5912
517 Ga0501073_0045603 3300049589 Unclassified 3087
518 Ga0501073_0093353 3300049589 Unclassified 2091
519 Ga0501074_0008573 3300049590 Bacteria 7406
520 Ga0501074_0009263 3300049590 Bacteria 7153
521 Ga0501074_0022855 3300049590 Bacteria 4547
522 Ga0501074_0023670 3300049590 Bacteria 4463
523 Ga0501074_0076583 3300049590 Unclassified 2401
524 Ga0501074_0123976 3300049590 Bacteria 1847
525 Ga0501075_0004355 3300049591 Bacteria 9575
526 Ga0501075_0017740 3300049591 Bacteria 5140
527 Ga0501075_0040650 3300049591 Bacteria 3483
528 Ga0501075_0041833 3300049591 Bacteria 3434
529 Ga0501075_0259814 3300049591 Bacteria 1323
530 Ga0501076_0003298 3300049592 Bacteria 11307
531 Ga0501076_0007628 3300049592 Bacteria 7880
532 Ga0501076_0032611 3300049592 Bacteria 4065
533 Ga0501076_0270097 3300049592 Bacteria 1392
534 Ga0501076_0337541 3300049592 Bacteria 1236
535 Ga0501077_0005659 3300049593 Bacteria 7617
536 Ga0501077_0017987 3300049593 Bacteria 4466
537 Ga0501077_0210775 3300049593 Bacteria 1234
538 Ga0501079_0007041 3300049741 Bacteria 8486
539 Ga0501079_0013478 3300049741 Bacteria 6233
540 Ga0501079_0242063 3300049741 Unclassified 1409
541 Ga0501080_0003099 3300049742 Bacteria 14676
542 Ga0501080_0023793 3300049742 Bacteria 5676
543 Ga0501080_0025463 3300049742 Bacteria 5491
544 Ga0501080_0088297 3300049742 Bacteria 2880
545 Ga0501080_0714476 3300049742 Unclassified 883
546 Ga0501081_0006900 3300049743 Bacteria 7379
547 Ga0501081_0015417 3300049743 Bacteria 5043
548 Ga0501081_0022536 3300049743 Bacteria 4215
549 Ga0501081_0036234 3300049743 Bacteria 3363
550 Ga0501081_0222097 3300049743 Unclassified 1374
551 Ga0501081_0306958 3300049743 Unclassified 1164
552 Ga0501083_0021145 3300049744 Bacteria 4522
553 Ga0501083_0025235 3300049744 Bacteria 4114
554 Ga0501083_0198736 3300049744 Unclassified 1308
555 Ga0501035_0013202 3300049822 Bacteria 7623
556 Ga0501035_0038603 3300049822 Bacteria 4323
557 Ga0501035_0066840 3300049822 Bacteria 3190
558 Ga0501044_0041747 3300049823 Bacteria 4775
559 Ga0501045_0004861 3300049824 Bacteria 9299
560 Ga0501045_0016092 3300049824 Bacteria 5307
561 Ga0501045_0108497 3300049824 Bacteria 2057
562 nmdc:mga00v17_39663_c1 3300050491 Bacteria 2821
563 nmdc:mga0yw44_92507_c1 3300050492 Bacteria 1914
564 nmdc:mga05p37_429281_c1 3300050507 Unclassified 1536
565 nmdc:mga05p37_55864_c1 3300050507 Bacteria 4860
566 nmdc:mga05p37_708134_c1 3300050507 Bacteria 1117
567 nmdc:mga05p37_760932_c1 3300050507 Unclassified 1066
568 nmdc:mga09592_101044_c1 3300050508 Bacteria 2470
569 nmdc:mga0qj67_64831_c2 3300050509 Bacteria 2411
570 nmdc:mga06r32_142130_c1 3300050510 Bacteria 2377
571 nmdc:mga08y16_25275_c1 3300050511 Bacteria 6261
572 nmdc:mga08y16_309851_c1 3300050511 Bacteria 1626
573 nmdc:mga08y16_49928_c1 3300050511 Bacteria 4378
574 nmdc:mga08y16_51592_c1 3300050511 Bacteria 4304
575 nmdc:mga0n895_88907_c1 3300050512 Bacteria 3089
576 nmdc:mga0n895_934060_c1 3300050512 Unclassified 852
577 nmdc:mga0rr50_45265_c1 3300050513 Bacteria 3233
578 nmdc:mga08x19_106274_c1 3300050514 Unclassified 1868
579 nmdc:mga08x19_90466_c1 3300050514 Bacteria 2019
580 nmdc:mga0a205_28996_c1 3300050515 Bacteria 5294
581 nmdc:mga0a205_563810_c1 3300050515 Bacteria 993
582 nmdc:mga0a205_681233_c1 3300050515 Unclassified 878
583 Ga0495619_0031628 3300053085 Unclassified 3430
584 Ga0495619_0057870 3300053085 Bacteria 2572
585 Ga0501084_0005511 3300054114 Bacteria 10390
586 Ga0501084_0014150 3300054114 Bacteria 6606
587 Ga0501084_0019688 3300054114 Bacteria 5623
588 Ga0501084_0036250 3300054114 Bacteria 4120
589 Ga0501084_0253779 3300054114 Unclassified 1484
590 Ga0501084_0296683 3300054114 Bacteria 1365
591 Ga0590074_013353 3300059423 Bacteria 1387
592 Ga0501082_0001298 3300060353 Bacteria 21910
593 Ga0501082_0011402 3300060353 Bacteria 7646
594 Ga0501082_0022081 3300060353 Bacteria 5487
595 Ga0501082_0058804 3300060353 Bacteria 3312
596 Ga0501082_0277946 3300060353 Bacteria 1457
597 Ga0530510_0001689 3300061734 Bacteria 14958
598 Ga0530510_0005528 3300061734 Bacteria 8753
599 Ga0530510_0006141 3300061734 Bacteria 8343
600 Ga0530510_0009072 3300061734 Bacteria 6971
601 Ga0530510_0017138 3300061734 Bacteria 5131
602 Ga0530510_0371679 3300061734 Bacteria 1075
603 Ga0070680_100206714
604 Ga0070658_10007803
605 Ga0070658_10142602
606 Ga0070658_10285509
607 Ga0070683_100000523
608 Ga0070683_100027799
609 Ga0070683_100171814
610 Ga0070683_100194767
611 Ga0070670_100087049
612 Ga0070670_100382871
613 Ga0070666_10467695
614 Ga0070680_100015427
615 Ga0070682_100057281
616 Ga0070682_100351172
617 Ga0070660_100013105
618 Ga0070660_100124076
619 Ga0070660_100442915
620 Ga0070691_10017548
621 Ga0070687_100252193
622 Ga0070661_100132151
623 Ga0070692_10017946
624 Ga0070668_100071505
625 Ga0070675_100823849
626 Ga0070674_100016106
627 Ga0070674_100346927
628 Ga0070688_100151943
629 Ga0070659_100049824
630 Ga0070709_10134791
631 Ga0070709_10227581
632 Ga0070709_10495935
633 Ga0070714_100004907
634 Ga0070714_100029834
635 Ga0070714_100050023
636 Ga0070714_100477873
637 Ga0070713_100098221
638 Ga0070713_100672177
639 Ga0070705_100009579
640 Ga0070705_100070967
641 Ga0070663_100268749
642 Ga0070663_100285728
643 Ga0070678_100033057
644 Ga0070678_100237392
645 Ga0070662_100057327
646 Ga0070662_100077119
647 Ga0068867_100155678
648 Ga0068867_100221481
649 Ga0070706_100053596
650 Ga0070706_100061701
651 Ga0070706_100206002
652 Ga0070706_100658178
653 Ga0070707_100053266
654 Ga0070707_100357255
655 Ga0070707_100543342
656 Ga0070698_100025665
657 Ga0070698_100037762
658 Ga0070698_100101172
659 Ga0070698_100112064
660 Ga0070698_100202658
661 Ga0070699_100020721
662 Ga0070699_100049834
663 Ga0070699_100118090
664 Ga0070699_100297885
665 Ga0070679_100067376
666 Ga0070679_100094656
667 Ga0070684_100014629
668 Ga0070684_100017563
669 Ga0070684_100028863
670 Ga0070684_100093161
671 Ga0070684_100140231
672 Ga0070684_100167398
673 Ga0070684_100206544
674 Ga0070684_100375239
675 Ga0070697_100223732
676 Ga0070695_100040948
677 Ga0070695_100117778
678 Ga0070696_100011479
679 Ga0070693_100005821
680 Ga0070693_100174580
681 Ga0070665_100013370
682 Ga0070704_100182234
683 Ga0068855_100050832
684 Ga0068855_100080104
685 Ga0070664_100068336
686 Ga0070664_100134118
687 Ga0070664_100228650
688 Ga0068857_100005143
689 Ga0068857_100516160
690 Ga0068854_100107840
691 Ga0068854_100275339
692 Ga0068856_100151522
693 Ga0070702_100117492
694 Ga0070702_100319155
695 Ga0068852_100120035
696 Ga0068852_100591186
697 Ga0068852_100639065
698 Ga0068859_100059808
699 Ga0068866_10075494
700 Ga0068861_100112186
701 Ga0068870_10039090
702 Ga0068870_10227741
703 Ga0068858_100013364
704 Ga0081455_10020553
705 Ga0081455_10025791
706 Ga0081455_10117444
707 Ga0081455_10342198
708 Ga0081538_10008791
709 Ga0081539_10000433
710 Ga0070717_10224256
711 Ga0070717_10536814
712 Ga0075364_10060151
713 Ga0075432_10068081
714 Ga0075432_10070999
715 Ga0070715_10097732
716 Ga0070716_100010378
717 Ga0070716_100157795
718 Ga0070712_100390476
719 Ga0075428_100033810
720 Ga0075428_100101694
721 Ga0075430_100099729
722 Ga0075431_100162140
723 Ga0075433_10028863
724 Ga0075433_10179168
725 Ga0075434_100052890
726 Ga0075434_100304356
727 Ga0075429_100275627
728 Ga0068865_100098922
729 Ga0075436_100072891
730 Ga0097620_100059802
731 Ga0075435_100041990
732 Ga0075435_100373802
733 Ga0105240_10136014
734 Ga0111539_10012380
735 Ga0111539_10114366
736 Ga0111539_10427896
737 Ga0105245_10029708
738 Ga0105245_10040856
739 Ga0105245_10132686
740 Ga0105247_10017681
741 Ga0114129_10005186
742 Ga0114129_10033307
743 Ga0114129_10039597
744 Ga0114129_10178225
745 Ga0114129_10380647
746 Ga0114129_10452851
747 Ga0105243_10040776
748 Ga0105243_10041272
749 Ga0105243_10100255
750 Ga0105243_10623682
751 Ga0105242_10058291
752 Ga0105248_10035508
753 Ga0105237_10723414
754 Ga0105238_10368404
755 Ga0105238_10581393
756 Ga0105249_10051563
757 Ga0105249_10080535
758 Ga0105249_10293211
759 Ga0105239_10013563
760 Ga0105239_10212107
761 Ga0105239_10302213
762 Ga0105246_10052067
763 Ga0105246_10052505
764 Ga0105246_10360647
765 Ga0157370_10050383
766 Ga0157370_10057103
767 Ga0157369_10036233
768 Ga0157369_10045651
769 Ga0157369_10172799
770 Ga0157369_10211564
771 Ga0163162_10350738
772 Ga0163163_10228141
773 Ga0157377_10097665
774 Ga0157377_10138583
775 Ga0157377_10150570
776 Ga0157379_10027872
777 Ga0206356_10537382
778 Ga0207653_10007908
779 Ga0207688_10034742
780 Ga0207699_10103080
781 Ga0207645_10193343
782 Ga0207643_10310108
783 Ga0207705_10021630
784 Ga0207705_10249959
785 Ga0207684_10163714
786 Ga0207684_10234128
787 Ga0207684_10381616
788 Ga0207695_10057395
789 Ga0207695_10073223
790 Ga0207693_10052149
791 Ga0207663_10100953
792 Ga0207663_10246807
793 Ga0207660_10012867
794 Ga0207660_10338754
795 Ga0207657_10095840
796 Ga0207657_10233325
797 Ga0207649_10059474
798 Ga0207652_10001978
799 Ga0207652_10021225
800 Ga0207652_10156174
801 Ga0207652_10317617
802 Ga0207646_10302702
803 Ga0207694_10097456
804 Ga0207650_10476390
805 Ga0207650_10489277
806 Ga0207659_10411874
807 Ga0207687_10017642
808 Ga0207687_10074872
809 Ga0207687_10082273
810 Ga0207687_10126858
811 Ga0207664_10085145
812 Ga0207664_10108885
813 Ga0207644_10057014
814 Ga0207690_10124856
815 Ga0207706_10039090
816 Ga0207686_10057903
817 Ga0207670_10522725
818 Ga0207704_10148124
819 Ga0207665_10033144
820 Ga0207689_10028579
821 Ga0207689_10094338
822 Ga0207689_10205981
823 Ga0207661_10002757
824 Ga0207661_10005380
825 Ga0207661_10042170
826 Ga0207661_10063820
827 Ga0207679_10170026
828 Ga0207679_10191700
829 Ga0207679_10239403
830 Ga0207679_10503119
831 Ga0207679_10544665
832 Ga0207667_10713180
833 Ga0207651_10144095
834 Ga0207712_10023123
835 Ga0207712_10147705
836 Ga0207668_10110184
837 Ga0207640_10045029
838 Ga0207640_10133815
839 Ga0207677_10032908
840 Ga0207677_10424528
841 Ga0207703_10031892
842 Ga0207678_10225926
843 Ga0207702_10009674
844 Ga0207702_10187657
845 Ga0207641_10015119
846 Ga0207641_10543185
847 Ga0207648_10229248
848 Ga0207648_10264509
849 Ga0207648_10560547
850 Ga0207676_10345700
851 Ga0207674_10010741
852 Ga0207674_10069973
853 Ga0207675_100212300
854 Ga0207675_100496332
855 Ga0207683_10009996
856 Ga0207683_10290918
857 Ga0207698_10068430
858 Ga0207698_10277866
859 Ga0207698_10492317
860 Ga0209966_1012742
861 Ga0207428_10041278
862 Ga0207428_10065940
863 Ga0207428_10115010
864 Ga0207428_10134604
865 Ga0268266_10087010
866 Ga0268264_10475457
867 Ga0265319_1006553
868 Ga0265334_10034700
869 Ga0265318_10000286
870 Ga0265318_10007801
871 Ga0265322_10004433
872 Ga0265336_10004057
873 Ga0265336_10022074
874 Ga0265338_10004582
875 Ga0265338_10032499
876 Ga0265338_10054962
877 Ga0265330_10000170
878 Ga0265330_10017953
879 Ga0265332_10001371
880 Ga0265332_10038469
881 Ga0265328_10000396
882 Ga0265320_10013367
883 Ga0265320_10014683
884 Ga0265320_10116433
885 Ga0265325_10000058
886 Ga0265325_10156781
887 Ga0265329_10001018
888 Ga0265329_10009366
889 Ga0265329_10040225
890 Ga0265340_10001302
891 Ga0265339_10001168
892 Ga0265339_10002081
893 Ga0265339_10034397
894 Ga0265339_10081364
895 Ga0265331_10000568
896 Ga0265327_10004500
897 Ga0265327_10061966
898 Ga0265327_10071078
899 Ga0265327_10136333
900 Ga0265327_10149927
901 Ga0265327_10158158
902 Ga0265316_10000700
903 Ga0265316_10009407
904 Ga0307408_100197050
905 Ga0307408_100586012
906 Ga0265313_10000754
907 Ga0265313_10096279
908 Ga0265314_10000982
909 Ga0265314_10006552
910 Ga0265314_10009563
911 Ga0265314_10138707
912 Ga0265342_10001473
913 Ga0307405_10022721
914 Ga0307413_10005658
915 Ga0307406_10520144
916 Ga0307407_10006366
917 Ga0307409_100099558
918 Ga0307416_100006095
919 Ga0307414_10022307
920 Ga0307411_10018117
921 Ga0307415_100016377
922 Ga0373948_0021533
923 Ga0373929_0025597
924 Ga0373960_0006877
925 Ga0373933_0138898
926 Ga0373937_0348784
927 Ga0395899_0041616
928 Ga0395899_0171422
929 Ga0395900_0181598
930 Ga0395900_0306465
931 Ga0395900_0485737
932 Ga0395898_0012539
933 Ga0395898_0041700
934 Ga0395898_0517719
935 Ga0395905_0049922
936 Ga0395905_0063424
937 Ga0395905_0315992
938 Ga0395901_0003433
939 Ga0395901_0005374
940 Ga0395901_0183307
941 Ga0242420_003538
942 Ga0436360_1034011
943 Ga0439453_0019626
944 Ga0451789_0068614
945 Ga0451800_0111257
946 Ga0451802_1690725
947 Ga0451807_2629204
948 Ga0451835_0070927
949 Ga0451839_0131532
950 Ga0451855_2003555
951 Ga0451853_1182808
952 Ga0439441_008684
953 Ga0450920_012623
954 Ga0439458_0025548
955 Ga0466966_0021021
956 Ga0466961_0222852
957 Ga0466963_0029963
958 Ga0466963_0045069
959 Ga0466963_0073676
960 Ga0466964_0083887
961 Ga0466971_0022908
962 Ga0466957_0038706
963 Ga0466957_0329014
964 Ga0466959_0008653
965 Ga0466959_0135165
966 Ga0466958_0057855
967 Ga0466958_0148577
968 Ga0466967_0014542
969 Ga0466967_0033729
970 Ga0466967_0146115
971 Ga0466967_0155248
972 Ga0466967_0158329
973 Ga0495603_0030972
974 Ga0495641_0152205
975 Ga0495651_0055130
976 Ga0495605_0064635
977 Ga0495584_0092768
978 Ga0495594_0173920
979 Ga0495596_0024074
980 Ga0495616_0036803
981 Ga0495616_0125441
982 Ga0495618_0237270
983 Ga0495628_0128100
984 Ga0495631_0079246
985 Ga0495637_0028724
986 Ga0495637_0108498
987 Ga0495644_0087033
988 Ga0495663_0026644
989 Ga0495642_0063642
990 Ga0495652_0203563
991 Ga0495640_0249942
992 Ga0495587_0104847
993 Ga0495598_0016203
994 Ga0495609_0027826
995 Ga0495609_0079918
996 Ga0495597_0104461
997 Ga0495645_0077748
998 Ga0495667_0012883
999 Ga0495656_0086727
1000 Ga0495656_0123072
1001 Ga0495668_0033532
1002 Ga0495634_0003820
1003 Ga0495611_0109761
1004 Ga0495635_0036470
1005 Ga0495635_0102418
1006 Ga0495659_0020021
1007 Ga0495599_0106149
1008 Ga0495658_0232929
1009 Ga0495670_0174720
1010 Ga0495589_0054548
1011 Ga0495589_0103793
1012 Ga0495674_0383393
1013 Ga0495680_0003282
1014 Ga0495680_0110528
1015 Ga0495680_0200802
1016 Ga0495677_0028005
1017 Ga0495684_0095875
1018 Ga0495602_0235161
1019 Ga0495626_0116774
1020 Ga0496100_0060590
1021 Ga0496100_0149735
1022 Ga0496101_0220318
1023 Ga0496102_0007452
1024 Ga0496102_0462134
1025 Ga0496105_0163011
1026 Ga0496107_0046639
1027 Ga0496107_0223351
1028 Ga0496108_0014918
1029 Ga0496108_0219324
1030 Ga0496109_0012800
1031 Ga0496109_0182260
1032 Ga0496109_0210337
1033 Ga0496110_0005208
1034 Ga0496110_0098908
1035 Ga0496110_0493532
1036 Ga0496111_0001090
1037 Ga0496111_0011296
1038 Ga0496111_0051345
1039 Ga0496111_0286501
1040 Ga0496112_0220945
1041 Ga0496112_0328107
1042 Ga0496112_0340623
1043 Ga0496113_0209865
1044 Ga0496114_0026697
1045 Ga0496115_0038139
1046 Ga0501031_0010423
1047 Ga0501031_0017419
1048 Ga0501031_0026588
1049 Ga0501032_0049700
1050 Ga0501032_0148379
1051 Ga0501033_0022998
1052 Ga0501033_0043337
1053 Ga0501033_0348687
1054 Ga0501033_0403409
1055 Ga0501034_0005913
1056 Ga0501034_0014992
1057 Ga0501036_0015680
1058 Ga0501036_0015960
1059 Ga0501036_0047636
1060 Ga0501036_0139664
1061 Ga0501036_0181211
1062 Ga0501036_0231004
1063 Ga0501037_0015806
1064 Ga0501037_0033201
1065 Ga0501038_0005341
1066 Ga0501038_0015360
1067 Ga0501038_0063765
1068 Ga0501038_0093232
1069 Ga0501038_0107248
1070 Ga0501039_0015111
1071 Ga0501039_0016582
1072 Ga0501039_0017330
1073 Ga0501039_0035028
1074 Ga0501039_0109453
1075 Ga0501040_0005058
1076 Ga0501040_0009515
1077 Ga0501040_0037211
1078 Ga0501040_0105088
1079 Ga0501041_0006242
1080 Ga0501041_0008251
1081 Ga0501041_0013318
1082 Ga0501041_0117265
1083 Ga0501042_0007362
1084 Ga0501042_0021070
1085 Ga0501042_0090455
1086 Ga0501043_0052521
1087 Ga0501043_0121755
1088 Ga0501043_0353885
1089 Ga0501046_0005025
1090 Ga0501046_0022076
1091 Ga0501046_0022930
1092 Ga0501046_0234073
1093 Ga0501047_0626358
1094 Ga0501048_0007167
1095 Ga0501048_0046034
1096 Ga0501048_0063684
1097 Ga0501048_0190430
1098 Ga0501067_0007804
1099 Ga0501067_0013328
1100 Ga0501067_0175401
1101 Ga0501068_0008992
1102 Ga0501068_0023006
1103 Ga0501068_0067500
1104 Ga0501069_0009252
1105 Ga0501069_0035678
1106 Ga0501070_0002071
1107 Ga0501070_0006123
1108 Ga0501070_0021493
1109 Ga0501070_0077415
1110 Ga0501071_0005145
1111 Ga0501071_0007588
1112 Ga0501071_0039797
1113 Ga0501072_0009054
1114 Ga0501072_0012104
1115 Ga0501072_0385251
1116 Ga0501073_0009579
1117 Ga0501073_0010184
1118 Ga0501073_0013640
1119 Ga0501073_0045603
1120 Ga0501073_0093353
1121 Ga0501074_0008573
1122 Ga0501074_0009263
1123 Ga0501074_0022855
1124 Ga0501074_0023670
1125 Ga0501074_0076583
1126 Ga0501074_0123976
1127 Ga0501075_0004355
1128 Ga0501075_0017740
1129 Ga0501075_0040650
1130 Ga0501075_0041833
1131 Ga0501075_0259814
1132 Ga0501076_0003298
1133 Ga0501076_0007628
1134 Ga0501076_0032611
1135 Ga0501076_0270097
1136 Ga0501076_0337541
1137 Ga0501077_0005659
1138 Ga0501077_0017987
1139 Ga0501077_0210775
1140 Ga0501079_0007041
1141 Ga0501079_0013478
1142 Ga0501079_0242063
1143 Ga0501080_0003099
1144 Ga0501080_0023793
1145 Ga0501080_0025463
1146 Ga0501080_0088297
1147 Ga0501080_0714476
1148 Ga0501081_0006900
1149 Ga0501081_0015417
1150 Ga0501081_0022536
1151 Ga0501081_0036234
1152 Ga0501081_0222097
1153 Ga0501081_0306958
1154 Ga0501083_0021145
1155 Ga0501083_0025235
1156 Ga0501083_0198736
1157 Ga0501035_0013202
1158 Ga0501035_0038603
1159 Ga0501035_0066840
1160 Ga0501044_0041747
1161 Ga0501045_0004861
1162 Ga0501045_0016092
1163 Ga0501045_0108497
1164 nmdc:mga00v17_39663_c1
1165 nmdc:mga0yw44_92507_c1
1166 nmdc:mga05p37_429281_c1
1167 nmdc:mga05p37_55864_c1
1168 nmdc:mga05p37_708134_c1
1169 nmdc:mga05p37_760932_c1
1170 nmdc:mga09592_101044_c1
1171 nmdc:mga0qj67_64831_c2
1172 nmdc:mga06r32_142130_c1
1173 nmdc:mga08y16_25275_c1
1174 nmdc:mga08y16_309851_c1
1175 nmdc:mga08y16_49928_c1
1176 nmdc:mga08y16_51592_c1
1177 nmdc:mga0n895_88907_c1
1178 nmdc:mga0n895_934060_c1
1179 nmdc:mga0rr50_45265_c1
1180 nmdc:mga08x19_106274_c1
1181 nmdc:mga08x19_90466_c1
1182 nmdc:mga0a205_28996_c1
1183 nmdc:mga0a205_563810_c1
1184 nmdc:mga0a205_681233_c1
1185 Ga0495619_0031628
1186 Ga0495619_0057870
1187 Ga0501084_0005511
1188 Ga0501084_0014150
1189 Ga0501084_0019688
1190 Ga0501084_0036250
1191 Ga0501084_0253779
1192 Ga0501084_0296683
1193 Ga0590074_013353
1194 Ga0501082_0001298
1195 Ga0501082_0011402
1196 Ga0501082_0022081
1197 Ga0501082_0058804
1198 Ga0501082_0277946
1199 Ga0530510_0001689
1200 Ga0530510_0005528
1201 Ga0530510_0006141
1202 Ga0530510_0009072
1203 Ga0530510_0017138
1204 Ga0530510_0371679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

194

271

0.9

PF13312

DUF4081

Domain of unknown function (DUF4081)

49

147

0.89

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

152

262

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a9o-assembly1.cif.gz_B structure of the polyamine acetyltransferase dpa 0.8236 126 256
2eui-assembly2.cif.gz_E crystal structure of a probable acetyltransferase 0.8224 126 256
3e0k-assembly1.cif.gz_A-2 crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus 0.815 126 256
8a9n-assembly1.cif.gz_B structure of dpa polyamine acetyltransferase in complex with 1,3-dap 0.8113 126 256
8a9o-assembly1.cif.gz_A structure of the polyamine acetyltransferase dpa 0.8032 126 257
ID Description Score Start End Superfamily
af_I6XFI7_58_284_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9505 52 264 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9004 195 252 3.40.630.30
af_I6XFI7_58_284_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8899 52 264 3.40.630.30
af_Q4CNN1_154_277_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8695 197 251 3.40.630.30
af_A0A0R0IHP4_113_245_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8683 184 254 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A538CJW6-F1-model_v4 GNAT family N-acetyltransferase 0.994 8 264 GO:0016747
AF-A0A538H954-F1-model_v4 GNAT family N-acetyltransferase 0.993 100 264 GO:0016747
AF-A0A7V9V123-F1-model_v4 GNAT family N-acetyltransferase 0.9925 6 264 GO:0016747
AF-A0A538JJZ9-F1-model_v4 GNAT family N-acetyltransferase 0.9922 1 264 GO:0016747
AF-A0A7W0SYQ2-F1-model_v4 GNAT family N-acetyltransferase 0.9903 54 264 GO:0016747

Map