F468043
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 601 | 301 | 600 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300005535|Ga0070684_100177751|Ga0070684_1001777514 |
| Length | 114 |
| Sequence | MVRAVSQTIELPRTGGPGTGLGGSWRVIVRNDDHNTFDHVAHTLAGTIPGVSVDAGYRFADRIHNTGMAIVWSGHLEAAEHYWEQLVEAGLTMAPGTGLGPDRRAGGDTRAQCH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 164 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 166 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 200 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 201 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 204 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 205 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 206 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 296 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 301 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 11.81 |
| Rhizosphere | 85.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10111344 | 3300003203 | Bacteria | 810 |
| 2 | JGI25407J50210_10050147 | 3300003373 | Bacteria | 1059 |
| 3 | Ga0070658_10802408 | 3300005327 | Bacteria | 818 |
| 4 | Ga0070676_11264417 | 3300005328 | Bacteria | 563 |
| 5 | Ga0070683_101095262 | 3300005329 | Bacteria | 765 |
| 6 | Ga0070683_101167952 | 3300005329 | Bacteria | 740 |
| 7 | Ga0070683_101616849 | 3300005329 | Bacteria | 623 |
| 8 | Ga0070690_100554811 | 3300005330 | Bacteria | 867 |
| 9 | Ga0070670_100755037 | 3300005331 | Bacteria | 877 |
| 10 | Ga0068869_101153551 | 3300005334 | Bacteria | 679 |
| 11 | Ga0068869_101876011 | 3300005334 | Bacteria | 537 |
| 12 | Ga0070666_10761269 | 3300005335 | Bacteria | 712 |
| 13 | Ga0070680_101068356 | 3300005336 | Bacteria | 697 |
| 14 | Ga0070682_100072547 | 3300005337 | Bacteria | 2206 |
| 15 | Ga0070682_100102265 | 3300005337 | Bacteria | 1894 |
| 16 | Ga0070682_101841171 | 3300005337 | Bacteria | 529 |
| 17 | Ga0068868_101157060 | 3300005338 | Bacteria | 714 |
| 18 | Ga0070660_100300494 | 3300005339 | Bacteria | 1316 |
| 19 | Ga0070687_100199396 | 3300005343 | Bacteria | 1211 |
| 20 | Ga0070687_100431878 | 3300005343 | Bacteria | 871 |
| 21 | Ga0070661_101130873 | 3300005344 | Unclassified | 653 |
| 22 | Ga0070692_10256195 | 3300005345 | Bacteria | 1050 |
| 23 | Ga0070692_10610381 | 3300005345 | Bacteria | 723 |
| 24 | Ga0070668_102197656 | 3300005347 | Bacteria | 510 |
| 25 | Ga0070669_100061979 | 3300005353 | Bacteria | 2749 |
| 26 | Ga0070675_102114635 | 3300005354 | Bacteria | 519 |
| 27 | Ga0070675_102243916 | 3300005354 | Bacteria | 503 |
| 28 | Ga0070671_100442447 | 3300005355 | Bacteria | 1115 |
| 29 | Ga0070671_100480124 | 3300005355 | Bacteria | 1068 |
| 30 | Ga0070674_100160373 | 3300005356 | Bacteria | 1706 |
| 31 | Ga0070674_101755205 | 3300005356 | Unclassified | 562 |
| 32 | Ga0070688_100202147 | 3300005365 | Bacteria | 1391 |
| 33 | Ga0070659_100022833 | 3300005366 | Bacteria | 4779 |
| 34 | Ga0070659_100389774 | 3300005366 | Bacteria | 1175 |
| 35 | Ga0070709_11000720 | 3300005434 | Bacteria | 665 |
| 36 | Ga0070710_10000009 | 3300005437 | Bacteria | 165863 |
| 37 | Ga0070710_10269354 | 3300005437 | Bacteria | 1101 |
| 38 | Ga0070710_10375979 | 3300005437 | Bacteria | 946 |
| 39 | Ga0070710_11459443 | 3300005437 | Bacteria | 513 |
| 40 | Ga0070701_10145785 | 3300005438 | Bacteria | 1359 |
| 41 | Ga0070701_10854495 | 3300005438 | Bacteria | 625 |
| 42 | Ga0070705_100562809 | 3300005440 | Bacteria | 876 |
| 43 | Ga0070705_101033548 | 3300005440 | Bacteria | 669 |
| 44 | Ga0070705_101155218 | 3300005440 | Bacteria | 636 |
| 45 | Ga0070700_100087779 | 3300005441 | Bacteria | 2022 |
| 46 | Ga0070700_101157888 | 3300005441 | Bacteria | 644 |
| 47 | Ga0070694_100834518 | 3300005444 | Bacteria | 757 |
| 48 | Ga0070663_100691820 | 3300005455 | Bacteria | 866 |
| 49 | Ga0070663_101103237 | 3300005455 | Bacteria | 694 |
| 50 | Ga0070678_100525449 | 3300005456 | Bacteria | 1048 |
| 51 | Ga0070678_100602752 | 3300005456 | Bacteria | 981 |
| 52 | Ga0070678_101345307 | 3300005456 | Bacteria | 665 |
| 53 | Ga0070662_100102570 | 3300005457 | Bacteria | 2168 |
| 54 | Ga0070662_100661238 | 3300005457 | Bacteria | 882 |
| 55 | Ga0070681_10082889 | 3300005458 | Bacteria | 3161 |
| 56 | Ga0068867_100988714 | 3300005459 | Unclassified | 762 |
| 57 | Ga0070685_10027951 | 3300005466 | Bacteria | 3122 |
| 58 | Ga0070684_100177751 | 3300005535 | Bacteria | 1935 |
| 59 | Ga0070684_100612553 | 3300005535 | Bacteria | 1013 |
| 60 | Ga0070684_101900413 | 3300005535 | Bacteria | 562 |
| 61 | Ga0070684_101980042 | 3300005535 | Bacteria | 550 |
| 62 | Ga0068853_100918547 | 3300005539 | Bacteria | 841 |
| 63 | Ga0070672_100624557 | 3300005543 | Bacteria | 940 |
| 64 | Ga0070686_100668084 | 3300005544 | Bacteria | 825 |
| 65 | Ga0070695_100302794 | 3300005545 | Bacteria | 1182 |
| 66 | Ga0070696_100188729 | 3300005546 | Bacteria | 1533 |
| 67 | Ga0070696_100789869 | 3300005546 | Bacteria | 781 |
| 68 | Ga0070693_100091270 | 3300005547 | Bacteria | 1837 |
| 69 | Ga0070693_100204033 | 3300005547 | Bacteria | 1286 |
| 70 | Ga0070693_100570387 | 3300005547 | Bacteria | 813 |
| 71 | Ga0070665_100264584 | 3300005548 | Bacteria | 1721 |
| 72 | Ga0070704_101138698 | 3300005549 | Bacteria | 710 |
| 73 | Ga0070664_100160511 | 3300005564 | Bacteria | 1989 |
| 74 | Ga0070664_100226335 | 3300005564 | Bacteria | 1675 |
| 75 | Ga0070664_100976124 | 3300005564 | Bacteria | 796 |
| 76 | Ga0068854_100147251 | 3300005578 | Bacteria | 1813 |
| 77 | Ga0068854_100544913 | 3300005578 | Bacteria | 983 |
| 78 | Ga0068854_100757249 | 3300005578 | Unclassified | 843 |
| 79 | Ga0068854_101211604 | 3300005578 | Bacteria | 677 |
| 80 | Ga0068856_100080235 | 3300005614 | Bacteria | 3236 |
| 81 | Ga0068856_100266443 | 3300005614 | Bacteria | 1729 |
| 82 | Ga0068856_100590481 | 3300005614 | Bacteria | 1132 |
| 83 | Ga0068856_102014348 | 3300005614 | Bacteria | 588 |
| 84 | Ga0068856_102639344 | 3300005614 | Unclassified | 508 |
| 85 | Ga0070702_100026757 | 3300005615 | Bacteria | 3103 |
| 86 | Ga0070702_100463710 | 3300005615 | Bacteria | 922 |
| 87 | Ga0068852_101081979 | 3300005616 | Bacteria | 822 |
| 88 | Ga0068852_101393418 | 3300005616 | Bacteria | 723 |
| 89 | Ga0068852_101408805 | 3300005616 | Bacteria | 719 |
| 90 | Ga0068864_101332765 | 3300005618 | Bacteria | 718 |
| 91 | Ga0068864_102013358 | 3300005618 | Bacteria | 584 |
| 92 | Ga0068866_10216179 | 3300005718 | Bacteria | 1154 |
| 93 | Ga0068861_100075562 | 3300005719 | Bacteria | 2623 |
| 94 | Ga0068851_10248871 | 3300005834 | Bacteria | 1007 |
| 95 | Ga0068851_10420819 | 3300005834 | Bacteria | 789 |
| 96 | Ga0068870_10057609 | 3300005840 | Bacteria | 2078 |
| 97 | Ga0068860_101125424 | 3300005843 | Bacteria | 805 |
| 98 | Ga0068860_101819812 | 3300005843 | Bacteria | 631 |
| 99 | Ga0068862_100088556 | 3300005844 | Bacteria | 2693 |
| 100 | Ga0068862_100538606 | 3300005844 | Bacteria | 1113 |
| 101 | Ga0068862_100566227 | 3300005844 | Bacteria | 1087 |
| 102 | Ga0081538_10001913 | 3300005981 | Bacteria | 20841 |
| 103 | Ga0081538_10004097 | 3300005981 | Bacteria | 13549 |
| 104 | Ga0081538_10021300 | 3300005981 | Bacteria | 4737 |
| 105 | Ga0081538_10037999 | 3300005981 | Bacteria | 3113 |
| 106 | Ga0081538_10328093 | 3300005981 | Bacteria | 557 |
| 107 | Ga0081540_1001320 | 3300005983 | Bacteria | 21640 |
| 108 | Ga0081540_1041565 | 3300005983 | Bacteria | 2382 |
| 109 | Ga0081539_10002904 | 3300005985 | Bacteria | 22668 |
| 110 | Ga0081539_10003140 | 3300005985 | Bacteria | 21027 |
| 111 | Ga0081539_10003406 | 3300005985 | Bacteria | 19616 |
| 112 | Ga0081539_10053414 | 3300005985 | Bacteria | 2262 |
| 113 | Ga0081539_10364834 | 3300005985 | Unclassified | 605 |
| 114 | Ga0075432_10251145 | 3300006058 | Bacteria | 718 |
| 115 | Ga0075432_10405955 | 3300006058 | Bacteria | 589 |
| 116 | Ga0070716_100984837 | 3300006173 | Bacteria | 666 |
| 117 | Ga0070712_100000170 | 3300006175 | Bacteria | 35641 |
| 118 | Ga0070712_100540348 | 3300006175 | Bacteria | 981 |
| 119 | Ga0070712_101025242 | 3300006175 | Bacteria | 715 |
| 120 | Ga0068871_101017946 | 3300006358 | Bacteria | 772 |
| 121 | Ga0075428_102209549 | 3300006844 | Bacteria | 567 |
| 122 | Ga0075433_11142675 | 3300006852 | Bacteria | 677 |
| 123 | Ga0075434_100111977 | 3300006871 | Bacteria | 2740 |
| 124 | Ga0075434_100571442 | 3300006871 | Bacteria | 1150 |
| 125 | Ga0075429_100414562 | 3300006880 | Unclassified | 1179 |
| 126 | Ga0068865_101476731 | 3300006881 | Bacteria | 608 |
| 127 | Ga0075435_100144981 | 3300007076 | Bacteria | 1994 |
| 128 | Ga0075435_100275518 | 3300007076 | Bacteria | 1436 |
| 129 | Ga0075435_100277192 | 3300007076 | Bacteria | 1431 |
| 130 | Ga0105244_10268898 | 3300009036 | Bacteria | 792 |
| 131 | Ga0105240_10617140 | 3300009093 | Bacteria | 1192 |
| 132 | Ga0111539_10140971 | 3300009094 | Bacteria | 2822 |
| 133 | Ga0111539_10491343 | 3300009094 | Bacteria | 1429 |
| 134 | Ga0111539_10698662 | 3300009094 | Bacteria | 1181 |
| 135 | Ga0105245_10148040 | 3300009098 | Bacteria | 2217 |
| 136 | Ga0105245_10300953 | 3300009098 | Bacteria | 1574 |
| 137 | Ga0105245_10569807 | 3300009098 | Bacteria | 1156 |
| 138 | Ga0105245_10848514 | 3300009098 | Bacteria | 953 |
| 139 | Ga0105245_10927043 | 3300009098 | Bacteria | 913 |
| 140 | Ga0105245_10984426 | 3300009098 | Bacteria | 887 |
| 141 | Ga0105245_12073789 | 3300009098 | Bacteria | 622 |
| 142 | Ga0105247_10351179 | 3300009101 | Bacteria | 1037 |
| 143 | Ga0114129_12939875 | 3300009147 | Bacteria | 562 |
| 144 | Ga0105243_10378421 | 3300009148 | Bacteria | 1309 |
| 145 | Ga0105243_10464816 | 3300009148 | Bacteria | 1190 |
| 146 | Ga0105243_10627595 | 3300009148 | Bacteria | 1038 |
| 147 | Ga0105243_10627799 | 3300009148 | Bacteria | 1038 |
| 148 | Ga0105243_10755345 | 3300009148 | Bacteria | 954 |
| 149 | Ga0105243_12467507 | 3300009148 | Unclassified | 559 |
| 150 | Ga0105243_12500158 | 3300009148 | Bacteria | 555 |
| 151 | Ga0105243_12830072 | 3300009148 | Bacteria | 526 |
| 152 | Ga0105241_10463801 | 3300009174 | Bacteria | 1123 |
| 153 | Ga0105242_10048110 | 3300009176 | Bacteria | 3465 |
| 154 | Ga0105242_10327070 | 3300009176 | Bacteria | 1408 |
| 155 | Ga0105242_11721342 | 3300009176 | Unclassified | 664 |
| 156 | Ga0105248_11686584 | 3300009177 | Bacteria | 718 |
| 157 | Ga0105248_13290680 | 3300009177 | Bacteria | 514 |
| 158 | Ga0105238_10641953 | 3300009551 | Bacteria | 1071 |
| 159 | Ga0105238_10798137 | 3300009551 | Bacteria | 959 |
| 160 | Ga0105238_10926481 | 3300009551 | Bacteria | 890 |
| 161 | Ga0105238_11211681 | 3300009551 | Bacteria | 779 |
| 162 | Ga0105249_10103726 | 3300009553 | Bacteria | 2679 |
| 163 | Ga0105249_10684267 | 3300009553 | Bacteria | 1085 |
| 164 | Ga0105249_10895128 | 3300009553 | Bacteria | 954 |
| 165 | Ga0105249_11087897 | 3300009553 | Bacteria | 869 |
| 166 | Ga0105249_11284670 | 3300009553 | Bacteria | 803 |
| 167 | Ga0105249_13406021 | 3300009553 | Bacteria | 512 |
| 168 | Ga0105239_10171107 | 3300010375 | Bacteria | 2429 |
| 169 | Ga0105239_10281454 | 3300010375 | Bacteria | 1872 |
| 170 | Ga0105239_10529093 | 3300010375 | Bacteria | 1342 |
| 171 | Ga0105239_10670010 | 3300010375 | Bacteria | 1185 |
| 172 | Ga0105239_12796733 | 3300010375 | Bacteria | 569 |
| 173 | Ga0105246_10451643 | 3300011119 | Bacteria | 1080 |
| 174 | Ga0157345_1044286 | 3300012498 | Bacteria | 546 |
| 175 | Ga0157371_10458842 | 3300013102 | Bacteria | 937 |
| 176 | Ga0157371_10545933 | 3300013102 | Bacteria | 859 |
| 177 | Ga0157371_10610582 | 3300013102 | Bacteria | 812 |
| 178 | Ga0157369_11787013 | 3300013105 | Bacteria | 624 |
| 179 | Ga0157369_12327379 | 3300013105 | Bacteria | 543 |
| 180 | Ga0157374_10364642 | 3300013296 | Bacteria | 1437 |
| 181 | Ga0157374_12112936 | 3300013296 | Bacteria | 590 |
| 182 | Ga0157378_10251438 | 3300013297 | Bacteria | 1692 |
| 183 | Ga0157378_10710324 | 3300013297 | Bacteria | 1025 |
| 184 | Ga0157378_11204776 | 3300013297 | Bacteria | 797 |
| 185 | Ga0157378_12054479 | 3300013297 | Bacteria | 622 |
| 186 | Ga0163162_10181675 | 3300013306 | Bacteria | 2230 |
| 187 | Ga0157372_10220228 | 3300013307 | Bacteria | 2200 |
| 188 | Ga0157372_10561991 | 3300013307 | Bacteria | 1330 |
| 189 | Ga0157372_11023050 | 3300013307 | Bacteria | 957 |
| 190 | Ga0157372_11326084 | 3300013307 | Bacteria | 830 |
| 191 | Ga0157372_11434404 | 3300013307 | Bacteria | 796 |
| 192 | Ga0157375_10175788 | 3300013308 | Bacteria | 2290 |
| 193 | Ga0157375_11428620 | 3300013308 | Bacteria | 815 |
| 194 | Ga0163163_10411871 | 3300014325 | Bacteria | 1410 |
| 195 | Ga0163163_11123278 | 3300014325 | Bacteria | 849 |
| 196 | Ga0157380_11918985 | 3300014326 | Bacteria | 653 |
| 197 | Ga0157380_12653865 | 3300014326 | Bacteria | 567 |
| 198 | Ga0157380_12865060 | 3300014326 | Bacteria | 549 |
| 199 | Ga0157380_13525861 | 3300014326 | Unclassified | 501 |
| 200 | Ga0182008_10141013 | 3300014497 | Bacteria | 1205 |
| 201 | Ga0182008_10478473 | 3300014497 | Bacteria | 681 |
| 202 | Ga0157377_10293881 | 3300014745 | Bacteria | 1070 |
| 203 | Ga0157377_10310054 | 3300014745 | Bacteria | 1045 |
| 204 | Ga0157377_10418812 | 3300014745 | Bacteria | 917 |
| 205 | Ga0157377_11240354 | 3300014745 | Bacteria | 579 |
| 206 | Ga0157379_10001699 | 3300014968 | Bacteria | 18215 |
| 207 | Ga0157379_11051276 | 3300014968 | Bacteria | 778 |
| 208 | Ga0157379_11168493 | 3300014968 | Bacteria | 739 |
| 209 | Ga0157379_11276782 | 3300014968 | Bacteria | 708 |
| 210 | Ga0157376_10578196 | 3300014969 | Bacteria | 1115 |
| 211 | Ga0157376_11100528 | 3300014969 | Bacteria | 820 |
| 212 | Ga0157376_13065640 | 3300014969 | Unclassified | 506 |
| 213 | Ga0163161_10621065 | 3300017792 | Bacteria | 893 |
| 214 | Ga0213876_10062878 | 3300021384 | Bacteria | 1960 |
| 215 | Ga0213875_10586612 | 3300021388 | Bacteria | 538 |
| 216 | Ga0207656_10022875 | 3300025321 | Bacteria | 2511 |
| 217 | Ga0207682_10452613 | 3300025893 | Bacteria | 608 |
| 218 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 219 | Ga0207692_10140913 | 3300025898 | Bacteria | 1371 |
| 220 | Ga0207692_10279352 | 3300025898 | Bacteria | 1010 |
| 221 | Ga0207692_10945561 | 3300025898 | Bacteria | 568 |
| 222 | Ga0207642_10014980 | 3300025899 | Bacteria | 2877 |
| 223 | Ga0207642_10511381 | 3300025899 | Bacteria | 737 |
| 224 | Ga0207688_10205635 | 3300025901 | Bacteria | 1182 |
| 225 | Ga0207680_11227543 | 3300025903 | Bacteria | 534 |
| 226 | Ga0207647_10194648 | 3300025904 | Bacteria | 1174 |
| 227 | Ga0207647_10220799 | 3300025904 | Bacteria | 1092 |
| 228 | Ga0207645_10558386 | 3300025907 | Bacteria | 777 |
| 229 | Ga0207643_10228889 | 3300025908 | Bacteria | 1140 |
| 230 | Ga0207654_10173914 | 3300025911 | Bacteria | 1400 |
| 231 | Ga0207707_10279178 | 3300025912 | Bacteria | 1447 |
| 232 | Ga0207671_10714686 | 3300025914 | Bacteria | 796 |
| 233 | Ga0207693_10000028 | 3300025915 | Bacteria | 120041 |
| 234 | Ga0207663_10951964 | 3300025916 | Bacteria | 688 |
| 235 | Ga0207663_11317178 | 3300025916 | Bacteria | 582 |
| 236 | Ga0207660_11261179 | 3300025917 | Bacteria | 601 |
| 237 | Ga0207662_11265254 | 3300025918 | Bacteria | 524 |
| 238 | Ga0207657_10369117 | 3300025919 | Bacteria | 1131 |
| 239 | Ga0207649_10480287 | 3300025920 | Bacteria | 942 |
| 240 | Ga0207649_10724363 | 3300025920 | Bacteria | 773 |
| 241 | Ga0207652_10283361 | 3300025921 | Bacteria | 1495 |
| 242 | Ga0207652_10418275 | 3300025921 | Bacteria | 1209 |
| 243 | Ga0207681_10005963 | 3300025923 | Bacteria | 7475 |
| 244 | Ga0207681_10813753 | 3300025923 | Bacteria | 781 |
| 245 | Ga0207694_11777865 | 3300025924 | Bacteria | 518 |
| 246 | Ga0207650_10585448 | 3300025925 | Bacteria | 937 |
| 247 | Ga0207659_11092051 | 3300025926 | Bacteria | 686 |
| 248 | Ga0207687_10050485 | 3300025927 | Bacteria | 2895 |
| 249 | Ga0207687_10344562 | 3300025927 | Bacteria | 1212 |
| 250 | Ga0207687_10533700 | 3300025927 | Bacteria | 983 |
| 251 | Ga0207687_11092149 | 3300025927 | Bacteria | 685 |
| 252 | Ga0207687_11531858 | 3300025927 | Bacteria | 573 |
| 253 | Ga0207644_10319088 | 3300025931 | Bacteria | 1256 |
| 254 | Ga0207644_11528525 | 3300025931 | Bacteria | 560 |
| 255 | Ga0207690_10000460 | 3300025932 | Bacteria | 26175 |
| 256 | Ga0207690_10049503 | 3300025932 | Bacteria | 2802 |
| 257 | Ga0207690_10124526 | 3300025932 | Bacteria | 1877 |
| 258 | Ga0207690_10192094 | 3300025932 | Bacteria | 1545 |
| 259 | Ga0207706_10041051 | 3300025933 | Bacteria | 4102 |
| 260 | Ga0207706_10056983 | 3300025933 | Bacteria | 3443 |
| 261 | Ga0207706_10249807 | 3300025933 | Bacteria | 1550 |
| 262 | Ga0207706_11275456 | 3300025933 | Unclassified | 608 |
| 263 | Ga0207686_10069550 | 3300025934 | Bacteria | 2259 |
| 264 | Ga0207709_10016322 | 3300025935 | Bacteria | 4127 |
| 265 | Ga0207709_10239128 | 3300025935 | Bacteria | 1320 |
| 266 | Ga0207709_10518505 | 3300025935 | Bacteria | 933 |
| 267 | Ga0207670_10031320 | 3300025936 | Bacteria | 3407 |
| 268 | Ga0207669_10055412 | 3300025937 | Bacteria | 2401 |
| 269 | Ga0207669_10526560 | 3300025937 | Bacteria | 950 |
| 270 | Ga0207704_10089703 | 3300025938 | Bacteria | 2015 |
| 271 | Ga0207665_10970544 | 3300025939 | Bacteria | 675 |
| 272 | Ga0207691_10077524 | 3300025940 | Bacteria | 2994 |
| 273 | Ga0207691_10680762 | 3300025940 | Bacteria | 868 |
| 274 | Ga0207711_10653517 | 3300025941 | Bacteria | 981 |
| 275 | Ga0207689_10104293 | 3300025942 | Bacteria | 2330 |
| 276 | Ga0207661_10588642 | 3300025944 | Bacteria | 1021 |
| 277 | Ga0207679_10149136 | 3300025945 | Bacteria | 1901 |
| 278 | Ga0207679_10529674 | 3300025945 | Bacteria | 1055 |
| 279 | Ga0207679_10851511 | 3300025945 | Bacteria | 833 |
| 280 | Ga0207667_10661848 | 3300025949 | Bacteria | 1049 |
| 281 | Ga0207651_10252805 | 3300025960 | Bacteria | 1443 |
| 282 | Ga0207712_10212667 | 3300025961 | Bacteria | 1541 |
| 283 | Ga0207712_10280972 | 3300025961 | Bacteria | 1359 |
| 284 | Ga0207668_10460075 | 3300025972 | Bacteria | 1088 |
| 285 | Ga0207668_10638238 | 3300025972 | Bacteria | 931 |
| 286 | Ga0207668_10810798 | 3300025972 | Bacteria | 829 |
| 287 | Ga0207640_10129996 | 3300025981 | Bacteria | 1819 |
| 288 | Ga0207640_10204311 | 3300025981 | Bacteria | 1500 |
| 289 | Ga0207640_10469956 | 3300025981 | Bacteria | 1041 |
| 290 | Ga0207640_11552116 | 3300025981 | Bacteria | 596 |
| 291 | Ga0207658_11859664 | 3300025986 | Bacteria | 549 |
| 292 | Ga0207677_10035971 | 3300026023 | Bacteria | 3222 |
| 293 | Ga0207677_10233329 | 3300026023 | Bacteria | 1484 |
| 294 | Ga0207703_10139036 | 3300026035 | Bacteria | 2106 |
| 295 | Ga0207678_10172074 | 3300026067 | Bacteria | 1849 |
| 296 | Ga0207708_10059564 | 3300026075 | Bacteria | 2915 |
| 297 | Ga0207708_10164473 | 3300026075 | Unclassified | 1754 |
| 298 | Ga0207708_10474780 | 3300026075 | Bacteria | 1045 |
| 299 | Ga0207702_10236095 | 3300026078 | Bacteria | 1711 |
| 300 | Ga0207702_10380522 | 3300026078 | Bacteria | 1357 |
| 301 | Ga0207702_10990445 | 3300026078 | Bacteria | 834 |
| 302 | Ga0207641_10137733 | 3300026088 | Bacteria | 2199 |
| 303 | Ga0207648_10185362 | 3300026089 | Bacteria | 1843 |
| 304 | Ga0207648_10532352 | 3300026089 | Bacteria | 1077 |
| 305 | Ga0207676_10406750 | 3300026095 | Bacteria | 1273 |
| 306 | Ga0207676_12539376 | 3300026095 | Bacteria | 509 |
| 307 | Ga0207674_11054659 | 3300026116 | Bacteria | 782 |
| 308 | Ga0207674_11349453 | 3300026116 | Bacteria | 682 |
| 309 | Ga0207675_100063470 | 3300026118 | Bacteria | 3451 |
| 310 | Ga0207675_100081838 | 3300026118 | Bacteria | 3028 |
| 311 | Ga0207675_100340418 | 3300026118 | Bacteria | 1468 |
| 312 | Ga0207675_101653268 | 3300026118 | Bacteria | 660 |
| 313 | Ga0207683_10047015 | 3300026121 | Bacteria | 3779 |
| 314 | Ga0207428_10046930 | 3300027907 | Bacteria | 3471 |
| 315 | Ga0207428_10217387 | 3300027907 | Bacteria | 1434 |
| 316 | Ga0207428_10906467 | 3300027907 | Bacteria | 623 |
| 317 | Ga0268266_10178506 | 3300028379 | Bacteria | 1932 |
| 318 | Ga0268265_10129980 | 3300028380 | Bacteria | 2091 |
| 319 | Ga0268265_11307554 | 3300028380 | Bacteria | 725 |
| 320 | Ga0268264_10097986 | 3300028381 | Bacteria | 2542 |
| 321 | Ga0268264_11259928 | 3300028381 | Bacteria | 749 |
| 322 | Ga0268264_11755163 | 3300028381 | Bacteria | 631 |
| 323 | Ga0265326_10000030 | 3300028558 | Bacteria | 96518 |
| 324 | Ga0265319_1000088 | 3300028563 | Bacteria | 71590 |
| 325 | Ga0265319_1001802 | 3300028563 | Bacteria | 12252 |
| 326 | Ga0265319_1092039 | 3300028563 | Bacteria | 956 |
| 327 | Ga0265334_10000156 | 3300028573 | Bacteria | 42408 |
| 328 | Ga0265318_10003342 | 3300028577 | Bacteria | 8115 |
| 329 | Ga0265323_10217661 | 3300028653 | Unclassified | 599 |
| 330 | Ga0265322_10014765 | 3300028654 | Bacteria | 2258 |
| 331 | Ga0265336_10000515 | 3300028666 | Bacteria | 22427 |
| 332 | Ga0265338_10000536 | 3300028800 | Bacteria | 66434 |
| 333 | Ga0265338_10077006 | 3300028800 | Bacteria | 2821 |
| 334 | Ga0265338_10330281 | 3300028800 | Bacteria | 1101 |
| 335 | Ga0265324_10001136 | 3300029957 | Bacteria | 15983 |
| 336 | Ga0265332_10475914 | 3300031238 | Bacteria | 517 |
| 337 | Ga0265320_10011700 | 3300031240 | Bacteria | 5150 |
| 338 | Ga0265320_10023734 | 3300031240 | Bacteria | 3258 |
| 339 | Ga0265320_10039189 | 3300031240 | Bacteria | 2371 |
| 340 | Ga0265320_10061481 | 3300031240 | Bacteria | 1790 |
| 341 | Ga0265327_10072636 | 3300031251 | Bacteria | 1718 |
| 342 | Ga0265316_10072053 | 3300031344 | Bacteria | 2662 |
| 343 | Ga0265313_10039991 | 3300031595 | Bacteria | 2322 |
| 344 | Ga0265313_10165436 | 3300031595 | Bacteria | 937 |
| 345 | Ga0265314_10121748 | 3300031711 | Bacteria | 1641 |
| 346 | Ga0307413_11026150 | 3300031824 | Bacteria | 708 |
| 347 | Ga0307413_11439547 | 3300031824 | Bacteria | 607 |
| 348 | Ga0307410_11738897 | 3300031852 | Bacteria | 553 |
| 349 | Ga0326468_10028146 | 3300031889 | Bacteria | 725 |
| 350 | Ga0307406_10137431 | 3300031901 | Bacteria | 1725 |
| 351 | Ga0307406_11261258 | 3300031901 | Bacteria | 644 |
| 352 | Ga0307406_11384905 | 3300031901 | Bacteria | 616 |
| 353 | Ga0307407_11113576 | 3300031903 | Bacteria | 614 |
| 354 | Ga0307409_100634633 | 3300031995 | Bacteria | 1060 |
| 355 | Ga0307416_100528966 | 3300032002 | Bacteria | 1249 |
| 356 | Ga0307416_100578112 | 3300032002 | Bacteria | 1200 |
| 357 | Ga0307414_11928356 | 3300032004 | Bacteria | 551 |
| 358 | Ga0307411_10835188 | 3300032005 | Bacteria | 814 |
| 359 | Ga0307415_100863628 | 3300032126 | Bacteria | 831 |
| 360 | Ga0307415_101132784 | 3300032126 | Bacteria | 734 |
| 361 | Ga0307415_101526038 | 3300032126 | Bacteria | 640 |
| 362 | Ga0373946_0080555 | 3300035171 | Bacteria | 1425 |
| 363 | Ga0373961_0207481 | 3300035241 | Bacteria | 694 |
| 364 | Ga0373935_1151748 | 3300035692 | Bacteria | 578 |
| 365 | Ga0373947_0339982 | 3300035725 | Bacteria | 1006 |
| 366 | Ga0395900_0294161 | 3300037418 | Bacteria | 1612 |
| 367 | Ga0395900_1375960 | 3300037418 | Bacteria | 619 |
| 368 | Ga0395900_1664319 | 3300037418 | Bacteria | 549 |
| 369 | Ga0395898_1121559 | 3300037466 | Bacteria | 719 |
| 370 | Ga0395905_0902105 | 3300037471 | Bacteria | 787 |
| 371 | Ga0436364_0405852 | 3300037853 | Bacteria | 1778 |
| 372 | Ga0395901_0225079 | 3300038443 | Bacteria | 1960 |
| 373 | Ga0395901_0239242 | 3300038443 | Bacteria | 1894 |
| 374 | Ga0395901_0457015 | 3300038443 | Bacteria | 1305 |
| 375 | Ga0395901_0656918 | 3300038443 | Bacteria | 1051 |
| 376 | Ga0242420_063477 | 3300038996 | Bacteria | 741 |
| 377 | Ga0436365_1391036 | 3300039437 | Bacteria | 2045 |
| 378 | Ga0436363_1069811 | 3300039450 | Bacteria | 959 |
| 379 | Ga0436363_1509907 | 3300039450 | Bacteria | 1115 |
| 380 | Ga0436363_1618696 | 3300039450 | Bacteria | 508 |
| 381 | Ga0451795_1071654 | 3300041456 | Bacteria | 595 |
| 382 | Ga0451807_0359264 | 3300041486 | Bacteria | 742 |
| 383 | Ga0451833_0358762 | 3300041491 | Bacteria | 788 |
| 384 | Ga0451835_1000594 | 3300041492 | Bacteria | 921 |
| 385 | Ga0451839_0069234 | 3300041496 | Bacteria | 1195 |
| 386 | Ga0451853_2463626 | 3300041512 | Bacteria | 1792 |
| 387 | Ga0439448_0073593 | 3300042005 | Bacteria | 1140 |
| 388 | Ga0450902_097072 | 3300042137 | Bacteria | 523 |
| 389 | Ga0439464_0212011 | 3300042439 | Bacteria | 620 |
| 390 | Ga0439440_0223008 | 3300042993 | Bacteria | 566 |
| 391 | Ga0466972_0222628 | 3300044658 | Bacteria | 883 |
| 392 | Ga0466972_0629803 | 3300044658 | Bacteria | 508 |
| 393 | Ga0466961_0796199 | 3300044693 | Bacteria | 564 |
| 394 | Ga0466963_0167303 | 3300044694 | Bacteria | 1532 |
| 395 | Ga0466964_0058577 | 3300044706 | Bacteria | 1597 |
| 396 | Ga0466970_0032472 | 3300044765 | Bacteria | 2758 |
| 397 | Ga0466960_0005612 | 3300044901 | Bacteria | 4978 |
| 398 | Ga0466960_0192905 | 3300044901 | Bacteria | 1109 |
| 399 | Ga0466960_0229854 | 3300044901 | Bacteria | 1024 |
| 400 | Ga0466960_0864203 | 3300044901 | Bacteria | 550 |
| 401 | Ga0466960_1011754 | 3300044901 | Bacteria | 511 |
| 402 | Ga0466959_0619025 | 3300045049 | Bacteria | 728 |
| 403 | Ga0466967_0016857 | 3300045976 | Bacteria | 5777 |
| 404 | Ga0466967_0022542 | 3300045976 | Bacteria | 5141 |
| 405 | Ga0466967_0084611 | 3300045976 | Bacteria | 2870 |
| 406 | Ga0466967_0116344 | 3300045976 | Bacteria | 2463 |
| 407 | Ga0466967_0237946 | 3300045976 | Bacteria | 1736 |
| 408 | Ga0466967_0322474 | 3300045976 | Bacteria | 1490 |
| 409 | Ga0466967_0906928 | 3300045976 | Bacteria | 876 |
| 410 | Ga0466967_1237782 | 3300045976 | Bacteria | 743 |
| 411 | Ga0466967_1459897 | 3300045976 | Bacteria | 681 |
| 412 | Ga0466967_2189466 | 3300045976 | Bacteria | 549 |
| 413 | Ga0495603_0087534 | 3300046455 | Bacteria | 1823 |
| 414 | Ga0495590_0254730 | 3300046457 | Bacteria | 654 |
| 415 | Ga0495650_0000063 | 3300046471 | Bacteria | 277841 |
| 416 | Ga0495580_0636541 | 3300046472 | Bacteria | 702 |
| 417 | Ga0495584_0687171 | 3300046491 | Bacteria | 522 |
| 418 | Ga0495585_0100003 | 3300046492 | Bacteria | 1552 |
| 419 | Ga0495594_0146038 | 3300046499 | Bacteria | 1342 |
| 420 | Ga0495630_1389017 | 3300046517 | Bacteria | 528 |
| 421 | Ga0495637_0138304 | 3300046520 | Bacteria | 926 |
| 422 | Ga0495637_0335947 | 3300046520 | Bacteria | 532 |
| 423 | Ga0495644_0043755 | 3300046523 | Bacteria | 1685 |
| 424 | Ga0495652_0056967 | 3300046529 | Bacteria | 3317 |
| 425 | Ga0495598_0331695 | 3300046537 | Bacteria | 582 |
| 426 | Ga0495609_0063723 | 3300046538 | Bacteria | 1627 |
| 427 | Ga0495645_0000228 | 3300046543 | Bacteria | 40598 |
| 428 | Ga0495656_0152203 | 3300046615 | Bacteria | 1118 |
| 429 | Ga0495611_0180078 | 3300046648 | Bacteria | 988 |
| 430 | Ga0495647_0572998 | 3300046681 | Bacteria | 529 |
| 431 | Ga0495658_0180595 | 3300046683 | Bacteria | 1309 |
| 432 | Ga0495624_0586964 | 3300046690 | Bacteria | 664 |
| 433 | Ga0495589_0543547 | 3300046794 | Bacteria | 530 |
| 434 | Ga0495600_0040734 | 3300046809 | Bacteria | 3026 |
| 435 | Ga0495581_0124794 | 3300047315 | Bacteria | 1499 |
| 436 | Ga0495676_0828000 | 3300047321 | Bacteria | 595 |
| 437 | Ga0495677_0271465 | 3300047445 | Bacteria | 665 |
| 438 | Ga0495679_135130 | 3300047446 | Bacteria | 668 |
| 439 | Ga0495686_0415546 | 3300047472 | Bacteria | 720 |
| 440 | Ga0496100_0000118 | 3300048903 | Bacteria | 45414 |
| 441 | Ga0496100_0034385 | 3300048903 | Bacteria | 3180 |
| 442 | Ga0496100_0060369 | 3300048903 | Bacteria | 2495 |
| 443 | Ga0496100_0103064 | 3300048903 | Bacteria | 1970 |
| 444 | Ga0496101_0001916 | 3300048904 | Bacteria | 12577 |
| 445 | Ga0496101_0020718 | 3300048904 | Bacteria | 4509 |
| 446 | Ga0496101_0132735 | 3300048904 | Bacteria | 1892 |
| 447 | Ga0496102_0000096 | 3300048905 | Bacteria | 124941 |
| 448 | Ga0496102_0488809 | 3300048905 | Bacteria | 1152 |
| 449 | Ga0496102_0580846 | 3300048905 | Bacteria | 1043 |
| 450 | Ga0496102_0581406 | 3300048905 | Bacteria | 1043 |
| 451 | Ga0496102_0889225 | 3300048905 | Bacteria | 812 |
| 452 | Ga0496102_0954199 | 3300048905 | Bacteria | 779 |
| 453 | Ga0496102_1393595 | 3300048905 | Bacteria | 620 |
| 454 | Ga0496103_0000035 | 3300048906 | Bacteria | 182242 |
| 455 | Ga0496103_0230116 | 3300048906 | Bacteria | 1192 |
| 456 | Ga0496103_0415074 | 3300048906 | Bacteria | 864 |
| 457 | Ga0496103_0865843 | 3300048906 | Bacteria | 568 |
| 458 | Ga0496104_0000028 | 3300048907 | Bacteria | 203377 |
| 459 | Ga0496104_0647244 | 3300048907 | Bacteria | 966 |
| 460 | Ga0496104_1390854 | 3300048907 | Bacteria | 605 |
| 461 | Ga0496105_0055331 | 3300048908 | Bacteria | 3276 |
| 462 | Ga0496105_0392581 | 3300048908 | Bacteria | 1103 |
| 463 | Ga0496105_0589519 | 3300048908 | Bacteria | 864 |
| 464 | Ga0496106_0033377 | 3300048909 | Bacteria | 3840 |
| 465 | Ga0496106_0070133 | 3300048909 | Bacteria | 2676 |
| 466 | Ga0496106_0351609 | 3300048909 | Bacteria | 1184 |
| 467 | Ga0496106_0385847 | 3300048909 | Bacteria | 1126 |
| 468 | Ga0496106_0438732 | 3300048909 | Bacteria | 1049 |
| 469 | Ga0496107_0062928 | 3300048910 | Bacteria | 2688 |
| 470 | Ga0496107_0164592 | 3300048910 | Bacteria | 1644 |
| 471 | Ga0496108_0025154 | 3300048911 | Bacteria | 4904 |
| 472 | Ga0496108_0035761 | 3300048911 | Bacteria | 4130 |
| 473 | Ga0496108_0051472 | 3300048911 | Bacteria | 3450 |
| 474 | Ga0496109_0024720 | 3300048912 | Bacteria | 5343 |
| 475 | Ga0496109_0031619 | 3300048912 | Bacteria | 4752 |
| 476 | Ga0496109_0166556 | 3300048912 | Bacteria | 2066 |
| 477 | Ga0496109_0190042 | 3300048912 | Bacteria | 1930 |
| 478 | Ga0496109_0583072 | 3300048912 | Bacteria | 1054 |
| 479 | Ga0496110_0000666 | 3300048913 | Bacteria | 23528 |
| 480 | Ga0496110_0002467 | 3300048913 | Bacteria | 13861 |
| 481 | Ga0496110_0038554 | 3300048913 | Bacteria | 4158 |
| 482 | Ga0496110_1025414 | 3300048913 | Bacteria | 733 |
| 483 | Ga0496110_1075948 | 3300048913 | Bacteria | 712 |
| 484 | Ga0496110_1362120 | 3300048913 | Bacteria | 619 |
| 485 | Ga0496111_0000229 | 3300048914 | Bacteria | 26736 |
| 486 | Ga0496111_0009578 | 3300048914 | Bacteria | 6471 |
| 487 | Ga0496111_0070554 | 3300048914 | Bacteria | 2541 |
| 488 | Ga0496111_0094422 | 3300048914 | Bacteria | 2193 |
| 489 | Ga0496111_0159737 | 3300048914 | Bacteria | 1673 |
| 490 | Ga0496111_0815151 | 3300048914 | Bacteria | 675 |
| 491 | Ga0496111_1279686 | 3300048914 | Bacteria | 517 |
| 492 | Ga0496111_1332845 | 3300048914 | Bacteria | 505 |
| 493 | Ga0496112_0000418 | 3300048915 | Bacteria | 28077 |
| 494 | Ga0496112_0008662 | 3300048915 | Bacteria | 9121 |
| 495 | Ga0496112_0194143 | 3300048915 | Bacteria | 1991 |
| 496 | Ga0496112_0330288 | 3300048915 | Bacteria | 1469 |
| 497 | Ga0496113_0007595 | 3300048916 | Bacteria | 6995 |
| 498 | Ga0496113_0083405 | 3300048916 | Bacteria | 2452 |
| 499 | Ga0496113_0178810 | 3300048916 | Bacteria | 1681 |
| 500 | Ga0496113_0920044 | 3300048916 | Bacteria | 691 |
| 501 | Ga0496114_0110111 | 3300048917 | Bacteria | 2359 |
| 502 | Ga0496114_0255675 | 3300048917 | Bacteria | 1542 |
| 503 | Ga0496114_0791113 | 3300048917 | Bacteria | 827 |
| 504 | Ga0496114_1005583 | 3300048917 | Bacteria | 717 |
| 505 | Ga0496115_0000350 | 3300048918 | Bacteria | 39036 |
| 506 | Ga0496115_0022745 | 3300048918 | Bacteria | 4860 |
| 507 | Ga0496115_0315187 | 3300048918 | Bacteria | 1280 |
| 508 | Ga0496115_0797346 | 3300048918 | Bacteria | 735 |
| 509 | Ga0496121_0024042 | 3300048924 | Bacteria | 5840 |
| 510 | Ga0496121_0058090 | 3300048924 | Bacteria | 3201 |
| 511 | Ga0496124_0364444 | 3300048927 | Bacteria | 1017 |
| 512 | Ga0501031_0046243 | 3300049568 | Bacteria | 2838 |
| 513 | Ga0501031_0178515 | 3300049568 | Bacteria | 1387 |
| 514 | Ga0501031_0263232 | 3300049568 | Bacteria | 1120 |
| 515 | Ga0501031_0388887 | 3300049568 | Bacteria | 902 |
| 516 | Ga0501034_0021900 | 3300049571 | Bacteria | 6512 |
| 517 | Ga0501036_0047983 | 3300049572 | Bacteria | 3616 |
| 518 | Ga0501036_0221600 | 3300049572 | Bacteria | 1588 |
| 519 | Ga0501037_0203658 | 3300049573 | Bacteria | 1398 |
| 520 | Ga0501038_0289437 | 3300049574 | Bacteria | 1288 |
| 521 | Ga0501038_0615036 | 3300049574 | Bacteria | 821 |
| 522 | Ga0501039_0014617 | 3300049575 | Bacteria | 6009 |
| 523 | Ga0501039_0292558 | 3300049575 | Bacteria | 1280 |
| 524 | Ga0501040_0045310 | 3300049576 | Bacteria | 2999 |
| 525 | Ga0501040_0061416 | 3300049576 | Bacteria | 2585 |
| 526 | Ga0501040_0719846 | 3300049576 | Bacteria | 722 |
| 527 | Ga0501041_0048537 | 3300049577 | Bacteria | 2586 |
| 528 | Ga0501041_0053572 | 3300049577 | Bacteria | 2461 |
| 529 | Ga0501042_0014356 | 3300049578 | Bacteria | 5406 |
| 530 | Ga0501042_0019959 | 3300049578 | Bacteria | 4661 |
| 531 | Ga0501042_0148998 | 3300049578 | Bacteria | 1687 |
| 532 | Ga0501042_0535081 | 3300049578 | Bacteria | 851 |
| 533 | Ga0501043_0497543 | 3300049579 | Bacteria | 911 |
| 534 | Ga0501046_0049634 | 3300049580 | Bacteria | 3319 |
| 535 | Ga0501046_0289936 | 3300049580 | Bacteria | 1197 |
| 536 | Ga0501048_0149280 | 3300049582 | Bacteria | 1653 |
| 537 | Ga0501048_1131475 | 3300049582 | Bacteria | 563 |
| 538 | Ga0501067_0341433 | 3300049583 | Bacteria | 834 |
| 539 | Ga0501067_0634285 | 3300049583 | Unclassified | 600 |
| 540 | Ga0501069_0562494 | 3300049585 | Bacteria | 683 |
| 541 | Ga0501070_0656567 | 3300049586 | Bacteria | 832 |
| 542 | Ga0501070_1027339 | 3300049586 | Unclassified | 638 |
| 543 | Ga0501071_0030118 | 3300049587 | Bacteria | 3837 |
| 544 | Ga0501071_0031317 | 3300049587 | Bacteria | 3769 |
| 545 | Ga0501071_0766459 | 3300049587 | Bacteria | 743 |
| 546 | Ga0501072_0014032 | 3300049588 | Bacteria | 6140 |
| 547 | Ga0501072_0138152 | 3300049588 | Bacteria | 1943 |
| 548 | Ga0501072_0247583 | 3300049588 | Bacteria | 1419 |
| 549 | Ga0501072_0510585 | 3300049588 | Bacteria | 950 |
| 550 | Ga0501073_0127537 | 3300049589 | Bacteria | 1764 |
| 551 | Ga0501074_0209437 | 3300049590 | Bacteria | 1389 |
| 552 | Ga0501074_0466369 | 3300049590 | Bacteria | 895 |
| 553 | Ga0501074_0798641 | 3300049590 | Bacteria | 665 |
| 554 | Ga0501075_0134829 | 3300049591 | Bacteria | 1881 |
| 555 | Ga0501075_0411957 | 3300049591 | Bacteria | 1030 |
| 556 | Ga0501075_0557687 | 3300049591 | Bacteria | 874 |
| 557 | Ga0501076_0186900 | 3300049592 | Bacteria | 1690 |
| 558 | Ga0501076_0326530 | 3300049592 | Bacteria | 1259 |
| 559 | Ga0501076_0422768 | 3300049592 | Bacteria | 1096 |
| 560 | Ga0501076_0495827 | 3300049592 | Bacteria | 1007 |
| 561 | Ga0501077_0480221 | 3300049593 | Bacteria | 796 |
| 562 | Ga0501079_0125805 | 3300049741 | Bacteria | 1994 |
| 563 | Ga0501079_0170709 | 3300049741 | Bacteria | 1696 |
| 564 | Ga0501079_0387193 | 3300049741 | Bacteria | 1096 |
| 565 | Ga0501080_0174862 | 3300049742 | Bacteria | 1979 |
| 566 | Ga0501080_0554841 | 3300049742 | Bacteria | 1023 |
| 567 | Ga0501081_0057198 | 3300049743 | Bacteria | 2696 |
| 568 | Ga0501081_0114490 | 3300049743 | Bacteria | 1916 |
| 569 | Ga0501081_0855663 | 3300049743 | Bacteria | 685 |
| 570 | Ga0501083_0117203 | 3300049744 | Bacteria | 1748 |
| 571 | Ga0501083_0381953 | 3300049744 | Bacteria | 916 |
| 572 | Ga0501035_0428582 | 3300049822 | Bacteria | 1097 |
| 573 | Ga0501045_0054352 | 3300049824 | Bacteria | 2927 |
| 574 | Ga0501045_0186115 | 3300049824 | Bacteria | 1547 |
| 575 | Ga0501045_0808607 | 3300049824 | Bacteria | 690 |
| 576 | Ga0501045_0820991 | 3300049824 | Bacteria | 684 |
| 577 | nmdc:mga09592_196946_c1 | 3300050508 | Bacteria | 1744 |
| 578 | nmdc:mga06r32_1885615_c1 | 3300050510 | Unclassified | 532 |
| 579 | nmdc:mga08y16_311413_c1 | 3300050511 | Bacteria | 1621 |
| 580 | nmdc:mga08y16_47162_c1 | 3300050511 | Bacteria | 4510 |
| 581 | nmdc:mga08y16_475046_c1 | 3300050511 | Bacteria | 1273 |
| 582 | nmdc:mga0n895_1441545_c1 | 3300050512 | Bacteria | 656 |
| 583 | nmdc:mga0n895_223369_c1 | 3300050512 | Bacteria | 1912 |
| 584 | nmdc:mga0n895_596557_c1 | 3300050512 | Bacteria | 1107 |
| 585 | nmdc:mga0rr50_140212_c1 | 3300050513 | Bacteria | 1944 |
| 586 | nmdc:mga0a205_822468_c1 | 3300050515 | Bacteria | 776 |
| 587 | Ga0495601_0000577 | 3300053077 | Bacteria | 19478 |
| 588 | Ga0495601_0118739 | 3300053077 | Bacteria | 1716 |
| 589 | Ga0495612_0000176 | 3300053078 | Bacteria | 26921 |
| 590 | Ga0500616_0005144 | 3300053153 | Bacteria | 8990 |
| 591 | Ga0501084_0067962 | 3300054114 | Bacteria | 2983 |
| 592 | Ga0501084_0734270 | 3300054114 | Bacteria | 832 |
| 593 | Ga0501084_0924440 | 3300054114 | Bacteria | 733 |
| 594 | Ga0587130_047276 | 3300059631 | Bacteria | 533 |
| 595 | Ga0587075_113150 | 3300059644 | Bacteria | 554 |
| 596 | Ga0501082_0105558 | 3300060353 | Bacteria | 2437 |
| 597 | Ga0501082_0181989 | 3300060353 | Bacteria | 1828 |
| 598 | Ga0466962_0685134 | 3300061719 | Bacteria | 525 |
| 599 | Ga0530510_0013210 | 3300061734 | Bacteria | 5807 |
| 600 | Ga0530510_0032831 | 3300061734 | Bacteria | 3736 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005535 | Ga0070684_100177751 | Ga0070684_1001777514 | 92 |
| 2 | 3300009553 | Ga0105249_10684267 | Ga0105249_106842672 | 93 |
| 3 | 3300009553 | Ga0105249_11284670 | Ga0105249_112846702 | 93 |
| 4 | 3300013306 | Ga0163162_10181675 | Ga0163162_101816752 | 93 |
| 5 | 3300014497 | Ga0182008_10141013 | Ga0182008_101410132 | 93 |
| 6 | 3300025933 | Ga0207706_10249807 | Ga0207706_102498073 | 93 |
| 7 | 3300025961 | Ga0207712_10280972 | Ga0207712_102809722 | 93 |
| 8 | 3300025972 | Ga0207668_10810798 | Ga0207668_108107982 | 93 |
| 9 | 3300026118 | Ga0207675_100081838 | Ga0207675_1000818382 | 93 |
| 10 | 3300047445 | Ga0495677_0271465 | Ga0495677_0271465_70_366 | 93 |
| 11 | 3300005356 | Ga0070674_101755205 | Ga0070674_1017552051 | 94 |
| 12 | 3300005437 | Ga0070710_10269354 | Ga0070710_102693542 | 94 |
| 13 | 3300005545 | Ga0070695_100302794 | Ga0070695_1003027942 | 94 |
| 14 | 3300005578 | Ga0068854_100757249 | Ga0068854_1007572492 | 94 |
| 15 | 3300005844 | Ga0068862_100538606 | Ga0068862_1005386062 | 94 |
| 16 | 3300005981 | Ga0081538_10004097 | Ga0081538_1000409710 | 94 |
| 17 | 3300009098 | Ga0105245_10569807 | Ga0105245_105698073 | 94 |
| 18 | 3300009148 | Ga0105243_10627595 | Ga0105243_106275952 | 94 |
| 19 | 3300009553 | Ga0105249_11087897 | Ga0105249_110878972 | 94 |
| 20 | 3300021384 | Ga0213876_10062878 | Ga0213876_100628782 | 94 |
| 21 | 3300021388 | Ga0213875_10586612 | Ga0213875_105866122 | 94 |
| 22 | 3300025898 | Ga0207692_10279352 | Ga0207692_102793522 | 94 |
| 23 | 3300025981 | Ga0207640_11552116 | Ga0207640_115521162 | 94 |
| 24 | 3300026118 | Ga0207675_100340418 | Ga0207675_1003404183 | 94 |
| 25 | 3300037853 | Ga0436364_0405852 | Ga0436364_0405852_1236_1529 | 94 |
| 26 | 3300039437 | Ga0436365_1391036 | Ga0436365_1391036_779_1072 | 94 |
| 27 | 3300039450 | Ga0436363_1509907 | Ga0436363_1509907_168_461 | 94 |
| 28 | 3300053077 | Ga0495601_0000577 | Ga0495601_0000577_11412_11696 | 94 |
| 29 | 3300053078 | Ga0495612_0000176 | Ga0495612_0000176_5883_6167 | 94 |
| 30 | 3300003203 | JGI25406J46586_10111344 | JGI25406J46586_101113442 | 95 |
| 31 | 3300003373 | JGI25407J50210_10050147 | JGI25407J50210_100501472 | 95 |
| 32 | 3300005327 | Ga0070658_10802408 | Ga0070658_108024082 | 95 |
| 33 | 3300005328 | Ga0070676_11264417 | Ga0070676_112644172 | 95 |
| 34 | 3300005329 | Ga0070683_101095262 | Ga0070683_1010952622 | 95 |
| 35 | 3300005329 | Ga0070683_101167952 | Ga0070683_1011679522 | 95 |
| 36 | 3300005329 | Ga0070683_101616849 | Ga0070683_1016168492 | 95 |
| 37 | 3300005330 | Ga0070690_100554811 | Ga0070690_1005548111 | 95 |
| 38 | 3300005331 | Ga0070670_100755037 | Ga0070670_1007550372 | 95 |
| 39 | 3300005334 | Ga0068869_101153551 | Ga0068869_1011535512 | 95 |
| 40 | 3300005334 | Ga0068869_101876011 | Ga0068869_1018760111 | 95 |
| 41 | 3300005335 | Ga0070666_10761269 | Ga0070666_107612692 | 95 |
| 42 | 3300005336 | Ga0070680_101068356 | Ga0070680_1010683562 | 95 |
| 43 | 3300005337 | Ga0070682_100072547 | Ga0070682_1000725473 | 95 |
| 44 | 3300005337 | Ga0070682_100102265 | Ga0070682_1001022653 | 95 |
| 45 | 3300005337 | Ga0070682_101841171 | Ga0070682_1018411711 | 95 |
| 46 | 3300005338 | Ga0068868_101157060 | Ga0068868_1011570601 | 95 |
| 47 | 3300005339 | Ga0070660_100300494 | Ga0070660_1003004942 | 95 |
| 48 | 3300005343 | Ga0070687_100199396 | Ga0070687_1001993962 | 95 |
| 49 | 3300005343 | Ga0070687_100431878 | Ga0070687_1004318782 | 95 |
| 50 | 3300005344 | Ga0070661_101130873 | Ga0070661_1011308732 | 95 |
| 51 | 3300005345 | Ga0070692_10256195 | Ga0070692_102561952 | 95 |
| 52 | 3300005345 | Ga0070692_10610381 | Ga0070692_106103812 | 95 |
| 53 | 3300005347 | Ga0070668_102197656 | Ga0070668_1021976561 | 95 |
| 54 | 3300005353 | Ga0070669_100061979 | Ga0070669_1000619792 | 95 |
| 55 | 3300005354 | Ga0070675_102114635 | Ga0070675_1021146352 | 95 |
| 56 | 3300005354 | Ga0070675_102243916 | Ga0070675_1022439162 | 95 |
| 57 | 3300005355 | Ga0070671_100442447 | Ga0070671_1004424472 | 95 |
| 58 | 3300005355 | Ga0070671_100480124 | Ga0070671_1004801242 | 95 |
| 59 | 3300005356 | Ga0070674_100160373 | Ga0070674_1001603732 | 95 |
| 60 | 3300005365 | Ga0070688_100202147 | Ga0070688_1002021472 | 95 |
| 61 | 3300005366 | Ga0070659_100022833 | Ga0070659_1000228335 | 95 |
| 62 | 3300005366 | Ga0070659_100389774 | Ga0070659_1003897742 | 95 |
| 63 | 3300005434 | Ga0070709_11000720 | Ga0070709_110007201 | 95 |
| 64 | 3300005437 | Ga0070710_10000009 | Ga0070710_1000000918 | 95 |
| 65 | 3300005437 | Ga0070710_10375979 | Ga0070710_103759792 | 95 |
| 66 | 3300005437 | Ga0070710_11459443 | Ga0070710_114594431 | 95 |
| 67 | 3300005438 | Ga0070701_10145785 | Ga0070701_101457852 | 95 |
| 68 | 3300005438 | Ga0070701_10854495 | Ga0070701_108544952 | 95 |
| 69 | 3300005440 | Ga0070705_100562809 | Ga0070705_1005628092 | 95 |
| 70 | 3300005440 | Ga0070705_101033548 | Ga0070705_1010335481 | 95 |
| 71 | 3300005440 | Ga0070705_101155218 | Ga0070705_1011552182 | 95 |
| 72 | 3300005441 | Ga0070700_100087779 | Ga0070700_1000877792 | 95 |
| 73 | 3300005441 | Ga0070700_101157888 | Ga0070700_1011578882 | 95 |
| 74 | 3300005444 | Ga0070694_100834518 | Ga0070694_1008345182 | 95 |
| 75 | 3300005455 | Ga0070663_100691820 | Ga0070663_1006918201 | 95 |
| 76 | 3300005455 | Ga0070663_101103237 | Ga0070663_1011032371 | 95 |
| 77 | 3300005456 | Ga0070678_100525449 | Ga0070678_1005254491 | 95 |
| 78 | 3300005456 | Ga0070678_100602752 | Ga0070678_1006027522 | 95 |
| 79 | 3300005456 | Ga0070678_101345307 | Ga0070678_1013453072 | 95 |
| 80 | 3300005457 | Ga0070662_100102570 | Ga0070662_1001025703 | 95 |
| 81 | 3300005457 | Ga0070662_100661238 | Ga0070662_1006612382 | 95 |
| 82 | 3300005458 | Ga0070681_10082889 | Ga0070681_100828892 | 95 |
| 83 | 3300005459 | Ga0068867_100988714 | Ga0068867_1009887142 | 95 |
| 84 | 3300005466 | Ga0070685_10027951 | Ga0070685_100279512 | 95 |
| 85 | 3300005535 | Ga0070684_100612553 | Ga0070684_1006125532 | 95 |
| 86 | 3300005535 | Ga0070684_101900413 | Ga0070684_1019004131 | 95 |
| 87 | 3300005535 | Ga0070684_101980042 | Ga0070684_1019800422 | 95 |
| 88 | 3300005539 | Ga0068853_100918547 | Ga0068853_1009185471 | 95 |
| 89 | 3300005543 | Ga0070672_100624557 | Ga0070672_1006245572 | 95 |
| 90 | 3300005544 | Ga0070686_100668084 | Ga0070686_1006680842 | 95 |
| 91 | 3300005546 | Ga0070696_100188729 | Ga0070696_1001887292 | 95 |
| 92 | 3300005546 | Ga0070696_100789869 | Ga0070696_1007898692 | 95 |
| 93 | 3300005547 | Ga0070693_100091270 | Ga0070693_1000912702 | 95 |
| 94 | 3300005547 | Ga0070693_100204033 | Ga0070693_1002040331 | 95 |
| 95 | 3300005547 | Ga0070693_100570387 | Ga0070693_1005703872 | 95 |
| 96 | 3300005548 | Ga0070665_100264584 | Ga0070665_1002645843 | 95 |
| 97 | 3300005549 | Ga0070704_101138698 | Ga0070704_1011386982 | 95 |
| 98 | 3300005564 | Ga0070664_100160511 | Ga0070664_1001605113 | 95 |
| 99 | 3300005564 | Ga0070664_100226335 | Ga0070664_1002263353 | 95 |
| 100 | 3300005564 | Ga0070664_100976124 | Ga0070664_1009761242 | 95 |
| 101 | 3300005578 | Ga0068854_100147251 | Ga0068854_1001472512 | 95 |
| 102 | 3300005578 | Ga0068854_100544913 | Ga0068854_1005449132 | 95 |
| 103 | 3300005578 | Ga0068854_101211604 | Ga0068854_1012116042 | 95 |
| 104 | 3300005614 | Ga0068856_100080235 | Ga0068856_1000802353 | 95 |
| 105 | 3300005614 | Ga0068856_100266443 | Ga0068856_1002664432 | 95 |
| 106 | 3300005614 | Ga0068856_100590481 | Ga0068856_1005904812 | 95 |
| 107 | 3300005614 | Ga0068856_102014348 | Ga0068856_1020143481 | 95 |
| 108 | 3300005614 | Ga0068856_102639344 | Ga0068856_1026393442 | 95 |
| 109 | 3300005615 | Ga0070702_100026757 | Ga0070702_1000267572 | 95 |
| 110 | 3300005615 | Ga0070702_100463710 | Ga0070702_1004637101 | 95 |
| 111 | 3300005616 | Ga0068852_101081979 | Ga0068852_1010819792 | 95 |
| 112 | 3300005616 | Ga0068852_101393418 | Ga0068852_1013934182 | 95 |
| 113 | 3300005616 | Ga0068852_101408805 | Ga0068852_1014088052 | 95 |
| 114 | 3300005618 | Ga0068864_101332765 | Ga0068864_1013327652 | 95 |
| 115 | 3300005618 | Ga0068864_102013358 | Ga0068864_1020133582 | 95 |
| 116 | 3300005718 | Ga0068866_10216179 | Ga0068866_102161792 | 95 |
| 117 | 3300005719 | Ga0068861_100075562 | Ga0068861_1000755622 | 95 |
| 118 | 3300005834 | Ga0068851_10248871 | Ga0068851_102488712 | 95 |
| 119 | 3300005834 | Ga0068851_10420819 | Ga0068851_104208192 | 95 |
| 120 | 3300005840 | Ga0068870_10057609 | Ga0068870_100576093 | 95 |
| 121 | 3300005843 | Ga0068860_101125424 | Ga0068860_1011254242 | 95 |
| 122 | 3300005843 | Ga0068860_101819812 | Ga0068860_1018198122 | 95 |
| 123 | 3300005844 | Ga0068862_100088556 | Ga0068862_1000885564 | 95 |
| 124 | 3300005844 | Ga0068862_100566227 | Ga0068862_1005662272 | 95 |
| 125 | 3300005981 | Ga0081538_10001913 | Ga0081538_1000191319 | 95 |
| 126 | 3300005981 | Ga0081538_10021300 | Ga0081538_100213002 | 95 |
| 127 | 3300005981 | Ga0081538_10037999 | Ga0081538_100379994 | 95 |
| 128 | 3300005981 | Ga0081538_10328093 | Ga0081538_103280931 | 95 |
| 129 | 3300005983 | Ga0081540_1001320 | Ga0081540_100132019 | 95 |
| 130 | 3300005983 | Ga0081540_1041565 | Ga0081540_10415652 | 95 |
| 131 | 3300005985 | Ga0081539_10002904 | Ga0081539_1000290419 | 95 |
| 132 | 3300005985 | Ga0081539_10003140 | Ga0081539_1000314021 | 95 |
| 133 | 3300005985 | Ga0081539_10003406 | Ga0081539_1000340613 | 95 |
| 134 | 3300005985 | Ga0081539_10053414 | Ga0081539_100534144 | 95 |
| 135 | 3300005985 | Ga0081539_10364834 | Ga0081539_103648342 | 95 |
| 136 | 3300006058 | Ga0075432_10251145 | Ga0075432_102511452 | 95 |
| 137 | 3300006058 | Ga0075432_10405955 | Ga0075432_104059552 | 95 |
| 138 | 3300006173 | Ga0070716_100984837 | Ga0070716_1009848371 | 95 |
| 139 | 3300006175 | Ga0070712_100000170 | Ga0070712_10000017021 | 95 |
| 140 | 3300006175 | Ga0070712_100540348 | Ga0070712_1005403482 | 95 |
| 141 | 3300006175 | Ga0070712_101025242 | Ga0070712_1010252422 | 95 |
| 142 | 3300006358 | Ga0068871_101017946 | Ga0068871_1010179462 | 95 |
| 143 | 3300006844 | Ga0075428_102209549 | Ga0075428_1022095491 | 95 |
| 144 | 3300006852 | Ga0075433_11142675 | Ga0075433_111426752 | 95 |
| 145 | 3300006871 | Ga0075434_100111977 | Ga0075434_1001119773 | 95 |
| 146 | 3300006871 | Ga0075434_100571442 | Ga0075434_1005714422 | 95 |
| 147 | 3300006880 | Ga0075429_100414562 | Ga0075429_1004145622 | 95 |
| 148 | 3300006881 | Ga0068865_101476731 | Ga0068865_1014767311 | 95 |
| 149 | 3300007076 | Ga0075435_100144981 | Ga0075435_1001449812 | 95 |
| 150 | 3300007076 | Ga0075435_100275518 | Ga0075435_1002755182 | 95 |
| 151 | 3300007076 | Ga0075435_100277192 | Ga0075435_1002771922 | 95 |
| 152 | 3300009036 | Ga0105244_10268898 | Ga0105244_102688982 | 95 |
| 153 | 3300009093 | Ga0105240_10617140 | Ga0105240_106171402 | 95 |
| 154 | 3300009094 | Ga0111539_10140971 | Ga0111539_101409712 | 95 |
| 155 | 3300009094 | Ga0111539_10491343 | Ga0111539_104913432 | 95 |
| 156 | 3300009094 | Ga0111539_10698662 | Ga0111539_106986622 | 95 |
| 157 | 3300009098 | Ga0105245_10148040 | Ga0105245_101480404 | 95 |
| 158 | 3300009098 | Ga0105245_10300953 | Ga0105245_103009532 | 95 |
| 159 | 3300009098 | Ga0105245_10848514 | Ga0105245_108485142 | 95 |
| 160 | 3300009098 | Ga0105245_10927043 | Ga0105245_109270432 | 95 |
| 161 | 3300009098 | Ga0105245_10984426 | Ga0105245_109844262 | 95 |
| 162 | 3300009098 | Ga0105245_12073789 | Ga0105245_120737892 | 95 |
| 163 | 3300009101 | Ga0105247_10351179 | Ga0105247_103511792 | 95 |
| 164 | 3300009147 | Ga0114129_12939875 | Ga0114129_129398751 | 95 |
| 165 | 3300009148 | Ga0105243_10378421 | Ga0105243_103784212 | 95 |
| 166 | 3300009148 | Ga0105243_10464816 | Ga0105243_104648163 | 95 |
| 167 | 3300009148 | Ga0105243_10627799 | Ga0105243_106277992 | 95 |
| 168 | 3300009148 | Ga0105243_10755345 | Ga0105243_107553452 | 95 |
| 169 | 3300009148 | Ga0105243_12467507 | Ga0105243_124675071 | 95 |
| 170 | 3300009148 | Ga0105243_12500158 | Ga0105243_125001582 | 95 |
| 171 | 3300009148 | Ga0105243_12830072 | Ga0105243_128300722 | 95 |
| 172 | 3300009174 | Ga0105241_10463801 | Ga0105241_104638012 | 95 |
| 173 | 3300009176 | Ga0105242_10048110 | Ga0105242_100481104 | 95 |
| 174 | 3300009176 | Ga0105242_10327070 | Ga0105242_103270702 | 95 |
| 175 | 3300009176 | Ga0105242_11721342 | Ga0105242_117213422 | 95 |
| 176 | 3300009177 | Ga0105248_11686584 | Ga0105248_116865842 | 95 |
| 177 | 3300009177 | Ga0105248_13290680 | Ga0105248_132906801 | 95 |
| 178 | 3300009551 | Ga0105238_10641953 | Ga0105238_106419532 | 95 |
| 179 | 3300009551 | Ga0105238_10798137 | Ga0105238_107981372 | 95 |
| 180 | 3300009551 | Ga0105238_10926481 | Ga0105238_109264812 | 95 |
| 181 | 3300009551 | Ga0105238_11211681 | Ga0105238_112116812 | 95 |
| 182 | 3300009553 | Ga0105249_10103726 | Ga0105249_101037262 | 95 |
| 183 | 3300009553 | Ga0105249_10895128 | Ga0105249_108951282 | 95 |
| 184 | 3300009553 | Ga0105249_13406021 | Ga0105249_134060211 | 95 |
| 185 | 3300010375 | Ga0105239_10171107 | Ga0105239_101711073 | 95 |
| 186 | 3300010375 | Ga0105239_10281454 | Ga0105239_102814542 | 95 |
| 187 | 3300010375 | Ga0105239_10529093 | Ga0105239_105290932 | 95 |
| 188 | 3300010375 | Ga0105239_10670010 | Ga0105239_106700102 | 95 |
| 189 | 3300010375 | Ga0105239_12796733 | Ga0105239_127967331 | 95 |
| 190 | 3300011119 | Ga0105246_10451643 | Ga0105246_104516431 | 95 |
| 191 | 3300012498 | Ga0157345_1044286 | Ga0157345_10442862 | 95 |
| 192 | 3300013102 | Ga0157371_10458842 | Ga0157371_104588422 | 95 |
| 193 | 3300013102 | Ga0157371_10545933 | Ga0157371_105459332 | 95 |
| 194 | 3300013102 | Ga0157371_10610582 | Ga0157371_106105821 | 95 |
| 195 | 3300013105 | Ga0157369_11787013 | Ga0157369_117870131 | 95 |
| 196 | 3300013105 | Ga0157369_12327379 | Ga0157369_123273792 | 95 |
| 197 | 3300013296 | Ga0157374_10364642 | Ga0157374_103646422 | 95 |
| 198 | 3300013296 | Ga0157374_12112936 | Ga0157374_121129362 | 95 |
| 199 | 3300013297 | Ga0157378_10251438 | Ga0157378_102514382 | 95 |
| 200 | 3300013297 | Ga0157378_10710324 | Ga0157378_107103243 | 95 |
| 201 | 3300013297 | Ga0157378_11204776 | Ga0157378_112047762 | 95 |
| 202 | 3300013297 | Ga0157378_12054479 | Ga0157378_120544792 | 95 |
| 203 | 3300013307 | Ga0157372_10220228 | Ga0157372_102202282 | 95 |
| 204 | 3300013307 | Ga0157372_10561991 | Ga0157372_105619912 | 95 |
| 205 | 3300013307 | Ga0157372_11023050 | Ga0157372_110230502 | 95 |
| 206 | 3300013307 | Ga0157372_11326084 | Ga0157372_113260841 | 95 |
| 207 | 3300013307 | Ga0157372_11434404 | Ga0157372_114344042 | 95 |
| 208 | 3300013308 | Ga0157375_10175788 | Ga0157375_101757882 | 95 |
| 209 | 3300013308 | Ga0157375_11428620 | Ga0157375_114286202 | 95 |
| 210 | 3300014325 | Ga0163163_10411871 | Ga0163163_104118712 | 95 |
| 211 | 3300014325 | Ga0163163_11123278 | Ga0163163_111232781 | 95 |
| 212 | 3300014326 | Ga0157380_11918985 | Ga0157380_119189852 | 95 |
| 213 | 3300014326 | Ga0157380_12653865 | Ga0157380_126538652 | 95 |
| 214 | 3300014326 | Ga0157380_12865060 | Ga0157380_128650602 | 95 |
| 215 | 3300014326 | Ga0157380_13525861 | Ga0157380_135258612 | 95 |
| 216 | 3300014497 | Ga0182008_10478473 | Ga0182008_104784732 | 95 |
| 217 | 3300014745 | Ga0157377_10293881 | Ga0157377_102938812 | 95 |
| 218 | 3300014745 | Ga0157377_10310054 | Ga0157377_103100542 | 95 |
| 219 | 3300014745 | Ga0157377_10418812 | Ga0157377_104188122 | 95 |
| 220 | 3300014745 | Ga0157377_11240354 | Ga0157377_112403541 | 95 |
| 221 | 3300014968 | Ga0157379_10001699 | Ga0157379_1000169921 | 95 |
| 222 | 3300014968 | Ga0157379_10001699 | Ga0157379_1000169922 | 95 |
| 223 | 3300014968 | Ga0157379_11051276 | Ga0157379_110512762 | 95 |
| 224 | 3300014968 | Ga0157379_11168493 | Ga0157379_111684932 | 95 |
| 225 | 3300014968 | Ga0157379_11276782 | Ga0157379_112767821 | 95 |
| 226 | 3300014969 | Ga0157376_10578196 | Ga0157376_105781962 | 95 |
| 227 | 3300014969 | Ga0157376_11100528 | Ga0157376_111005282 | 95 |
| 228 | 3300014969 | Ga0157376_13065640 | Ga0157376_130656402 | 95 |
| 229 | 3300017792 | Ga0163161_10621065 | Ga0163161_106210651 | 95 |
| 230 | 3300025321 | Ga0207656_10022875 | Ga0207656_100228753 | 95 |
| 231 | 3300025893 | Ga0207682_10452613 | Ga0207682_104526132 | 95 |
| 232 | 3300025898 | Ga0207692_10000005 | Ga0207692_10000005308 | 95 |
| 233 | 3300025898 | Ga0207692_10140913 | Ga0207692_101409132 | 95 |
| 234 | 3300025898 | Ga0207692_10945561 | Ga0207692_109455611 | 95 |
| 235 | 3300025899 | Ga0207642_10014980 | Ga0207642_100149802 | 95 |
| 236 | 3300025899 | Ga0207642_10511381 | Ga0207642_105113812 | 95 |
| 237 | 3300025901 | Ga0207688_10205635 | Ga0207688_102056352 | 95 |
| 238 | 3300025903 | Ga0207680_11227543 | Ga0207680_112275432 | 95 |
| 239 | 3300025904 | Ga0207647_10194648 | Ga0207647_101946482 | 95 |
| 240 | 3300025904 | Ga0207647_10220799 | Ga0207647_102207992 | 95 |
| 241 | 3300025907 | Ga0207645_10558386 | Ga0207645_105583862 | 95 |
| 242 | 3300025908 | Ga0207643_10228889 | Ga0207643_102288892 | 95 |
| 243 | 3300025911 | Ga0207654_10173914 | Ga0207654_101739141 | 95 |
| 244 | 3300025912 | Ga0207707_10279178 | Ga0207707_102791782 | 95 |
| 245 | 3300025914 | Ga0207671_10714686 | Ga0207671_107146862 | 95 |
| 246 | 3300025915 | Ga0207693_10000028 | Ga0207693_10000028108 | 95 |
| 247 | 3300025916 | Ga0207663_10951964 | Ga0207663_109519642 | 95 |
| 248 | 3300025916 | Ga0207663_11317178 | Ga0207663_113171781 | 95 |
| 249 | 3300025917 | Ga0207660_11261179 | Ga0207660_112611792 | 95 |
| 250 | 3300025918 | Ga0207662_11265254 | Ga0207662_112652542 | 95 |
| 251 | 3300025919 | Ga0207657_10369117 | Ga0207657_103691171 | 95 |
| 252 | 3300025920 | Ga0207649_10480287 | Ga0207649_104802872 | 95 |
| 253 | 3300025920 | Ga0207649_10724363 | Ga0207649_107243632 | 95 |
| 254 | 3300025921 | Ga0207652_10283361 | Ga0207652_102833612 | 95 |
| 255 | 3300025921 | Ga0207652_10418275 | Ga0207652_104182752 | 95 |
| 256 | 3300025923 | Ga0207681_10005963 | Ga0207681_100059632 | 95 |
| 257 | 3300025923 | Ga0207681_10813753 | Ga0207681_108137532 | 95 |
| 258 | 3300025924 | Ga0207694_11777865 | Ga0207694_117778652 | 95 |
| 259 | 3300025925 | Ga0207650_10585448 | Ga0207650_105854482 | 95 |
| 260 | 3300025926 | Ga0207659_11092051 | Ga0207659_110920512 | 95 |
| 261 | 3300025927 | Ga0207687_10050485 | Ga0207687_100504855 | 95 |
| 262 | 3300025927 | Ga0207687_10344562 | Ga0207687_103445622 | 95 |
| 263 | 3300025927 | Ga0207687_10533700 | Ga0207687_105337002 | 95 |
| 264 | 3300025927 | Ga0207687_11092149 | Ga0207687_110921491 | 95 |
| 265 | 3300025927 | Ga0207687_11531858 | Ga0207687_115318582 | 95 |
| 266 | 3300025931 | Ga0207644_10319088 | Ga0207644_103190882 | 95 |
| 267 | 3300025931 | Ga0207644_11528525 | Ga0207644_115285251 | 95 |
| 268 | 3300025932 | Ga0207690_10000460 | Ga0207690_1000046028 | 95 |
| 269 | 3300025932 | Ga0207690_10049503 | Ga0207690_100495033 | 95 |
| 270 | 3300025932 | Ga0207690_10124526 | Ga0207690_101245264 | 95 |
| 271 | 3300025932 | Ga0207690_10192094 | Ga0207690_101920942 | 95 |
| 272 | 3300025933 | Ga0207706_10041051 | Ga0207706_100410512 | 95 |
| 273 | 3300025933 | Ga0207706_10056983 | Ga0207706_100569832 | 95 |
| 274 | 3300025933 | Ga0207706_11275456 | Ga0207706_112754561 | 95 |
| 275 | 3300025934 | Ga0207686_10069550 | Ga0207686_100695502 | 95 |
| 276 | 3300025935 | Ga0207709_10016322 | Ga0207709_100163225 | 95 |
| 277 | 3300025935 | Ga0207709_10239128 | Ga0207709_102391282 | 95 |
| 278 | 3300025935 | Ga0207709_10518505 | Ga0207709_105185052 | 95 |
| 279 | 3300025936 | Ga0207670_10031320 | Ga0207670_100313202 | 95 |
| 280 | 3300025937 | Ga0207669_10055412 | Ga0207669_100554123 | 95 |
| 281 | 3300025937 | Ga0207669_10526560 | Ga0207669_105265602 | 95 |
| 282 | 3300025938 | Ga0207704_10089703 | Ga0207704_100897032 | 95 |
| 283 | 3300025939 | Ga0207665_10970544 | Ga0207665_109705442 | 95 |
| 284 | 3300025940 | Ga0207691_10077524 | Ga0207691_100775242 | 95 |
| 285 | 3300025940 | Ga0207691_10680762 | Ga0207691_106807622 | 95 |
| 286 | 3300025941 | Ga0207711_10653517 | Ga0207711_106535172 | 95 |
| 287 | 3300025942 | Ga0207689_10104293 | Ga0207689_101042932 | 95 |
| 288 | 3300025944 | Ga0207661_10588642 | Ga0207661_105886422 | 95 |
| 289 | 3300025945 | Ga0207679_10149136 | Ga0207679_101491362 | 95 |
| 290 | 3300025945 | Ga0207679_10529674 | Ga0207679_105296742 | 95 |
| 291 | 3300025945 | Ga0207679_10851511 | Ga0207679_108515111 | 95 |
| 292 | 3300025949 | Ga0207667_10661848 | Ga0207667_106618481 | 95 |
| 293 | 3300025960 | Ga0207651_10252805 | Ga0207651_102528053 | 95 |
| 294 | 3300025961 | Ga0207712_10212667 | Ga0207712_102126672 | 95 |
| 295 | 3300025972 | Ga0207668_10460075 | Ga0207668_104600752 | 95 |
| 296 | 3300025972 | Ga0207668_10638238 | Ga0207668_106382381 | 95 |
| 297 | 3300025981 | Ga0207640_10129996 | Ga0207640_101299962 | 95 |
| 298 | 3300025981 | Ga0207640_10204311 | Ga0207640_102043112 | 95 |
| 299 | 3300025981 | Ga0207640_10469956 | Ga0207640_104699562 | 95 |
| 300 | 3300025986 | Ga0207658_11859664 | Ga0207658_118596642 | 95 |
| 301 | 3300026023 | Ga0207677_10035971 | Ga0207677_100359712 | 95 |
| 302 | 3300026023 | Ga0207677_10233329 | Ga0207677_102333293 | 95 |
| 303 | 3300026035 | Ga0207703_10139036 | Ga0207703_101390363 | 95 |
| 304 | 3300026067 | Ga0207678_10172074 | Ga0207678_101720742 | 95 |
| 305 | 3300026075 | Ga0207708_10059564 | Ga0207708_100595642 | 95 |
| 306 | 3300026075 | Ga0207708_10164473 | Ga0207708_101644732 | 95 |
| 307 | 3300026075 | Ga0207708_10474780 | Ga0207708_104747802 | 95 |
| 308 | 3300026078 | Ga0207702_10236095 | Ga0207702_102360952 | 95 |
| 309 | 3300026078 | Ga0207702_10380522 | Ga0207702_103805223 | 95 |
| 310 | 3300026078 | Ga0207702_10990445 | Ga0207702_109904452 | 95 |
| 311 | 3300026088 | Ga0207641_10137733 | Ga0207641_101377332 | 95 |
| 312 | 3300026089 | Ga0207648_10185362 | Ga0207648_101853622 | 95 |
| 313 | 3300026089 | Ga0207648_10532352 | Ga0207648_105323522 | 95 |
| 314 | 3300026095 | Ga0207676_10406750 | Ga0207676_104067502 | 95 |
| 315 | 3300026095 | Ga0207676_12539376 | Ga0207676_125393761 | 95 |
| 316 | 3300026116 | Ga0207674_11054659 | Ga0207674_110546592 | 95 |
| 317 | 3300026116 | Ga0207674_11349453 | Ga0207674_113494532 | 95 |
| 318 | 3300026118 | Ga0207675_100063470 | Ga0207675_1000634702 | 95 |
| 319 | 3300026118 | Ga0207675_101653268 | Ga0207675_1016532682 | 95 |
| 320 | 3300026121 | Ga0207683_10047015 | Ga0207683_100470155 | 95 |
| 321 | 3300027907 | Ga0207428_10046930 | Ga0207428_100469303 | 95 |
| 322 | 3300027907 | Ga0207428_10217387 | Ga0207428_102173872 | 95 |
| 323 | 3300027907 | Ga0207428_10906467 | Ga0207428_109064672 | 95 |
| 324 | 3300028379 | Ga0268266_10178506 | Ga0268266_101785064 | 95 |
| 325 | 3300028380 | Ga0268265_10129980 | Ga0268265_101299802 | 95 |
| 326 | 3300028380 | Ga0268265_11307554 | Ga0268265_113075541 | 95 |
| 327 | 3300028381 | Ga0268264_10097986 | Ga0268264_100979863 | 95 |
| 328 | 3300028381 | Ga0268264_11259928 | Ga0268264_112599282 | 95 |
| 329 | 3300028381 | Ga0268264_11755163 | Ga0268264_117551632 | 95 |
| 330 | 3300028558 | Ga0265326_10000030 | Ga0265326_1000003050 | 95 |
| 331 | 3300028563 | Ga0265319_1000088 | Ga0265319_10000889 | 95 |
| 332 | 3300028563 | Ga0265319_1001802 | Ga0265319_10018025 | 95 |
| 333 | 3300028563 | Ga0265319_1092039 | Ga0265319_10920391 | 95 |
| 334 | 3300028573 | Ga0265334_10000156 | Ga0265334_100001567 | 95 |
| 335 | 3300028577 | Ga0265318_10003342 | Ga0265318_100033422 | 95 |
| 336 | 3300028653 | Ga0265323_10217661 | Ga0265323_102176612 | 95 |
| 337 | 3300028654 | Ga0265322_10014765 | Ga0265322_100147652 | 95 |
| 338 | 3300028666 | Ga0265336_10000515 | Ga0265336_1000051513 | 95 |
| 339 | 3300028800 | Ga0265338_10000536 | Ga0265338_1000053647 | 95 |
| 340 | 3300028800 | Ga0265338_10077006 | Ga0265338_100770063 | 95 |
| 341 | 3300028800 | Ga0265338_10330281 | Ga0265338_103302812 | 95 |
| 342 | 3300029957 | Ga0265324_10001136 | Ga0265324_100011364 | 95 |
| 343 | 3300031238 | Ga0265332_10475914 | Ga0265332_104759141 | 95 |
| 344 | 3300031240 | Ga0265320_10011700 | Ga0265320_100117006 | 95 |
| 345 | 3300031240 | Ga0265320_10023734 | Ga0265320_100237345 | 95 |
| 346 | 3300031240 | Ga0265320_10039189 | Ga0265320_100391894 | 95 |
| 347 | 3300031240 | Ga0265320_10061481 | Ga0265320_100614811 | 95 |
| 348 | 3300031251 | Ga0265327_10072636 | Ga0265327_100726362 | 95 |
| 349 | 3300031344 | Ga0265316_10072053 | Ga0265316_100720534 | 95 |
| 350 | 3300031595 | Ga0265313_10039991 | Ga0265313_100399912 | 95 |
| 351 | 3300031595 | Ga0265313_10165436 | Ga0265313_101654361 | 95 |
| 352 | 3300031711 | Ga0265314_10121748 | Ga0265314_101217483 | 95 |
| 353 | 3300031824 | Ga0307413_11026150 | Ga0307413_110261501 | 95 |
| 354 | 3300031824 | Ga0307413_11439547 | Ga0307413_114395471 | 95 |
| 355 | 3300031852 | Ga0307410_11738897 | Ga0307410_117388972 | 95 |
| 356 | 3300031889 | Ga0326468_10028146 | Ga0326468_100281462 | 95 |
| 357 | 3300031901 | Ga0307406_10137431 | Ga0307406_101374311 | 95 |
| 358 | 3300031901 | Ga0307406_11261258 | Ga0307406_112612582 | 95 |
| 359 | 3300031901 | Ga0307406_11384905 | Ga0307406_113849051 | 95 |
| 360 | 3300031903 | Ga0307407_11113576 | Ga0307407_111135762 | 95 |
| 361 | 3300031995 | Ga0307409_100634633 | Ga0307409_1006346332 | 95 |
| 362 | 3300032002 | Ga0307416_100528966 | Ga0307416_1005289661 | 95 |
| 363 | 3300032002 | Ga0307416_100578112 | Ga0307416_1005781122 | 95 |
| 364 | 3300032004 | Ga0307414_11928356 | Ga0307414_119283561 | 95 |
| 365 | 3300032005 | Ga0307411_10835188 | Ga0307411_108351881 | 95 |
| 366 | 3300032126 | Ga0307415_100863628 | Ga0307415_1008636282 | 95 |
| 367 | 3300032126 | Ga0307415_101132784 | Ga0307415_1011327842 | 95 |
| 368 | 3300032126 | Ga0307415_101526038 | Ga0307415_1015260382 | 95 |
| 369 | 3300035171 | Ga0373946_0080555 | Ga0373946_0080555_275_562 | 95 |
| 370 | 3300035241 | Ga0373961_0207481 | Ga0373961_0207481_118_405 | 95 |
| 371 | 3300035692 | Ga0373935_1151748 | Ga0373935_1151748_81_368 | 95 |
| 372 | 3300035725 | Ga0373947_0339982 | Ga0373947_0339982_188_475 | 95 |
| 373 | 3300037418 | Ga0395900_0294161 | Ga0395900_0294161_1265_1552 | 95 |
| 374 | 3300037418 | Ga0395900_1375960 | Ga0395900_1375960_205_492 | 95 |
| 375 | 3300037418 | Ga0395900_1664319 | Ga0395900_1664319_98_385 | 95 |
| 376 | 3300037466 | Ga0395898_1121559 | Ga0395898_1121559_175_462 | 95 |
| 377 | 3300037471 | Ga0395905_0902105 | Ga0395905_0902105_42_329 | 95 |
| 378 | 3300038443 | Ga0395901_0225079 | Ga0395901_0225079_223_510 | 95 |
| 379 | 3300038443 | Ga0395901_0239242 | Ga0395901_0239242_167_454 | 95 |
| 380 | 3300038443 | Ga0395901_0457015 | Ga0395901_0457015_763_1050 | 95 |
| 381 | 3300038443 | Ga0395901_0656918 | Ga0395901_0656918_375_662 | 95 |
| 382 | 3300038996 | Ga0242420_063477 | Ga0242420_063477_255_542 | 95 |
| 383 | 3300039450 | Ga0436363_1069811 | Ga0436363_1069811_446_733 | 95 |
| 384 | 3300039450 | Ga0436363_1618696 | Ga0436363_1618696_149_436 | 95 |
| 385 | 3300041456 | Ga0451795_1071654 | Ga0451795_1071654_281_568 | 95 |
| 386 | 3300041486 | Ga0451807_0359264 | Ga0451807_0359264_330_617 | 95 |
| 387 | 3300041491 | Ga0451833_0358762 | Ga0451833_0358762_208_495 | 95 |
| 388 | 3300041492 | Ga0451835_1000594 | Ga0451835_1000594_574_861 | 95 |
| 389 | 3300041496 | Ga0451839_0069234 | Ga0451839_0069234_521_811 | 95 |
| 390 | 3300041512 | Ga0451853_2463626 | Ga0451853_2463626_794_1081 | 95 |
| 391 | 3300042005 | Ga0439448_0073593 | Ga0439448_0073593_417_704 | 95 |
| 392 | 3300042137 | Ga0450902_097072 | Ga0450902_097072_21_308 | 95 |
| 393 | 3300042439 | Ga0439464_0212011 | Ga0439464_0212011_120_413 | 95 |
| 394 | 3300042993 | Ga0439440_0223008 | Ga0439440_0223008_94_381 | 95 |
| 395 | 3300044658 | Ga0466972_0222628 | Ga0466972_0222628_324_611 | 95 |
| 396 | 3300044658 | Ga0466972_0629803 | Ga0466972_0629803_118_405 | 95 |
| 397 | 3300044693 | Ga0466961_0796199 | Ga0466961_0796199_209_496 | 95 |
| 398 | 3300044694 | Ga0466963_0167303 | Ga0466963_0167303_144_431 | 95 |
| 399 | 3300044706 | Ga0466964_0058577 | Ga0466964_0058577_132_422 | 95 |
| 400 | 3300044765 | Ga0466970_0032472 | Ga0466970_0032472_222_509 | 95 |
| 401 | 3300044901 | Ga0466960_0005612 | Ga0466960_0005612_3884_4171 | 95 |
| 402 | 3300044901 | Ga0466960_0192905 | Ga0466960_0192905_342_629 | 95 |
| 403 | 3300044901 | Ga0466960_0229854 | Ga0466960_0229854_384_671 | 95 |
| 404 | 3300044901 | Ga0466960_0864203 | Ga0466960_0864203_46_336 | 95 |
| 405 | 3300044901 | Ga0466960_1011754 | Ga0466960_1011754_14_304 | 95 |
| 406 | 3300045049 | Ga0466959_0619025 | Ga0466959_0619025_229_519 | 95 |
| 407 | 3300045976 | Ga0466967_0016857 | Ga0466967_0016857_5402_5689 | 95 |
| 408 | 3300045976 | Ga0466967_0022542 | Ga0466967_0022542_1411_1701 | 95 |
| 409 | 3300045976 | Ga0466967_0084611 | Ga0466967_0084611_91_378 | 95 |
| 410 | 3300045976 | Ga0466967_0116344 | Ga0466967_0116344_2083_2370 | 95 |
| 411 | 3300045976 | Ga0466967_0237946 | Ga0466967_0237946_1235_1522 | 95 |
| 412 | 3300045976 | Ga0466967_0322474 | Ga0466967_0322474_222_509 | 95 |
| 413 | 3300045976 | Ga0466967_0906928 | Ga0466967_0906928_470_760 | 95 |
| 414 | 3300045976 | Ga0466967_1237782 | Ga0466967_1237782_146_433 | 95 |
| 415 | 3300045976 | Ga0466967_1459897 | Ga0466967_1459897_210_500 | 95 |
| 416 | 3300045976 | Ga0466967_2189466 | Ga0466967_2189466_237_524 | 95 |
| 417 | 3300046455 | Ga0495603_0087534 | Ga0495603_0087534_322_609 | 95 |
| 418 | 3300046457 | Ga0495590_0254730 | Ga0495590_0254730_249_536 | 95 |
| 419 | 3300046471 | Ga0495650_0000063 | Ga0495650_0000063_126865_127152 | 95 |
| 420 | 3300046472 | Ga0495580_0636541 | Ga0495580_0636541_211_498 | 95 |
| 421 | 3300046491 | Ga0495584_0687171 | Ga0495584_0687171_195_482 | 95 |
| 422 | 3300046492 | Ga0495585_0100003 | Ga0495585_0100003_89_376 | 95 |
| 423 | 3300046499 | Ga0495594_0146038 | Ga0495594_0146038_561_848 | 95 |
| 424 | 3300046517 | Ga0495630_1389017 | Ga0495630_1389017_216_506 | 95 |
| 425 | 3300046520 | Ga0495637_0138304 | Ga0495637_0138304_217_504 | 95 |
| 426 | 3300046520 | Ga0495637_0335947 | Ga0495637_0335947_42_329 | 95 |
| 427 | 3300046523 | Ga0495644_0043755 | Ga0495644_0043755_1168_1455 | 95 |
| 428 | 3300046529 | Ga0495652_0056967 | Ga0495652_0056967_1919_2206 | 95 |
| 429 | 3300046537 | Ga0495598_0331695 | Ga0495598_0331695_185_472 | 95 |
| 430 | 3300046538 | Ga0495609_0063723 | Ga0495609_0063723_209_496 | 95 |
| 431 | 3300046543 | Ga0495645_0000228 | Ga0495645_0000228_1150_1437 | 95 |
| 432 | 3300046615 | Ga0495656_0152203 | Ga0495656_0152203_720_1007 | 95 |
| 433 | 3300046648 | Ga0495611_0180078 | Ga0495611_0180078_318_605 | 95 |
| 434 | 3300046681 | Ga0495647_0572998 | Ga0495647_0572998_105_392 | 95 |
| 435 | 3300046683 | Ga0495658_0180595 | Ga0495658_0180595_175_462 | 95 |
| 436 | 3300046690 | Ga0495624_0586964 | Ga0495624_0586964_304_591 | 95 |
| 437 | 3300046794 | Ga0495589_0543547 | Ga0495589_0543547_184_471 | 95 |
| 438 | 3300046809 | Ga0495600_0040734 | Ga0495600_0040734_2234_2521 | 95 |
| 439 | 3300047315 | Ga0495581_0124794 | Ga0495581_0124794_1025_1312 | 95 |
| 440 | 3300047321 | Ga0495676_0828000 | Ga0495676_0828000_102_389 | 95 |
| 441 | 3300047446 | Ga0495679_135130 | Ga0495679_135130_278_565 | 95 |
| 442 | 3300047472 | Ga0495686_0415546 | Ga0495686_0415546_367_654 | 95 |
| 443 | 3300048903 | Ga0496100_0000118 | Ga0496100_0000118_38507_38794 | 95 |
| 444 | 3300048903 | Ga0496100_0034385 | Ga0496100_0034385_2680_2967 | 95 |
| 445 | 3300048903 | Ga0496100_0060369 | Ga0496100_0060369_2003_2290 | 95 |
| 446 | 3300048903 | Ga0496100_0103064 | Ga0496100_0103064_287_574 | 95 |
| 447 | 3300048904 | Ga0496101_0001916 | Ga0496101_0001916_3712_3999 | 95 |
| 448 | 3300048904 | Ga0496101_0020718 | Ga0496101_0020718_3254_3541 | 95 |
| 449 | 3300048904 | Ga0496101_0132735 | Ga0496101_0132735_1450_1737 | 95 |
| 450 | 3300048905 | Ga0496102_0000096 | Ga0496102_0000096_5906_6193 | 95 |
| 451 | 3300048905 | Ga0496102_0488809 | Ga0496102_0488809_203_490 | 95 |
| 452 | 3300048905 | Ga0496102_0580846 | Ga0496102_0580846_176_463 | 95 |
| 453 | 3300048905 | Ga0496102_0581406 | Ga0496102_0581406_596_883 | 95 |
| 454 | 3300048905 | Ga0496102_0889225 | Ga0496102_0889225_397_684 | 95 |
| 455 | 3300048905 | Ga0496102_0954199 | Ga0496102_0954199_424_711 | 95 |
| 456 | 3300048905 | Ga0496102_1393595 | Ga0496102_1393595_61_348 | 95 |
| 457 | 3300048906 | Ga0496103_0000035 | Ga0496103_0000035_5719_6006 | 95 |
| 458 | 3300048906 | Ga0496103_0230116 | Ga0496103_0230116_710_997 | 95 |
| 459 | 3300048906 | Ga0496103_0415074 | Ga0496103_0415074_537_824 | 95 |
| 460 | 3300048906 | Ga0496103_0865843 | Ga0496103_0865843_221_508 | 95 |
| 461 | 3300048907 | Ga0496104_0000028 | Ga0496104_0000028_66915_67202 | 95 |
| 462 | 3300048907 | Ga0496104_0647244 | Ga0496104_0647244_515_802 | 95 |
| 463 | 3300048907 | Ga0496104_1390854 | Ga0496104_1390854_95_382 | 95 |
| 464 | 3300048908 | Ga0496105_0055331 | Ga0496105_0055331_2632_2919 | 95 |
| 465 | 3300048908 | Ga0496105_0392581 | Ga0496105_0392581_415_702 | 95 |
| 466 | 3300048908 | Ga0496105_0589519 | Ga0496105_0589519_20_307 | 95 |
| 467 | 3300048909 | Ga0496106_0033377 | Ga0496106_0033377_3206_3493 | 95 |
| 468 | 3300048909 | Ga0496106_0070133 | Ga0496106_0070133_1451_1738 | 95 |
| 469 | 3300048909 | Ga0496106_0351609 | Ga0496106_0351609_566_853 | 95 |
| 470 | 3300048909 | Ga0496106_0385847 | Ga0496106_0385847_712_999 | 95 |
| 471 | 3300048909 | Ga0496106_0438732 | Ga0496106_0438732_508_795 | 95 |
| 472 | 3300048910 | Ga0496107_0062928 | Ga0496107_0062928_817_1104 | 95 |
| 473 | 3300048910 | Ga0496107_0164592 | Ga0496107_0164592_1237_1524 | 95 |
| 474 | 3300048911 | Ga0496108_0025154 | Ga0496108_0025154_3197_3484 | 95 |
| 475 | 3300048911 | Ga0496108_0035761 | Ga0496108_0035761_3478_3765 | 95 |
| 476 | 3300048911 | Ga0496108_0051472 | Ga0496108_0051472_2300_2587 | 95 |
| 477 | 3300048912 | Ga0496109_0024720 | Ga0496109_0024720_370_657 | 95 |
| 478 | 3300048912 | Ga0496109_0031619 | Ga0496109_0031619_1360_1647 | 95 |
| 479 | 3300048912 | Ga0496109_0166556 | Ga0496109_0166556_1751_2038 | 95 |
| 480 | 3300048912 | Ga0496109_0190042 | Ga0496109_0190042_155_442 | 95 |
| 481 | 3300048912 | Ga0496109_0583072 | Ga0496109_0583072_141_440 | 95 |
| 482 | 3300048913 | Ga0496110_0000666 | Ga0496110_0000666_16676_16963 | 95 |
| 483 | 3300048913 | Ga0496110_0002467 | Ga0496110_0002467_6161_6448 | 95 |
| 484 | 3300048913 | Ga0496110_0038554 | Ga0496110_0038554_2285_2572 | 95 |
| 485 | 3300048913 | Ga0496110_1025414 | Ga0496110_1025414_96_383 | 95 |
| 486 | 3300048913 | Ga0496110_1075948 | Ga0496110_1075948_212_499 | 95 |
| 487 | 3300048913 | Ga0496110_1362120 | Ga0496110_1362120_57_344 | 95 |
| 488 | 3300048914 | Ga0496111_0000229 | Ga0496111_0000229_19864_20151 | 95 |
| 489 | 3300048914 | Ga0496111_0009578 | Ga0496111_0009578_4930_5217 | 95 |
| 490 | 3300048914 | Ga0496111_0070554 | Ga0496111_0070554_1270_1557 | 95 |
| 491 | 3300048914 | Ga0496111_0094422 | Ga0496111_0094422_283_570 | 95 |
| 492 | 3300048914 | Ga0496111_0159737 | Ga0496111_0159737_1344_1631 | 95 |
| 493 | 3300048914 | Ga0496111_0815151 | Ga0496111_0815151_367_654 | 95 |
| 494 | 3300048914 | Ga0496111_1279686 | Ga0496111_1279686_74_361 | 95 |
| 495 | 3300048914 | Ga0496111_1332845 | Ga0496111_1332845_116_403 | 95 |
| 496 | 3300048915 | Ga0496112_0000418 | Ga0496112_0000418_23179_23466 | 95 |
| 497 | 3300048915 | Ga0496112_0008662 | Ga0496112_0008662_2560_2847 | 95 |
| 498 | 3300048915 | Ga0496112_0194143 | Ga0496112_0194143_549_836 | 95 |
| 499 | 3300048915 | Ga0496112_0330288 | Ga0496112_0330288_371_658 | 95 |
| 500 | 3300048916 | Ga0496113_0007595 | Ga0496113_0007595_3913_4200 | 95 |
| 501 | 3300048916 | Ga0496113_0083405 | Ga0496113_0083405_289_576 | 95 |
| 502 | 3300048916 | Ga0496113_0178810 | Ga0496113_0178810_1303_1590 | 95 |
| 503 | 3300048916 | Ga0496113_0920044 | Ga0496113_0920044_216_503 | 95 |
| 504 | 3300048917 | Ga0496114_0110111 | Ga0496114_0110111_520_807 | 95 |
| 505 | 3300048917 | Ga0496114_0255675 | Ga0496114_0255675_554_841 | 95 |
| 506 | 3300048917 | Ga0496114_0791113 | Ga0496114_0791113_268_555 | 95 |
| 507 | 3300048917 | Ga0496114_1005583 | Ga0496114_1005583_346_633 | 95 |
| 508 | 3300048918 | Ga0496115_0000350 | Ga0496115_0000350_6687_7010 | 95 |
| 509 | 3300048918 | Ga0496115_0022745 | Ga0496115_0022745_3249_3536 | 95 |
| 510 | 3300048918 | Ga0496115_0315187 | Ga0496115_0315187_729_1016 | 95 |
| 511 | 3300048918 | Ga0496115_0797346 | Ga0496115_0797346_391_678 | 95 |
| 512 | 3300048924 | Ga0496121_0024042 | Ga0496121_0024042_1382_1669 | 95 |
| 513 | 3300048924 | Ga0496121_0058090 | Ga0496121_0058090_2093_2380 | 95 |
| 514 | 3300048927 | Ga0496124_0364444 | Ga0496124_0364444_469_756 | 95 |
| 515 | 3300049568 | Ga0501031_0046243 | Ga0501031_0046243_1385_1672 | 95 |
| 516 | 3300049568 | Ga0501031_0178515 | Ga0501031_0178515_990_1277 | 95 |
| 517 | 3300049568 | Ga0501031_0263232 | Ga0501031_0263232_428_715 | 95 |
| 518 | 3300049568 | Ga0501031_0388887 | Ga0501031_0388887_354_641 | 95 |
| 519 | 3300049571 | Ga0501034_0021900 | Ga0501034_0021900_2128_2415 | 95 |
| 520 | 3300049572 | Ga0501036_0047983 | Ga0501036_0047983_1360_1647 | 95 |
| 521 | 3300049572 | Ga0501036_0221600 | Ga0501036_0221600_1137_1424 | 95 |
| 522 | 3300049573 | Ga0501037_0203658 | Ga0501037_0203658_583_870 | 95 |
| 523 | 3300049574 | Ga0501038_0289437 | Ga0501038_0289437_858_1145 | 95 |
| 524 | 3300049574 | Ga0501038_0615036 | Ga0501038_0615036_310_597 | 95 |
| 525 | 3300049575 | Ga0501039_0014617 | Ga0501039_0014617_3656_3943 | 95 |
| 526 | 3300049575 | Ga0501039_0292558 | Ga0501039_0292558_823_1110 | 95 |
| 527 | 3300049576 | Ga0501040_0045310 | Ga0501040_0045310_2108_2395 | 95 |
| 528 | 3300049576 | Ga0501040_0061416 | Ga0501040_0061416_1227_1514 | 95 |
| 529 | 3300049576 | Ga0501040_0719846 | Ga0501040_0719846_112_399 | 95 |
| 530 | 3300049577 | Ga0501041_0048537 | Ga0501041_0048537_1341_1628 | 95 |
| 531 | 3300049577 | Ga0501041_0053572 | Ga0501041_0053572_1848_2135 | 95 |
| 532 | 3300049578 | Ga0501042_0014356 | Ga0501042_0014356_4310_4597 | 95 |
| 533 | 3300049578 | Ga0501042_0019959 | Ga0501042_0019959_2253_2540 | 95 |
| 534 | 3300049578 | Ga0501042_0148998 | Ga0501042_0148998_1210_1497 | 95 |
| 535 | 3300049578 | Ga0501042_0535081 | Ga0501042_0535081_482_769 | 95 |
| 536 | 3300049579 | Ga0501043_0497543 | Ga0501043_0497543_440_727 | 95 |
| 537 | 3300049580 | Ga0501046_0049634 | Ga0501046_0049634_1076_1363 | 95 |
| 538 | 3300049580 | Ga0501046_0289936 | Ga0501046_0289936_358_645 | 95 |
| 539 | 3300049582 | Ga0501048_0149280 | Ga0501048_0149280_1101_1388 | 95 |
| 540 | 3300049582 | Ga0501048_1131475 | Ga0501048_1131475_266_553 | 95 |
| 541 | 3300049583 | Ga0501067_0341433 | Ga0501067_0341433_529_816 | 95 |
| 542 | 3300049583 | Ga0501067_0634285 | Ga0501067_0634285_40_327 | 95 |
| 543 | 3300049585 | Ga0501069_0562494 | Ga0501069_0562494_374_661 | 95 |
| 544 | 3300049586 | Ga0501070_0656567 | Ga0501070_0656567_459_746 | 95 |
| 545 | 3300049586 | Ga0501070_1027339 | Ga0501070_1027339_70_357 | 95 |
| 546 | 3300049587 | Ga0501071_0030118 | Ga0501071_0030118_3300_3587 | 95 |
| 547 | 3300049587 | Ga0501071_0031317 | Ga0501071_0031317_3422_3709 | 95 |
| 548 | 3300049587 | Ga0501071_0766459 | Ga0501071_0766459_36_323 | 95 |
| 549 | 3300049588 | Ga0501072_0014032 | Ga0501072_0014032_3563_3850 | 95 |
| 550 | 3300049588 | Ga0501072_0138152 | Ga0501072_0138152_649_936 | 95 |
| 551 | 3300049588 | Ga0501072_0247583 | Ga0501072_0247583_732_1019 | 95 |
| 552 | 3300049588 | Ga0501072_0510585 | Ga0501072_0510585_501_788 | 95 |
| 553 | 3300049589 | Ga0501073_0127537 | Ga0501073_0127537_481_768 | 95 |
| 554 | 3300049590 | Ga0501074_0209437 | Ga0501074_0209437_340_627 | 95 |
| 555 | 3300049590 | Ga0501074_0466369 | Ga0501074_0466369_136_423 | 95 |
| 556 | 3300049590 | Ga0501074_0798641 | Ga0501074_0798641_129_416 | 95 |
| 557 | 3300049591 | Ga0501075_0134829 | Ga0501075_0134829_918_1205 | 95 |
| 558 | 3300049591 | Ga0501075_0411957 | Ga0501075_0411957_272_559 | 95 |
| 559 | 3300049591 | Ga0501075_0557687 | Ga0501075_0557687_431_718 | 95 |
| 560 | 3300049592 | Ga0501076_0186900 | Ga0501076_0186900_1041_1328 | 95 |
| 561 | 3300049592 | Ga0501076_0326530 | Ga0501076_0326530_272_559 | 95 |
| 562 | 3300049592 | Ga0501076_0422768 | Ga0501076_0422768_776_1063 | 95 |
| 563 | 3300049592 | Ga0501076_0495827 | Ga0501076_0495827_556_843 | 95 |
| 564 | 3300049593 | Ga0501077_0480221 | Ga0501077_0480221_431_718 | 95 |
| 565 | 3300049741 | Ga0501079_0125805 | Ga0501079_0125805_1456_1743 | 95 |
| 566 | 3300049741 | Ga0501079_0170709 | Ga0501079_0170709_1163_1450 | 95 |
| 567 | 3300049741 | Ga0501079_0387193 | Ga0501079_0387193_549_836 | 95 |
| 568 | 3300049742 | Ga0501080_0174862 | Ga0501080_0174862_92_379 | 95 |
| 569 | 3300049742 | Ga0501080_0554841 | Ga0501080_0554841_460_747 | 95 |
| 570 | 3300049743 | Ga0501081_0057198 | Ga0501081_0057198_2051_2338 | 95 |
| 571 | 3300049743 | Ga0501081_0114490 | Ga0501081_0114490_778_1065 | 95 |
| 572 | 3300049743 | Ga0501081_0855663 | Ga0501081_0855663_93_380 | 95 |
| 573 | 3300049744 | Ga0501083_0117203 | Ga0501083_0117203_46_333 | 95 |
| 574 | 3300049744 | Ga0501083_0381953 | Ga0501083_0381953_79_366 | 95 |
| 575 | 3300049822 | Ga0501035_0428582 | Ga0501035_0428582_447_734 | 95 |
| 576 | 3300049824 | Ga0501045_0054352 | Ga0501045_0054352_359_646 | 95 |
| 577 | 3300049824 | Ga0501045_0186115 | Ga0501045_0186115_521_808 | 95 |
| 578 | 3300049824 | Ga0501045_0808607 | Ga0501045_0808607_17_304 | 95 |
| 579 | 3300049824 | Ga0501045_0820991 | Ga0501045_0820991_374_661 | 95 |
| 580 | 3300050508 | nmdc:mga09592_196946_c1 | nmdc:mga09592_196946_c1_1148_1435 | 95 |
| 581 | 3300050510 | nmdc:mga06r32_1885615_c1 | nmdc:mga06r32_1885615_c1_43_330 | 95 |
| 582 | 3300050511 | nmdc:mga08y16_311413_c1 | nmdc:mga08y16_311413_c1_558_845 | 95 |
| 583 | 3300050511 | nmdc:mga08y16_47162_c1 | nmdc:mga08y16_47162_c1_1809_2096 | 95 |
| 584 | 3300050511 | nmdc:mga08y16_475046_c1 | nmdc:mga08y16_475046_c1_607_894 | 95 |
| 585 | 3300050512 | nmdc:mga0n895_1441545_c1 | nmdc:mga0n895_1441545_c1_148_435 | 95 |
| 586 | 3300050512 | nmdc:mga0n895_223369_c1 | nmdc:mga0n895_223369_c1_1415_1702 | 95 |
| 587 | 3300050512 | nmdc:mga0n895_596557_c1 | nmdc:mga0n895_596557_c1_641_940 | 95 |
| 588 | 3300050513 | nmdc:mga0rr50_140212_c1 | nmdc:mga0rr50_140212_c1_881_1168 | 95 |
| 589 | 3300050515 | nmdc:mga0a205_822468_c1 | nmdc:mga0a205_822468_c1_191_478 | 95 |
| 590 | 3300053077 | Ga0495601_0118739 | Ga0495601_0118739_275_562 | 95 |
| 591 | 3300053153 | Ga0500616_0005144 | Ga0500616_0005144_1041_1328 | 95 |
| 592 | 3300054114 | Ga0501084_0067962 | Ga0501084_0067962_1743_2030 | 95 |
| 593 | 3300054114 | Ga0501084_0734270 | Ga0501084_0734270_415_702 | 95 |
| 594 | 3300054114 | Ga0501084_0924440 | Ga0501084_0924440_243_530 | 95 |
| 595 | 3300059631 | Ga0587130_047276 | Ga0587130_047276_94_381 | 95 |
| 596 | 3300059644 | Ga0587075_113150 | Ga0587075_113150_116_403 | 95 |
| 597 | 3300060353 | Ga0501082_0105558 | Ga0501082_0105558_1665_1952 | 95 |
| 598 | 3300060353 | Ga0501082_0181989 | Ga0501082_0181989_1386_1673 | 95 |
| 599 | 3300061719 | Ga0466962_0685134 | Ga0466962_0685134_211_498 | 95 |
| 600 | 3300061734 | Ga0530510_0013210 | Ga0530510_0013210_1908_2195 | 95 |
| 601 | 3300061734 | Ga0530510_0032831 | Ga0530510_0032831_2804_3091 | 95 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d34-assembly1.cif.gz_B | atclps1-peptide complex | 0.9332 | 17 | 93 |
| 4o2x-assembly2.cif.gz_B | structure of a malarial protein | 0.9171 | 20 | 93 |
| 4o2x-assembly1.cif.gz_A | structure of a malarial protein | 0.9122 | 20 | 95 |
| 3dnj-assembly2.cif.gz_A | the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide | 0.8893 | 21 | 95 |
| 7d34-assembly1.cif.gz_B | atclps1-peptide complex | 0.8887 | 17 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0IJ84_76_154_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9522 | 21 | 93 | 3.30.1390.10 |
| af_Q8IEB2_84_184_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9428 | 18 | 94 | 3.30.1390.10 |
| 3o1fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8673 | 19 | 95 | 3.30.1390.10 |
| af_A0A0R0IJ84_76_154_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8606 | 21 | 93 | 3.30.1390.10 |
| af_Q9VX91_228_322_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8516 | 14 | 82 | 3.30.1390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4VXJ9-F1-model_v4 | Clp protease ClpS | 0.9698 | 23 | 95 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-U6MKK3-F1-model_v4 | ATP-dependent Clp protease adaptor domain-containing protein, putative | 0.9622 | 21 | 94 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A7S1BRN6-F1-model_v4 | Adaptor protein ClpS core domain-containing protein | 0.9574 | 21 | 94 |
GO:0006508
GO:0030163 |
| AF-A0A538CPT5-F1-model_v4 | Clp protease ClpS | 0.955 | 23 | 95 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A4V2PXQ9-F1-model_v4 | ATP-dependent Clp protease adaptor protein ClpS | 0.9542 | 20 | 93 |
GO:0006508
GO:0008233 GO:0030163 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar