F468043

General Info

Members Datasets Scaffolds Average Seq Length
601 301 600 95

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100177751|Ga0070684_1001777514
Length 114
Sequence MVRAVSQTIELPRTGGPGTGLGGSWRVIVRNDDHNTFDHVAHTLAGTIPGVSVDAGYRFADRIHNTGMAIVWSGHLEAAEHYWEQLVEAGLTMAPGTGLGPDRRAGGDTRAQCH

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
161 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
165 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
201 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 11.81
Rhizosphere 85.69
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10111344 3300003203 Bacteria 810
2 JGI25407J50210_10050147 3300003373 Bacteria 1059
3 Ga0070658_10802408 3300005327 Bacteria 818
4 Ga0070676_11264417 3300005328 Bacteria 563
5 Ga0070683_101095262 3300005329 Bacteria 765
6 Ga0070683_101167952 3300005329 Bacteria 740
7 Ga0070683_101616849 3300005329 Bacteria 623
8 Ga0070690_100554811 3300005330 Bacteria 867
9 Ga0070670_100755037 3300005331 Bacteria 877
10 Ga0068869_101153551 3300005334 Bacteria 679
11 Ga0068869_101876011 3300005334 Bacteria 537
12 Ga0070666_10761269 3300005335 Bacteria 712
13 Ga0070680_101068356 3300005336 Bacteria 697
14 Ga0070682_100072547 3300005337 Bacteria 2206
15 Ga0070682_100102265 3300005337 Bacteria 1894
16 Ga0070682_101841171 3300005337 Bacteria 529
17 Ga0068868_101157060 3300005338 Bacteria 714
18 Ga0070660_100300494 3300005339 Bacteria 1316
19 Ga0070687_100199396 3300005343 Bacteria 1211
20 Ga0070687_100431878 3300005343 Bacteria 871
21 Ga0070661_101130873 3300005344 Unclassified 653
22 Ga0070692_10256195 3300005345 Bacteria 1050
23 Ga0070692_10610381 3300005345 Bacteria 723
24 Ga0070668_102197656 3300005347 Bacteria 510
25 Ga0070669_100061979 3300005353 Bacteria 2749
26 Ga0070675_102114635 3300005354 Bacteria 519
27 Ga0070675_102243916 3300005354 Bacteria 503
28 Ga0070671_100442447 3300005355 Bacteria 1115
29 Ga0070671_100480124 3300005355 Bacteria 1068
30 Ga0070674_100160373 3300005356 Bacteria 1706
31 Ga0070674_101755205 3300005356 Unclassified 562
32 Ga0070688_100202147 3300005365 Bacteria 1391
33 Ga0070659_100022833 3300005366 Bacteria 4779
34 Ga0070659_100389774 3300005366 Bacteria 1175
35 Ga0070709_11000720 3300005434 Bacteria 665
36 Ga0070710_10000009 3300005437 Bacteria 165863
37 Ga0070710_10269354 3300005437 Bacteria 1101
38 Ga0070710_10375979 3300005437 Bacteria 946
39 Ga0070710_11459443 3300005437 Bacteria 513
40 Ga0070701_10145785 3300005438 Bacteria 1359
41 Ga0070701_10854495 3300005438 Bacteria 625
42 Ga0070705_100562809 3300005440 Bacteria 876
43 Ga0070705_101033548 3300005440 Bacteria 669
44 Ga0070705_101155218 3300005440 Bacteria 636
45 Ga0070700_100087779 3300005441 Bacteria 2022
46 Ga0070700_101157888 3300005441 Bacteria 644
47 Ga0070694_100834518 3300005444 Bacteria 757
48 Ga0070663_100691820 3300005455 Bacteria 866
49 Ga0070663_101103237 3300005455 Bacteria 694
50 Ga0070678_100525449 3300005456 Bacteria 1048
51 Ga0070678_100602752 3300005456 Bacteria 981
52 Ga0070678_101345307 3300005456 Bacteria 665
53 Ga0070662_100102570 3300005457 Bacteria 2168
54 Ga0070662_100661238 3300005457 Bacteria 882
55 Ga0070681_10082889 3300005458 Bacteria 3161
56 Ga0068867_100988714 3300005459 Unclassified 762
57 Ga0070685_10027951 3300005466 Bacteria 3122
58 Ga0070684_100177751 3300005535 Bacteria 1935
59 Ga0070684_100612553 3300005535 Bacteria 1013
60 Ga0070684_101900413 3300005535 Bacteria 562
61 Ga0070684_101980042 3300005535 Bacteria 550
62 Ga0068853_100918547 3300005539 Bacteria 841
63 Ga0070672_100624557 3300005543 Bacteria 940
64 Ga0070686_100668084 3300005544 Bacteria 825
65 Ga0070695_100302794 3300005545 Bacteria 1182
66 Ga0070696_100188729 3300005546 Bacteria 1533
67 Ga0070696_100789869 3300005546 Bacteria 781
68 Ga0070693_100091270 3300005547 Bacteria 1837
69 Ga0070693_100204033 3300005547 Bacteria 1286
70 Ga0070693_100570387 3300005547 Bacteria 813
71 Ga0070665_100264584 3300005548 Bacteria 1721
72 Ga0070704_101138698 3300005549 Bacteria 710
73 Ga0070664_100160511 3300005564 Bacteria 1989
74 Ga0070664_100226335 3300005564 Bacteria 1675
75 Ga0070664_100976124 3300005564 Bacteria 796
76 Ga0068854_100147251 3300005578 Bacteria 1813
77 Ga0068854_100544913 3300005578 Bacteria 983
78 Ga0068854_100757249 3300005578 Unclassified 843
79 Ga0068854_101211604 3300005578 Bacteria 677
80 Ga0068856_100080235 3300005614 Bacteria 3236
81 Ga0068856_100266443 3300005614 Bacteria 1729
82 Ga0068856_100590481 3300005614 Bacteria 1132
83 Ga0068856_102014348 3300005614 Bacteria 588
84 Ga0068856_102639344 3300005614 Unclassified 508
85 Ga0070702_100026757 3300005615 Bacteria 3103
86 Ga0070702_100463710 3300005615 Bacteria 922
87 Ga0068852_101081979 3300005616 Bacteria 822
88 Ga0068852_101393418 3300005616 Bacteria 723
89 Ga0068852_101408805 3300005616 Bacteria 719
90 Ga0068864_101332765 3300005618 Bacteria 718
91 Ga0068864_102013358 3300005618 Bacteria 584
92 Ga0068866_10216179 3300005718 Bacteria 1154
93 Ga0068861_100075562 3300005719 Bacteria 2623
94 Ga0068851_10248871 3300005834 Bacteria 1007
95 Ga0068851_10420819 3300005834 Bacteria 789
96 Ga0068870_10057609 3300005840 Bacteria 2078
97 Ga0068860_101125424 3300005843 Bacteria 805
98 Ga0068860_101819812 3300005843 Bacteria 631
99 Ga0068862_100088556 3300005844 Bacteria 2693
100 Ga0068862_100538606 3300005844 Bacteria 1113
101 Ga0068862_100566227 3300005844 Bacteria 1087
102 Ga0081538_10001913 3300005981 Bacteria 20841
103 Ga0081538_10004097 3300005981 Bacteria 13549
104 Ga0081538_10021300 3300005981 Bacteria 4737
105 Ga0081538_10037999 3300005981 Bacteria 3113
106 Ga0081538_10328093 3300005981 Bacteria 557
107 Ga0081540_1001320 3300005983 Bacteria 21640
108 Ga0081540_1041565 3300005983 Bacteria 2382
109 Ga0081539_10002904 3300005985 Bacteria 22668
110 Ga0081539_10003140 3300005985 Bacteria 21027
111 Ga0081539_10003406 3300005985 Bacteria 19616
112 Ga0081539_10053414 3300005985 Bacteria 2262
113 Ga0081539_10364834 3300005985 Unclassified 605
114 Ga0075432_10251145 3300006058 Bacteria 718
115 Ga0075432_10405955 3300006058 Bacteria 589
116 Ga0070716_100984837 3300006173 Bacteria 666
117 Ga0070712_100000170 3300006175 Bacteria 35641
118 Ga0070712_100540348 3300006175 Bacteria 981
119 Ga0070712_101025242 3300006175 Bacteria 715
120 Ga0068871_101017946 3300006358 Bacteria 772
121 Ga0075428_102209549 3300006844 Bacteria 567
122 Ga0075433_11142675 3300006852 Bacteria 677
123 Ga0075434_100111977 3300006871 Bacteria 2740
124 Ga0075434_100571442 3300006871 Bacteria 1150
125 Ga0075429_100414562 3300006880 Unclassified 1179
126 Ga0068865_101476731 3300006881 Bacteria 608
127 Ga0075435_100144981 3300007076 Bacteria 1994
128 Ga0075435_100275518 3300007076 Bacteria 1436
129 Ga0075435_100277192 3300007076 Bacteria 1431
130 Ga0105244_10268898 3300009036 Bacteria 792
131 Ga0105240_10617140 3300009093 Bacteria 1192
132 Ga0111539_10140971 3300009094 Bacteria 2822
133 Ga0111539_10491343 3300009094 Bacteria 1429
134 Ga0111539_10698662 3300009094 Bacteria 1181
135 Ga0105245_10148040 3300009098 Bacteria 2217
136 Ga0105245_10300953 3300009098 Bacteria 1574
137 Ga0105245_10569807 3300009098 Bacteria 1156
138 Ga0105245_10848514 3300009098 Bacteria 953
139 Ga0105245_10927043 3300009098 Bacteria 913
140 Ga0105245_10984426 3300009098 Bacteria 887
141 Ga0105245_12073789 3300009098 Bacteria 622
142 Ga0105247_10351179 3300009101 Bacteria 1037
143 Ga0114129_12939875 3300009147 Bacteria 562
144 Ga0105243_10378421 3300009148 Bacteria 1309
145 Ga0105243_10464816 3300009148 Bacteria 1190
146 Ga0105243_10627595 3300009148 Bacteria 1038
147 Ga0105243_10627799 3300009148 Bacteria 1038
148 Ga0105243_10755345 3300009148 Bacteria 954
149 Ga0105243_12467507 3300009148 Unclassified 559
150 Ga0105243_12500158 3300009148 Bacteria 555
151 Ga0105243_12830072 3300009148 Bacteria 526
152 Ga0105241_10463801 3300009174 Bacteria 1123
153 Ga0105242_10048110 3300009176 Bacteria 3465
154 Ga0105242_10327070 3300009176 Bacteria 1408
155 Ga0105242_11721342 3300009176 Unclassified 664
156 Ga0105248_11686584 3300009177 Bacteria 718
157 Ga0105248_13290680 3300009177 Bacteria 514
158 Ga0105238_10641953 3300009551 Bacteria 1071
159 Ga0105238_10798137 3300009551 Bacteria 959
160 Ga0105238_10926481 3300009551 Bacteria 890
161 Ga0105238_11211681 3300009551 Bacteria 779
162 Ga0105249_10103726 3300009553 Bacteria 2679
163 Ga0105249_10684267 3300009553 Bacteria 1085
164 Ga0105249_10895128 3300009553 Bacteria 954
165 Ga0105249_11087897 3300009553 Bacteria 869
166 Ga0105249_11284670 3300009553 Bacteria 803
167 Ga0105249_13406021 3300009553 Bacteria 512
168 Ga0105239_10171107 3300010375 Bacteria 2429
169 Ga0105239_10281454 3300010375 Bacteria 1872
170 Ga0105239_10529093 3300010375 Bacteria 1342
171 Ga0105239_10670010 3300010375 Bacteria 1185
172 Ga0105239_12796733 3300010375 Bacteria 569
173 Ga0105246_10451643 3300011119 Bacteria 1080
174 Ga0157345_1044286 3300012498 Bacteria 546
175 Ga0157371_10458842 3300013102 Bacteria 937
176 Ga0157371_10545933 3300013102 Bacteria 859
177 Ga0157371_10610582 3300013102 Bacteria 812
178 Ga0157369_11787013 3300013105 Bacteria 624
179 Ga0157369_12327379 3300013105 Bacteria 543
180 Ga0157374_10364642 3300013296 Bacteria 1437
181 Ga0157374_12112936 3300013296 Bacteria 590
182 Ga0157378_10251438 3300013297 Bacteria 1692
183 Ga0157378_10710324 3300013297 Bacteria 1025
184 Ga0157378_11204776 3300013297 Bacteria 797
185 Ga0157378_12054479 3300013297 Bacteria 622
186 Ga0163162_10181675 3300013306 Bacteria 2230
187 Ga0157372_10220228 3300013307 Bacteria 2200
188 Ga0157372_10561991 3300013307 Bacteria 1330
189 Ga0157372_11023050 3300013307 Bacteria 957
190 Ga0157372_11326084 3300013307 Bacteria 830
191 Ga0157372_11434404 3300013307 Bacteria 796
192 Ga0157375_10175788 3300013308 Bacteria 2290
193 Ga0157375_11428620 3300013308 Bacteria 815
194 Ga0163163_10411871 3300014325 Bacteria 1410
195 Ga0163163_11123278 3300014325 Bacteria 849
196 Ga0157380_11918985 3300014326 Bacteria 653
197 Ga0157380_12653865 3300014326 Bacteria 567
198 Ga0157380_12865060 3300014326 Bacteria 549
199 Ga0157380_13525861 3300014326 Unclassified 501
200 Ga0182008_10141013 3300014497 Bacteria 1205
201 Ga0182008_10478473 3300014497 Bacteria 681
202 Ga0157377_10293881 3300014745 Bacteria 1070
203 Ga0157377_10310054 3300014745 Bacteria 1045
204 Ga0157377_10418812 3300014745 Bacteria 917
205 Ga0157377_11240354 3300014745 Bacteria 579
206 Ga0157379_10001699 3300014968 Bacteria 18215
207 Ga0157379_11051276 3300014968 Bacteria 778
208 Ga0157379_11168493 3300014968 Bacteria 739
209 Ga0157379_11276782 3300014968 Bacteria 708
210 Ga0157376_10578196 3300014969 Bacteria 1115
211 Ga0157376_11100528 3300014969 Bacteria 820
212 Ga0157376_13065640 3300014969 Unclassified 506
213 Ga0163161_10621065 3300017792 Bacteria 893
214 Ga0213876_10062878 3300021384 Bacteria 1960
215 Ga0213875_10586612 3300021388 Bacteria 538
216 Ga0207656_10022875 3300025321 Bacteria 2511
217 Ga0207682_10452613 3300025893 Bacteria 608
218 Ga0207692_10000005 3300025898 Bacteria 370169
219 Ga0207692_10140913 3300025898 Bacteria 1371
220 Ga0207692_10279352 3300025898 Bacteria 1010
221 Ga0207692_10945561 3300025898 Bacteria 568
222 Ga0207642_10014980 3300025899 Bacteria 2877
223 Ga0207642_10511381 3300025899 Bacteria 737
224 Ga0207688_10205635 3300025901 Bacteria 1182
225 Ga0207680_11227543 3300025903 Bacteria 534
226 Ga0207647_10194648 3300025904 Bacteria 1174
227 Ga0207647_10220799 3300025904 Bacteria 1092
228 Ga0207645_10558386 3300025907 Bacteria 777
229 Ga0207643_10228889 3300025908 Bacteria 1140
230 Ga0207654_10173914 3300025911 Bacteria 1400
231 Ga0207707_10279178 3300025912 Bacteria 1447
232 Ga0207671_10714686 3300025914 Bacteria 796
233 Ga0207693_10000028 3300025915 Bacteria 120041
234 Ga0207663_10951964 3300025916 Bacteria 688
235 Ga0207663_11317178 3300025916 Bacteria 582
236 Ga0207660_11261179 3300025917 Bacteria 601
237 Ga0207662_11265254 3300025918 Bacteria 524
238 Ga0207657_10369117 3300025919 Bacteria 1131
239 Ga0207649_10480287 3300025920 Bacteria 942
240 Ga0207649_10724363 3300025920 Bacteria 773
241 Ga0207652_10283361 3300025921 Bacteria 1495
242 Ga0207652_10418275 3300025921 Bacteria 1209
243 Ga0207681_10005963 3300025923 Bacteria 7475
244 Ga0207681_10813753 3300025923 Bacteria 781
245 Ga0207694_11777865 3300025924 Bacteria 518
246 Ga0207650_10585448 3300025925 Bacteria 937
247 Ga0207659_11092051 3300025926 Bacteria 686
248 Ga0207687_10050485 3300025927 Bacteria 2895
249 Ga0207687_10344562 3300025927 Bacteria 1212
250 Ga0207687_10533700 3300025927 Bacteria 983
251 Ga0207687_11092149 3300025927 Bacteria 685
252 Ga0207687_11531858 3300025927 Bacteria 573
253 Ga0207644_10319088 3300025931 Bacteria 1256
254 Ga0207644_11528525 3300025931 Bacteria 560
255 Ga0207690_10000460 3300025932 Bacteria 26175
256 Ga0207690_10049503 3300025932 Bacteria 2802
257 Ga0207690_10124526 3300025932 Bacteria 1877
258 Ga0207690_10192094 3300025932 Bacteria 1545
259 Ga0207706_10041051 3300025933 Bacteria 4102
260 Ga0207706_10056983 3300025933 Bacteria 3443
261 Ga0207706_10249807 3300025933 Bacteria 1550
262 Ga0207706_11275456 3300025933 Unclassified 608
263 Ga0207686_10069550 3300025934 Bacteria 2259
264 Ga0207709_10016322 3300025935 Bacteria 4127
265 Ga0207709_10239128 3300025935 Bacteria 1320
266 Ga0207709_10518505 3300025935 Bacteria 933
267 Ga0207670_10031320 3300025936 Bacteria 3407
268 Ga0207669_10055412 3300025937 Bacteria 2401
269 Ga0207669_10526560 3300025937 Bacteria 950
270 Ga0207704_10089703 3300025938 Bacteria 2015
271 Ga0207665_10970544 3300025939 Bacteria 675
272 Ga0207691_10077524 3300025940 Bacteria 2994
273 Ga0207691_10680762 3300025940 Bacteria 868
274 Ga0207711_10653517 3300025941 Bacteria 981
275 Ga0207689_10104293 3300025942 Bacteria 2330
276 Ga0207661_10588642 3300025944 Bacteria 1021
277 Ga0207679_10149136 3300025945 Bacteria 1901
278 Ga0207679_10529674 3300025945 Bacteria 1055
279 Ga0207679_10851511 3300025945 Bacteria 833
280 Ga0207667_10661848 3300025949 Bacteria 1049
281 Ga0207651_10252805 3300025960 Bacteria 1443
282 Ga0207712_10212667 3300025961 Bacteria 1541
283 Ga0207712_10280972 3300025961 Bacteria 1359
284 Ga0207668_10460075 3300025972 Bacteria 1088
285 Ga0207668_10638238 3300025972 Bacteria 931
286 Ga0207668_10810798 3300025972 Bacteria 829
287 Ga0207640_10129996 3300025981 Bacteria 1819
288 Ga0207640_10204311 3300025981 Bacteria 1500
289 Ga0207640_10469956 3300025981 Bacteria 1041
290 Ga0207640_11552116 3300025981 Bacteria 596
291 Ga0207658_11859664 3300025986 Bacteria 549
292 Ga0207677_10035971 3300026023 Bacteria 3222
293 Ga0207677_10233329 3300026023 Bacteria 1484
294 Ga0207703_10139036 3300026035 Bacteria 2106
295 Ga0207678_10172074 3300026067 Bacteria 1849
296 Ga0207708_10059564 3300026075 Bacteria 2915
297 Ga0207708_10164473 3300026075 Unclassified 1754
298 Ga0207708_10474780 3300026075 Bacteria 1045
299 Ga0207702_10236095 3300026078 Bacteria 1711
300 Ga0207702_10380522 3300026078 Bacteria 1357
301 Ga0207702_10990445 3300026078 Bacteria 834
302 Ga0207641_10137733 3300026088 Bacteria 2199
303 Ga0207648_10185362 3300026089 Bacteria 1843
304 Ga0207648_10532352 3300026089 Bacteria 1077
305 Ga0207676_10406750 3300026095 Bacteria 1273
306 Ga0207676_12539376 3300026095 Bacteria 509
307 Ga0207674_11054659 3300026116 Bacteria 782
308 Ga0207674_11349453 3300026116 Bacteria 682
309 Ga0207675_100063470 3300026118 Bacteria 3451
310 Ga0207675_100081838 3300026118 Bacteria 3028
311 Ga0207675_100340418 3300026118 Bacteria 1468
312 Ga0207675_101653268 3300026118 Bacteria 660
313 Ga0207683_10047015 3300026121 Bacteria 3779
314 Ga0207428_10046930 3300027907 Bacteria 3471
315 Ga0207428_10217387 3300027907 Bacteria 1434
316 Ga0207428_10906467 3300027907 Bacteria 623
317 Ga0268266_10178506 3300028379 Bacteria 1932
318 Ga0268265_10129980 3300028380 Bacteria 2091
319 Ga0268265_11307554 3300028380 Bacteria 725
320 Ga0268264_10097986 3300028381 Bacteria 2542
321 Ga0268264_11259928 3300028381 Bacteria 749
322 Ga0268264_11755163 3300028381 Bacteria 631
323 Ga0265326_10000030 3300028558 Bacteria 96518
324 Ga0265319_1000088 3300028563 Bacteria 71590
325 Ga0265319_1001802 3300028563 Bacteria 12252
326 Ga0265319_1092039 3300028563 Bacteria 956
327 Ga0265334_10000156 3300028573 Bacteria 42408
328 Ga0265318_10003342 3300028577 Bacteria 8115
329 Ga0265323_10217661 3300028653 Unclassified 599
330 Ga0265322_10014765 3300028654 Bacteria 2258
331 Ga0265336_10000515 3300028666 Bacteria 22427
332 Ga0265338_10000536 3300028800 Bacteria 66434
333 Ga0265338_10077006 3300028800 Bacteria 2821
334 Ga0265338_10330281 3300028800 Bacteria 1101
335 Ga0265324_10001136 3300029957 Bacteria 15983
336 Ga0265332_10475914 3300031238 Bacteria 517
337 Ga0265320_10011700 3300031240 Bacteria 5150
338 Ga0265320_10023734 3300031240 Bacteria 3258
339 Ga0265320_10039189 3300031240 Bacteria 2371
340 Ga0265320_10061481 3300031240 Bacteria 1790
341 Ga0265327_10072636 3300031251 Bacteria 1718
342 Ga0265316_10072053 3300031344 Bacteria 2662
343 Ga0265313_10039991 3300031595 Bacteria 2322
344 Ga0265313_10165436 3300031595 Bacteria 937
345 Ga0265314_10121748 3300031711 Bacteria 1641
346 Ga0307413_11026150 3300031824 Bacteria 708
347 Ga0307413_11439547 3300031824 Bacteria 607
348 Ga0307410_11738897 3300031852 Bacteria 553
349 Ga0326468_10028146 3300031889 Bacteria 725
350 Ga0307406_10137431 3300031901 Bacteria 1725
351 Ga0307406_11261258 3300031901 Bacteria 644
352 Ga0307406_11384905 3300031901 Bacteria 616
353 Ga0307407_11113576 3300031903 Bacteria 614
354 Ga0307409_100634633 3300031995 Bacteria 1060
355 Ga0307416_100528966 3300032002 Bacteria 1249
356 Ga0307416_100578112 3300032002 Bacteria 1200
357 Ga0307414_11928356 3300032004 Bacteria 551
358 Ga0307411_10835188 3300032005 Bacteria 814
359 Ga0307415_100863628 3300032126 Bacteria 831
360 Ga0307415_101132784 3300032126 Bacteria 734
361 Ga0307415_101526038 3300032126 Bacteria 640
362 Ga0373946_0080555 3300035171 Bacteria 1425
363 Ga0373961_0207481 3300035241 Bacteria 694
364 Ga0373935_1151748 3300035692 Bacteria 578
365 Ga0373947_0339982 3300035725 Bacteria 1006
366 Ga0395900_0294161 3300037418 Bacteria 1612
367 Ga0395900_1375960 3300037418 Bacteria 619
368 Ga0395900_1664319 3300037418 Bacteria 549
369 Ga0395898_1121559 3300037466 Bacteria 719
370 Ga0395905_0902105 3300037471 Bacteria 787
371 Ga0436364_0405852 3300037853 Bacteria 1778
372 Ga0395901_0225079 3300038443 Bacteria 1960
373 Ga0395901_0239242 3300038443 Bacteria 1894
374 Ga0395901_0457015 3300038443 Bacteria 1305
375 Ga0395901_0656918 3300038443 Bacteria 1051
376 Ga0242420_063477 3300038996 Bacteria 741
377 Ga0436365_1391036 3300039437 Bacteria 2045
378 Ga0436363_1069811 3300039450 Bacteria 959
379 Ga0436363_1509907 3300039450 Bacteria 1115
380 Ga0436363_1618696 3300039450 Bacteria 508
381 Ga0451795_1071654 3300041456 Bacteria 595
382 Ga0451807_0359264 3300041486 Bacteria 742
383 Ga0451833_0358762 3300041491 Bacteria 788
384 Ga0451835_1000594 3300041492 Bacteria 921
385 Ga0451839_0069234 3300041496 Bacteria 1195
386 Ga0451853_2463626 3300041512 Bacteria 1792
387 Ga0439448_0073593 3300042005 Bacteria 1140
388 Ga0450902_097072 3300042137 Bacteria 523
389 Ga0439464_0212011 3300042439 Bacteria 620
390 Ga0439440_0223008 3300042993 Bacteria 566
391 Ga0466972_0222628 3300044658 Bacteria 883
392 Ga0466972_0629803 3300044658 Bacteria 508
393 Ga0466961_0796199 3300044693 Bacteria 564
394 Ga0466963_0167303 3300044694 Bacteria 1532
395 Ga0466964_0058577 3300044706 Bacteria 1597
396 Ga0466970_0032472 3300044765 Bacteria 2758
397 Ga0466960_0005612 3300044901 Bacteria 4978
398 Ga0466960_0192905 3300044901 Bacteria 1109
399 Ga0466960_0229854 3300044901 Bacteria 1024
400 Ga0466960_0864203 3300044901 Bacteria 550
401 Ga0466960_1011754 3300044901 Bacteria 511
402 Ga0466959_0619025 3300045049 Bacteria 728
403 Ga0466967_0016857 3300045976 Bacteria 5777
404 Ga0466967_0022542 3300045976 Bacteria 5141
405 Ga0466967_0084611 3300045976 Bacteria 2870
406 Ga0466967_0116344 3300045976 Bacteria 2463
407 Ga0466967_0237946 3300045976 Bacteria 1736
408 Ga0466967_0322474 3300045976 Bacteria 1490
409 Ga0466967_0906928 3300045976 Bacteria 876
410 Ga0466967_1237782 3300045976 Bacteria 743
411 Ga0466967_1459897 3300045976 Bacteria 681
412 Ga0466967_2189466 3300045976 Bacteria 549
413 Ga0495603_0087534 3300046455 Bacteria 1823
414 Ga0495590_0254730 3300046457 Bacteria 654
415 Ga0495650_0000063 3300046471 Bacteria 277841
416 Ga0495580_0636541 3300046472 Bacteria 702
417 Ga0495584_0687171 3300046491 Bacteria 522
418 Ga0495585_0100003 3300046492 Bacteria 1552
419 Ga0495594_0146038 3300046499 Bacteria 1342
420 Ga0495630_1389017 3300046517 Bacteria 528
421 Ga0495637_0138304 3300046520 Bacteria 926
422 Ga0495637_0335947 3300046520 Bacteria 532
423 Ga0495644_0043755 3300046523 Bacteria 1685
424 Ga0495652_0056967 3300046529 Bacteria 3317
425 Ga0495598_0331695 3300046537 Bacteria 582
426 Ga0495609_0063723 3300046538 Bacteria 1627
427 Ga0495645_0000228 3300046543 Bacteria 40598
428 Ga0495656_0152203 3300046615 Bacteria 1118
429 Ga0495611_0180078 3300046648 Bacteria 988
430 Ga0495647_0572998 3300046681 Bacteria 529
431 Ga0495658_0180595 3300046683 Bacteria 1309
432 Ga0495624_0586964 3300046690 Bacteria 664
433 Ga0495589_0543547 3300046794 Bacteria 530
434 Ga0495600_0040734 3300046809 Bacteria 3026
435 Ga0495581_0124794 3300047315 Bacteria 1499
436 Ga0495676_0828000 3300047321 Bacteria 595
437 Ga0495677_0271465 3300047445 Bacteria 665
438 Ga0495679_135130 3300047446 Bacteria 668
439 Ga0495686_0415546 3300047472 Bacteria 720
440 Ga0496100_0000118 3300048903 Bacteria 45414
441 Ga0496100_0034385 3300048903 Bacteria 3180
442 Ga0496100_0060369 3300048903 Bacteria 2495
443 Ga0496100_0103064 3300048903 Bacteria 1970
444 Ga0496101_0001916 3300048904 Bacteria 12577
445 Ga0496101_0020718 3300048904 Bacteria 4509
446 Ga0496101_0132735 3300048904 Bacteria 1892
447 Ga0496102_0000096 3300048905 Bacteria 124941
448 Ga0496102_0488809 3300048905 Bacteria 1152
449 Ga0496102_0580846 3300048905 Bacteria 1043
450 Ga0496102_0581406 3300048905 Bacteria 1043
451 Ga0496102_0889225 3300048905 Bacteria 812
452 Ga0496102_0954199 3300048905 Bacteria 779
453 Ga0496102_1393595 3300048905 Bacteria 620
454 Ga0496103_0000035 3300048906 Bacteria 182242
455 Ga0496103_0230116 3300048906 Bacteria 1192
456 Ga0496103_0415074 3300048906 Bacteria 864
457 Ga0496103_0865843 3300048906 Bacteria 568
458 Ga0496104_0000028 3300048907 Bacteria 203377
459 Ga0496104_0647244 3300048907 Bacteria 966
460 Ga0496104_1390854 3300048907 Bacteria 605
461 Ga0496105_0055331 3300048908 Bacteria 3276
462 Ga0496105_0392581 3300048908 Bacteria 1103
463 Ga0496105_0589519 3300048908 Bacteria 864
464 Ga0496106_0033377 3300048909 Bacteria 3840
465 Ga0496106_0070133 3300048909 Bacteria 2676
466 Ga0496106_0351609 3300048909 Bacteria 1184
467 Ga0496106_0385847 3300048909 Bacteria 1126
468 Ga0496106_0438732 3300048909 Bacteria 1049
469 Ga0496107_0062928 3300048910 Bacteria 2688
470 Ga0496107_0164592 3300048910 Bacteria 1644
471 Ga0496108_0025154 3300048911 Bacteria 4904
472 Ga0496108_0035761 3300048911 Bacteria 4130
473 Ga0496108_0051472 3300048911 Bacteria 3450
474 Ga0496109_0024720 3300048912 Bacteria 5343
475 Ga0496109_0031619 3300048912 Bacteria 4752
476 Ga0496109_0166556 3300048912 Bacteria 2066
477 Ga0496109_0190042 3300048912 Bacteria 1930
478 Ga0496109_0583072 3300048912 Bacteria 1054
479 Ga0496110_0000666 3300048913 Bacteria 23528
480 Ga0496110_0002467 3300048913 Bacteria 13861
481 Ga0496110_0038554 3300048913 Bacteria 4158
482 Ga0496110_1025414 3300048913 Bacteria 733
483 Ga0496110_1075948 3300048913 Bacteria 712
484 Ga0496110_1362120 3300048913 Bacteria 619
485 Ga0496111_0000229 3300048914 Bacteria 26736
486 Ga0496111_0009578 3300048914 Bacteria 6471
487 Ga0496111_0070554 3300048914 Bacteria 2541
488 Ga0496111_0094422 3300048914 Bacteria 2193
489 Ga0496111_0159737 3300048914 Bacteria 1673
490 Ga0496111_0815151 3300048914 Bacteria 675
491 Ga0496111_1279686 3300048914 Bacteria 517
492 Ga0496111_1332845 3300048914 Bacteria 505
493 Ga0496112_0000418 3300048915 Bacteria 28077
494 Ga0496112_0008662 3300048915 Bacteria 9121
495 Ga0496112_0194143 3300048915 Bacteria 1991
496 Ga0496112_0330288 3300048915 Bacteria 1469
497 Ga0496113_0007595 3300048916 Bacteria 6995
498 Ga0496113_0083405 3300048916 Bacteria 2452
499 Ga0496113_0178810 3300048916 Bacteria 1681
500 Ga0496113_0920044 3300048916 Bacteria 691
501 Ga0496114_0110111 3300048917 Bacteria 2359
502 Ga0496114_0255675 3300048917 Bacteria 1542
503 Ga0496114_0791113 3300048917 Bacteria 827
504 Ga0496114_1005583 3300048917 Bacteria 717
505 Ga0496115_0000350 3300048918 Bacteria 39036
506 Ga0496115_0022745 3300048918 Bacteria 4860
507 Ga0496115_0315187 3300048918 Bacteria 1280
508 Ga0496115_0797346 3300048918 Bacteria 735
509 Ga0496121_0024042 3300048924 Bacteria 5840
510 Ga0496121_0058090 3300048924 Bacteria 3201
511 Ga0496124_0364444 3300048927 Bacteria 1017
512 Ga0501031_0046243 3300049568 Bacteria 2838
513 Ga0501031_0178515 3300049568 Bacteria 1387
514 Ga0501031_0263232 3300049568 Bacteria 1120
515 Ga0501031_0388887 3300049568 Bacteria 902
516 Ga0501034_0021900 3300049571 Bacteria 6512
517 Ga0501036_0047983 3300049572 Bacteria 3616
518 Ga0501036_0221600 3300049572 Bacteria 1588
519 Ga0501037_0203658 3300049573 Bacteria 1398
520 Ga0501038_0289437 3300049574 Bacteria 1288
521 Ga0501038_0615036 3300049574 Bacteria 821
522 Ga0501039_0014617 3300049575 Bacteria 6009
523 Ga0501039_0292558 3300049575 Bacteria 1280
524 Ga0501040_0045310 3300049576 Bacteria 2999
525 Ga0501040_0061416 3300049576 Bacteria 2585
526 Ga0501040_0719846 3300049576 Bacteria 722
527 Ga0501041_0048537 3300049577 Bacteria 2586
528 Ga0501041_0053572 3300049577 Bacteria 2461
529 Ga0501042_0014356 3300049578 Bacteria 5406
530 Ga0501042_0019959 3300049578 Bacteria 4661
531 Ga0501042_0148998 3300049578 Bacteria 1687
532 Ga0501042_0535081 3300049578 Bacteria 851
533 Ga0501043_0497543 3300049579 Bacteria 911
534 Ga0501046_0049634 3300049580 Bacteria 3319
535 Ga0501046_0289936 3300049580 Bacteria 1197
536 Ga0501048_0149280 3300049582 Bacteria 1653
537 Ga0501048_1131475 3300049582 Bacteria 563
538 Ga0501067_0341433 3300049583 Bacteria 834
539 Ga0501067_0634285 3300049583 Unclassified 600
540 Ga0501069_0562494 3300049585 Bacteria 683
541 Ga0501070_0656567 3300049586 Bacteria 832
542 Ga0501070_1027339 3300049586 Unclassified 638
543 Ga0501071_0030118 3300049587 Bacteria 3837
544 Ga0501071_0031317 3300049587 Bacteria 3769
545 Ga0501071_0766459 3300049587 Bacteria 743
546 Ga0501072_0014032 3300049588 Bacteria 6140
547 Ga0501072_0138152 3300049588 Bacteria 1943
548 Ga0501072_0247583 3300049588 Bacteria 1419
549 Ga0501072_0510585 3300049588 Bacteria 950
550 Ga0501073_0127537 3300049589 Bacteria 1764
551 Ga0501074_0209437 3300049590 Bacteria 1389
552 Ga0501074_0466369 3300049590 Bacteria 895
553 Ga0501074_0798641 3300049590 Bacteria 665
554 Ga0501075_0134829 3300049591 Bacteria 1881
555 Ga0501075_0411957 3300049591 Bacteria 1030
556 Ga0501075_0557687 3300049591 Bacteria 874
557 Ga0501076_0186900 3300049592 Bacteria 1690
558 Ga0501076_0326530 3300049592 Bacteria 1259
559 Ga0501076_0422768 3300049592 Bacteria 1096
560 Ga0501076_0495827 3300049592 Bacteria 1007
561 Ga0501077_0480221 3300049593 Bacteria 796
562 Ga0501079_0125805 3300049741 Bacteria 1994
563 Ga0501079_0170709 3300049741 Bacteria 1696
564 Ga0501079_0387193 3300049741 Bacteria 1096
565 Ga0501080_0174862 3300049742 Bacteria 1979
566 Ga0501080_0554841 3300049742 Bacteria 1023
567 Ga0501081_0057198 3300049743 Bacteria 2696
568 Ga0501081_0114490 3300049743 Bacteria 1916
569 Ga0501081_0855663 3300049743 Bacteria 685
570 Ga0501083_0117203 3300049744 Bacteria 1748
571 Ga0501083_0381953 3300049744 Bacteria 916
572 Ga0501035_0428582 3300049822 Bacteria 1097
573 Ga0501045_0054352 3300049824 Bacteria 2927
574 Ga0501045_0186115 3300049824 Bacteria 1547
575 Ga0501045_0808607 3300049824 Bacteria 690
576 Ga0501045_0820991 3300049824 Bacteria 684
577 nmdc:mga09592_196946_c1 3300050508 Bacteria 1744
578 nmdc:mga06r32_1885615_c1 3300050510 Unclassified 532
579 nmdc:mga08y16_311413_c1 3300050511 Bacteria 1621
580 nmdc:mga08y16_47162_c1 3300050511 Bacteria 4510
581 nmdc:mga08y16_475046_c1 3300050511 Bacteria 1273
582 nmdc:mga0n895_1441545_c1 3300050512 Bacteria 656
583 nmdc:mga0n895_223369_c1 3300050512 Bacteria 1912
584 nmdc:mga0n895_596557_c1 3300050512 Bacteria 1107
585 nmdc:mga0rr50_140212_c1 3300050513 Bacteria 1944
586 nmdc:mga0a205_822468_c1 3300050515 Bacteria 776
587 Ga0495601_0000577 3300053077 Bacteria 19478
588 Ga0495601_0118739 3300053077 Bacteria 1716
589 Ga0495612_0000176 3300053078 Bacteria 26921
590 Ga0500616_0005144 3300053153 Bacteria 8990
591 Ga0501084_0067962 3300054114 Bacteria 2983
592 Ga0501084_0734270 3300054114 Bacteria 832
593 Ga0501084_0924440 3300054114 Bacteria 733
594 Ga0587130_047276 3300059631 Bacteria 533
595 Ga0587075_113150 3300059644 Bacteria 554
596 Ga0501082_0105558 3300060353 Bacteria 2437
597 Ga0501082_0181989 3300060353 Bacteria 1828
598 Ga0466962_0685134 3300061719 Bacteria 525
599 Ga0530510_0013210 3300061734 Bacteria 5807
600 Ga0530510_0032831 3300061734 Bacteria 3736

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_100177751 Ga0070684_1001777514 92
2 3300009553 Ga0105249_10684267 Ga0105249_106842672 93
3 3300009553 Ga0105249_11284670 Ga0105249_112846702 93
4 3300013306 Ga0163162_10181675 Ga0163162_101816752 93
5 3300014497 Ga0182008_10141013 Ga0182008_101410132 93
6 3300025933 Ga0207706_10249807 Ga0207706_102498073 93
7 3300025961 Ga0207712_10280972 Ga0207712_102809722 93
8 3300025972 Ga0207668_10810798 Ga0207668_108107982 93
9 3300026118 Ga0207675_100081838 Ga0207675_1000818382 93
10 3300047445 Ga0495677_0271465 Ga0495677_0271465_70_366 93
11 3300005356 Ga0070674_101755205 Ga0070674_1017552051 94
12 3300005437 Ga0070710_10269354 Ga0070710_102693542 94
13 3300005545 Ga0070695_100302794 Ga0070695_1003027942 94
14 3300005578 Ga0068854_100757249 Ga0068854_1007572492 94
15 3300005844 Ga0068862_100538606 Ga0068862_1005386062 94
16 3300005981 Ga0081538_10004097 Ga0081538_1000409710 94
17 3300009098 Ga0105245_10569807 Ga0105245_105698073 94
18 3300009148 Ga0105243_10627595 Ga0105243_106275952 94
19 3300009553 Ga0105249_11087897 Ga0105249_110878972 94
20 3300021384 Ga0213876_10062878 Ga0213876_100628782 94
21 3300021388 Ga0213875_10586612 Ga0213875_105866122 94
22 3300025898 Ga0207692_10279352 Ga0207692_102793522 94
23 3300025981 Ga0207640_11552116 Ga0207640_115521162 94
24 3300026118 Ga0207675_100340418 Ga0207675_1003404183 94
25 3300037853 Ga0436364_0405852 Ga0436364_0405852_1236_1529 94
26 3300039437 Ga0436365_1391036 Ga0436365_1391036_779_1072 94
27 3300039450 Ga0436363_1509907 Ga0436363_1509907_168_461 94
28 3300053077 Ga0495601_0000577 Ga0495601_0000577_11412_11696 94
29 3300053078 Ga0495612_0000176 Ga0495612_0000176_5883_6167 94
30 3300003203 JGI25406J46586_10111344 JGI25406J46586_101113442 95
31 3300003373 JGI25407J50210_10050147 JGI25407J50210_100501472 95
32 3300005327 Ga0070658_10802408 Ga0070658_108024082 95
33 3300005328 Ga0070676_11264417 Ga0070676_112644172 95
34 3300005329 Ga0070683_101095262 Ga0070683_1010952622 95
35 3300005329 Ga0070683_101167952 Ga0070683_1011679522 95
36 3300005329 Ga0070683_101616849 Ga0070683_1016168492 95
37 3300005330 Ga0070690_100554811 Ga0070690_1005548111 95
38 3300005331 Ga0070670_100755037 Ga0070670_1007550372 95
39 3300005334 Ga0068869_101153551 Ga0068869_1011535512 95
40 3300005334 Ga0068869_101876011 Ga0068869_1018760111 95
41 3300005335 Ga0070666_10761269 Ga0070666_107612692 95
42 3300005336 Ga0070680_101068356 Ga0070680_1010683562 95
43 3300005337 Ga0070682_100072547 Ga0070682_1000725473 95
44 3300005337 Ga0070682_100102265 Ga0070682_1001022653 95
45 3300005337 Ga0070682_101841171 Ga0070682_1018411711 95
46 3300005338 Ga0068868_101157060 Ga0068868_1011570601 95
47 3300005339 Ga0070660_100300494 Ga0070660_1003004942 95
48 3300005343 Ga0070687_100199396 Ga0070687_1001993962 95
49 3300005343 Ga0070687_100431878 Ga0070687_1004318782 95
50 3300005344 Ga0070661_101130873 Ga0070661_1011308732 95
51 3300005345 Ga0070692_10256195 Ga0070692_102561952 95
52 3300005345 Ga0070692_10610381 Ga0070692_106103812 95
53 3300005347 Ga0070668_102197656 Ga0070668_1021976561 95
54 3300005353 Ga0070669_100061979 Ga0070669_1000619792 95
55 3300005354 Ga0070675_102114635 Ga0070675_1021146352 95
56 3300005354 Ga0070675_102243916 Ga0070675_1022439162 95
57 3300005355 Ga0070671_100442447 Ga0070671_1004424472 95
58 3300005355 Ga0070671_100480124 Ga0070671_1004801242 95
59 3300005356 Ga0070674_100160373 Ga0070674_1001603732 95
60 3300005365 Ga0070688_100202147 Ga0070688_1002021472 95
61 3300005366 Ga0070659_100022833 Ga0070659_1000228335 95
62 3300005366 Ga0070659_100389774 Ga0070659_1003897742 95
63 3300005434 Ga0070709_11000720 Ga0070709_110007201 95
64 3300005437 Ga0070710_10000009 Ga0070710_1000000918 95
65 3300005437 Ga0070710_10375979 Ga0070710_103759792 95
66 3300005437 Ga0070710_11459443 Ga0070710_114594431 95
67 3300005438 Ga0070701_10145785 Ga0070701_101457852 95
68 3300005438 Ga0070701_10854495 Ga0070701_108544952 95
69 3300005440 Ga0070705_100562809 Ga0070705_1005628092 95
70 3300005440 Ga0070705_101033548 Ga0070705_1010335481 95
71 3300005440 Ga0070705_101155218 Ga0070705_1011552182 95
72 3300005441 Ga0070700_100087779 Ga0070700_1000877792 95
73 3300005441 Ga0070700_101157888 Ga0070700_1011578882 95
74 3300005444 Ga0070694_100834518 Ga0070694_1008345182 95
75 3300005455 Ga0070663_100691820 Ga0070663_1006918201 95
76 3300005455 Ga0070663_101103237 Ga0070663_1011032371 95
77 3300005456 Ga0070678_100525449 Ga0070678_1005254491 95
78 3300005456 Ga0070678_100602752 Ga0070678_1006027522 95
79 3300005456 Ga0070678_101345307 Ga0070678_1013453072 95
80 3300005457 Ga0070662_100102570 Ga0070662_1001025703 95
81 3300005457 Ga0070662_100661238 Ga0070662_1006612382 95
82 3300005458 Ga0070681_10082889 Ga0070681_100828892 95
83 3300005459 Ga0068867_100988714 Ga0068867_1009887142 95
84 3300005466 Ga0070685_10027951 Ga0070685_100279512 95
85 3300005535 Ga0070684_100612553 Ga0070684_1006125532 95
86 3300005535 Ga0070684_101900413 Ga0070684_1019004131 95
87 3300005535 Ga0070684_101980042 Ga0070684_1019800422 95
88 3300005539 Ga0068853_100918547 Ga0068853_1009185471 95
89 3300005543 Ga0070672_100624557 Ga0070672_1006245572 95
90 3300005544 Ga0070686_100668084 Ga0070686_1006680842 95
91 3300005546 Ga0070696_100188729 Ga0070696_1001887292 95
92 3300005546 Ga0070696_100789869 Ga0070696_1007898692 95
93 3300005547 Ga0070693_100091270 Ga0070693_1000912702 95
94 3300005547 Ga0070693_100204033 Ga0070693_1002040331 95
95 3300005547 Ga0070693_100570387 Ga0070693_1005703872 95
96 3300005548 Ga0070665_100264584 Ga0070665_1002645843 95
97 3300005549 Ga0070704_101138698 Ga0070704_1011386982 95
98 3300005564 Ga0070664_100160511 Ga0070664_1001605113 95
99 3300005564 Ga0070664_100226335 Ga0070664_1002263353 95
100 3300005564 Ga0070664_100976124 Ga0070664_1009761242 95
101 3300005578 Ga0068854_100147251 Ga0068854_1001472512 95
102 3300005578 Ga0068854_100544913 Ga0068854_1005449132 95
103 3300005578 Ga0068854_101211604 Ga0068854_1012116042 95
104 3300005614 Ga0068856_100080235 Ga0068856_1000802353 95
105 3300005614 Ga0068856_100266443 Ga0068856_1002664432 95
106 3300005614 Ga0068856_100590481 Ga0068856_1005904812 95
107 3300005614 Ga0068856_102014348 Ga0068856_1020143481 95
108 3300005614 Ga0068856_102639344 Ga0068856_1026393442 95
109 3300005615 Ga0070702_100026757 Ga0070702_1000267572 95
110 3300005615 Ga0070702_100463710 Ga0070702_1004637101 95
111 3300005616 Ga0068852_101081979 Ga0068852_1010819792 95
112 3300005616 Ga0068852_101393418 Ga0068852_1013934182 95
113 3300005616 Ga0068852_101408805 Ga0068852_1014088052 95
114 3300005618 Ga0068864_101332765 Ga0068864_1013327652 95
115 3300005618 Ga0068864_102013358 Ga0068864_1020133582 95
116 3300005718 Ga0068866_10216179 Ga0068866_102161792 95
117 3300005719 Ga0068861_100075562 Ga0068861_1000755622 95
118 3300005834 Ga0068851_10248871 Ga0068851_102488712 95
119 3300005834 Ga0068851_10420819 Ga0068851_104208192 95
120 3300005840 Ga0068870_10057609 Ga0068870_100576093 95
121 3300005843 Ga0068860_101125424 Ga0068860_1011254242 95
122 3300005843 Ga0068860_101819812 Ga0068860_1018198122 95
123 3300005844 Ga0068862_100088556 Ga0068862_1000885564 95
124 3300005844 Ga0068862_100566227 Ga0068862_1005662272 95
125 3300005981 Ga0081538_10001913 Ga0081538_1000191319 95
126 3300005981 Ga0081538_10021300 Ga0081538_100213002 95
127 3300005981 Ga0081538_10037999 Ga0081538_100379994 95
128 3300005981 Ga0081538_10328093 Ga0081538_103280931 95
129 3300005983 Ga0081540_1001320 Ga0081540_100132019 95
130 3300005983 Ga0081540_1041565 Ga0081540_10415652 95
131 3300005985 Ga0081539_10002904 Ga0081539_1000290419 95
132 3300005985 Ga0081539_10003140 Ga0081539_1000314021 95
133 3300005985 Ga0081539_10003406 Ga0081539_1000340613 95
134 3300005985 Ga0081539_10053414 Ga0081539_100534144 95
135 3300005985 Ga0081539_10364834 Ga0081539_103648342 95
136 3300006058 Ga0075432_10251145 Ga0075432_102511452 95
137 3300006058 Ga0075432_10405955 Ga0075432_104059552 95
138 3300006173 Ga0070716_100984837 Ga0070716_1009848371 95
139 3300006175 Ga0070712_100000170 Ga0070712_10000017021 95
140 3300006175 Ga0070712_100540348 Ga0070712_1005403482 95
141 3300006175 Ga0070712_101025242 Ga0070712_1010252422 95
142 3300006358 Ga0068871_101017946 Ga0068871_1010179462 95
143 3300006844 Ga0075428_102209549 Ga0075428_1022095491 95
144 3300006852 Ga0075433_11142675 Ga0075433_111426752 95
145 3300006871 Ga0075434_100111977 Ga0075434_1001119773 95
146 3300006871 Ga0075434_100571442 Ga0075434_1005714422 95
147 3300006880 Ga0075429_100414562 Ga0075429_1004145622 95
148 3300006881 Ga0068865_101476731 Ga0068865_1014767311 95
149 3300007076 Ga0075435_100144981 Ga0075435_1001449812 95
150 3300007076 Ga0075435_100275518 Ga0075435_1002755182 95
151 3300007076 Ga0075435_100277192 Ga0075435_1002771922 95
152 3300009036 Ga0105244_10268898 Ga0105244_102688982 95
153 3300009093 Ga0105240_10617140 Ga0105240_106171402 95
154 3300009094 Ga0111539_10140971 Ga0111539_101409712 95
155 3300009094 Ga0111539_10491343 Ga0111539_104913432 95
156 3300009094 Ga0111539_10698662 Ga0111539_106986622 95
157 3300009098 Ga0105245_10148040 Ga0105245_101480404 95
158 3300009098 Ga0105245_10300953 Ga0105245_103009532 95
159 3300009098 Ga0105245_10848514 Ga0105245_108485142 95
160 3300009098 Ga0105245_10927043 Ga0105245_109270432 95
161 3300009098 Ga0105245_10984426 Ga0105245_109844262 95
162 3300009098 Ga0105245_12073789 Ga0105245_120737892 95
163 3300009101 Ga0105247_10351179 Ga0105247_103511792 95
164 3300009147 Ga0114129_12939875 Ga0114129_129398751 95
165 3300009148 Ga0105243_10378421 Ga0105243_103784212 95
166 3300009148 Ga0105243_10464816 Ga0105243_104648163 95
167 3300009148 Ga0105243_10627799 Ga0105243_106277992 95
168 3300009148 Ga0105243_10755345 Ga0105243_107553452 95
169 3300009148 Ga0105243_12467507 Ga0105243_124675071 95
170 3300009148 Ga0105243_12500158 Ga0105243_125001582 95
171 3300009148 Ga0105243_12830072 Ga0105243_128300722 95
172 3300009174 Ga0105241_10463801 Ga0105241_104638012 95
173 3300009176 Ga0105242_10048110 Ga0105242_100481104 95
174 3300009176 Ga0105242_10327070 Ga0105242_103270702 95
175 3300009176 Ga0105242_11721342 Ga0105242_117213422 95
176 3300009177 Ga0105248_11686584 Ga0105248_116865842 95
177 3300009177 Ga0105248_13290680 Ga0105248_132906801 95
178 3300009551 Ga0105238_10641953 Ga0105238_106419532 95
179 3300009551 Ga0105238_10798137 Ga0105238_107981372 95
180 3300009551 Ga0105238_10926481 Ga0105238_109264812 95
181 3300009551 Ga0105238_11211681 Ga0105238_112116812 95
182 3300009553 Ga0105249_10103726 Ga0105249_101037262 95
183 3300009553 Ga0105249_10895128 Ga0105249_108951282 95
184 3300009553 Ga0105249_13406021 Ga0105249_134060211 95
185 3300010375 Ga0105239_10171107 Ga0105239_101711073 95
186 3300010375 Ga0105239_10281454 Ga0105239_102814542 95
187 3300010375 Ga0105239_10529093 Ga0105239_105290932 95
188 3300010375 Ga0105239_10670010 Ga0105239_106700102 95
189 3300010375 Ga0105239_12796733 Ga0105239_127967331 95
190 3300011119 Ga0105246_10451643 Ga0105246_104516431 95
191 3300012498 Ga0157345_1044286 Ga0157345_10442862 95
192 3300013102 Ga0157371_10458842 Ga0157371_104588422 95
193 3300013102 Ga0157371_10545933 Ga0157371_105459332 95
194 3300013102 Ga0157371_10610582 Ga0157371_106105821 95
195 3300013105 Ga0157369_11787013 Ga0157369_117870131 95
196 3300013105 Ga0157369_12327379 Ga0157369_123273792 95
197 3300013296 Ga0157374_10364642 Ga0157374_103646422 95
198 3300013296 Ga0157374_12112936 Ga0157374_121129362 95
199 3300013297 Ga0157378_10251438 Ga0157378_102514382 95
200 3300013297 Ga0157378_10710324 Ga0157378_107103243 95
201 3300013297 Ga0157378_11204776 Ga0157378_112047762 95
202 3300013297 Ga0157378_12054479 Ga0157378_120544792 95
203 3300013307 Ga0157372_10220228 Ga0157372_102202282 95
204 3300013307 Ga0157372_10561991 Ga0157372_105619912 95
205 3300013307 Ga0157372_11023050 Ga0157372_110230502 95
206 3300013307 Ga0157372_11326084 Ga0157372_113260841 95
207 3300013307 Ga0157372_11434404 Ga0157372_114344042 95
208 3300013308 Ga0157375_10175788 Ga0157375_101757882 95
209 3300013308 Ga0157375_11428620 Ga0157375_114286202 95
210 3300014325 Ga0163163_10411871 Ga0163163_104118712 95
211 3300014325 Ga0163163_11123278 Ga0163163_111232781 95
212 3300014326 Ga0157380_11918985 Ga0157380_119189852 95
213 3300014326 Ga0157380_12653865 Ga0157380_126538652 95
214 3300014326 Ga0157380_12865060 Ga0157380_128650602 95
215 3300014326 Ga0157380_13525861 Ga0157380_135258612 95
216 3300014497 Ga0182008_10478473 Ga0182008_104784732 95
217 3300014745 Ga0157377_10293881 Ga0157377_102938812 95
218 3300014745 Ga0157377_10310054 Ga0157377_103100542 95
219 3300014745 Ga0157377_10418812 Ga0157377_104188122 95
220 3300014745 Ga0157377_11240354 Ga0157377_112403541 95
221 3300014968 Ga0157379_10001699 Ga0157379_1000169921 95
222 3300014968 Ga0157379_10001699 Ga0157379_1000169922 95
223 3300014968 Ga0157379_11051276 Ga0157379_110512762 95
224 3300014968 Ga0157379_11168493 Ga0157379_111684932 95
225 3300014968 Ga0157379_11276782 Ga0157379_112767821 95
226 3300014969 Ga0157376_10578196 Ga0157376_105781962 95
227 3300014969 Ga0157376_11100528 Ga0157376_111005282 95
228 3300014969 Ga0157376_13065640 Ga0157376_130656402 95
229 3300017792 Ga0163161_10621065 Ga0163161_106210651 95
230 3300025321 Ga0207656_10022875 Ga0207656_100228753 95
231 3300025893 Ga0207682_10452613 Ga0207682_104526132 95
232 3300025898 Ga0207692_10000005 Ga0207692_10000005308 95
233 3300025898 Ga0207692_10140913 Ga0207692_101409132 95
234 3300025898 Ga0207692_10945561 Ga0207692_109455611 95
235 3300025899 Ga0207642_10014980 Ga0207642_100149802 95
236 3300025899 Ga0207642_10511381 Ga0207642_105113812 95
237 3300025901 Ga0207688_10205635 Ga0207688_102056352 95
238 3300025903 Ga0207680_11227543 Ga0207680_112275432 95
239 3300025904 Ga0207647_10194648 Ga0207647_101946482 95
240 3300025904 Ga0207647_10220799 Ga0207647_102207992 95
241 3300025907 Ga0207645_10558386 Ga0207645_105583862 95
242 3300025908 Ga0207643_10228889 Ga0207643_102288892 95
243 3300025911 Ga0207654_10173914 Ga0207654_101739141 95
244 3300025912 Ga0207707_10279178 Ga0207707_102791782 95
245 3300025914 Ga0207671_10714686 Ga0207671_107146862 95
246 3300025915 Ga0207693_10000028 Ga0207693_10000028108 95
247 3300025916 Ga0207663_10951964 Ga0207663_109519642 95
248 3300025916 Ga0207663_11317178 Ga0207663_113171781 95
249 3300025917 Ga0207660_11261179 Ga0207660_112611792 95
250 3300025918 Ga0207662_11265254 Ga0207662_112652542 95
251 3300025919 Ga0207657_10369117 Ga0207657_103691171 95
252 3300025920 Ga0207649_10480287 Ga0207649_104802872 95
253 3300025920 Ga0207649_10724363 Ga0207649_107243632 95
254 3300025921 Ga0207652_10283361 Ga0207652_102833612 95
255 3300025921 Ga0207652_10418275 Ga0207652_104182752 95
256 3300025923 Ga0207681_10005963 Ga0207681_100059632 95
257 3300025923 Ga0207681_10813753 Ga0207681_108137532 95
258 3300025924 Ga0207694_11777865 Ga0207694_117778652 95
259 3300025925 Ga0207650_10585448 Ga0207650_105854482 95
260 3300025926 Ga0207659_11092051 Ga0207659_110920512 95
261 3300025927 Ga0207687_10050485 Ga0207687_100504855 95
262 3300025927 Ga0207687_10344562 Ga0207687_103445622 95
263 3300025927 Ga0207687_10533700 Ga0207687_105337002 95
264 3300025927 Ga0207687_11092149 Ga0207687_110921491 95
265 3300025927 Ga0207687_11531858 Ga0207687_115318582 95
266 3300025931 Ga0207644_10319088 Ga0207644_103190882 95
267 3300025931 Ga0207644_11528525 Ga0207644_115285251 95
268 3300025932 Ga0207690_10000460 Ga0207690_1000046028 95
269 3300025932 Ga0207690_10049503 Ga0207690_100495033 95
270 3300025932 Ga0207690_10124526 Ga0207690_101245264 95
271 3300025932 Ga0207690_10192094 Ga0207690_101920942 95
272 3300025933 Ga0207706_10041051 Ga0207706_100410512 95
273 3300025933 Ga0207706_10056983 Ga0207706_100569832 95
274 3300025933 Ga0207706_11275456 Ga0207706_112754561 95
275 3300025934 Ga0207686_10069550 Ga0207686_100695502 95
276 3300025935 Ga0207709_10016322 Ga0207709_100163225 95
277 3300025935 Ga0207709_10239128 Ga0207709_102391282 95
278 3300025935 Ga0207709_10518505 Ga0207709_105185052 95
279 3300025936 Ga0207670_10031320 Ga0207670_100313202 95
280 3300025937 Ga0207669_10055412 Ga0207669_100554123 95
281 3300025937 Ga0207669_10526560 Ga0207669_105265602 95
282 3300025938 Ga0207704_10089703 Ga0207704_100897032 95
283 3300025939 Ga0207665_10970544 Ga0207665_109705442 95
284 3300025940 Ga0207691_10077524 Ga0207691_100775242 95
285 3300025940 Ga0207691_10680762 Ga0207691_106807622 95
286 3300025941 Ga0207711_10653517 Ga0207711_106535172 95
287 3300025942 Ga0207689_10104293 Ga0207689_101042932 95
288 3300025944 Ga0207661_10588642 Ga0207661_105886422 95
289 3300025945 Ga0207679_10149136 Ga0207679_101491362 95
290 3300025945 Ga0207679_10529674 Ga0207679_105296742 95
291 3300025945 Ga0207679_10851511 Ga0207679_108515111 95
292 3300025949 Ga0207667_10661848 Ga0207667_106618481 95
293 3300025960 Ga0207651_10252805 Ga0207651_102528053 95
294 3300025961 Ga0207712_10212667 Ga0207712_102126672 95
295 3300025972 Ga0207668_10460075 Ga0207668_104600752 95
296 3300025972 Ga0207668_10638238 Ga0207668_106382381 95
297 3300025981 Ga0207640_10129996 Ga0207640_101299962 95
298 3300025981 Ga0207640_10204311 Ga0207640_102043112 95
299 3300025981 Ga0207640_10469956 Ga0207640_104699562 95
300 3300025986 Ga0207658_11859664 Ga0207658_118596642 95
301 3300026023 Ga0207677_10035971 Ga0207677_100359712 95
302 3300026023 Ga0207677_10233329 Ga0207677_102333293 95
303 3300026035 Ga0207703_10139036 Ga0207703_101390363 95
304 3300026067 Ga0207678_10172074 Ga0207678_101720742 95
305 3300026075 Ga0207708_10059564 Ga0207708_100595642 95
306 3300026075 Ga0207708_10164473 Ga0207708_101644732 95
307 3300026075 Ga0207708_10474780 Ga0207708_104747802 95
308 3300026078 Ga0207702_10236095 Ga0207702_102360952 95
309 3300026078 Ga0207702_10380522 Ga0207702_103805223 95
310 3300026078 Ga0207702_10990445 Ga0207702_109904452 95
311 3300026088 Ga0207641_10137733 Ga0207641_101377332 95
312 3300026089 Ga0207648_10185362 Ga0207648_101853622 95
313 3300026089 Ga0207648_10532352 Ga0207648_105323522 95
314 3300026095 Ga0207676_10406750 Ga0207676_104067502 95
315 3300026095 Ga0207676_12539376 Ga0207676_125393761 95
316 3300026116 Ga0207674_11054659 Ga0207674_110546592 95
317 3300026116 Ga0207674_11349453 Ga0207674_113494532 95
318 3300026118 Ga0207675_100063470 Ga0207675_1000634702 95
319 3300026118 Ga0207675_101653268 Ga0207675_1016532682 95
320 3300026121 Ga0207683_10047015 Ga0207683_100470155 95
321 3300027907 Ga0207428_10046930 Ga0207428_100469303 95
322 3300027907 Ga0207428_10217387 Ga0207428_102173872 95
323 3300027907 Ga0207428_10906467 Ga0207428_109064672 95
324 3300028379 Ga0268266_10178506 Ga0268266_101785064 95
325 3300028380 Ga0268265_10129980 Ga0268265_101299802 95
326 3300028380 Ga0268265_11307554 Ga0268265_113075541 95
327 3300028381 Ga0268264_10097986 Ga0268264_100979863 95
328 3300028381 Ga0268264_11259928 Ga0268264_112599282 95
329 3300028381 Ga0268264_11755163 Ga0268264_117551632 95
330 3300028558 Ga0265326_10000030 Ga0265326_1000003050 95
331 3300028563 Ga0265319_1000088 Ga0265319_10000889 95
332 3300028563 Ga0265319_1001802 Ga0265319_10018025 95
333 3300028563 Ga0265319_1092039 Ga0265319_10920391 95
334 3300028573 Ga0265334_10000156 Ga0265334_100001567 95
335 3300028577 Ga0265318_10003342 Ga0265318_100033422 95
336 3300028653 Ga0265323_10217661 Ga0265323_102176612 95
337 3300028654 Ga0265322_10014765 Ga0265322_100147652 95
338 3300028666 Ga0265336_10000515 Ga0265336_1000051513 95
339 3300028800 Ga0265338_10000536 Ga0265338_1000053647 95
340 3300028800 Ga0265338_10077006 Ga0265338_100770063 95
341 3300028800 Ga0265338_10330281 Ga0265338_103302812 95
342 3300029957 Ga0265324_10001136 Ga0265324_100011364 95
343 3300031238 Ga0265332_10475914 Ga0265332_104759141 95
344 3300031240 Ga0265320_10011700 Ga0265320_100117006 95
345 3300031240 Ga0265320_10023734 Ga0265320_100237345 95
346 3300031240 Ga0265320_10039189 Ga0265320_100391894 95
347 3300031240 Ga0265320_10061481 Ga0265320_100614811 95
348 3300031251 Ga0265327_10072636 Ga0265327_100726362 95
349 3300031344 Ga0265316_10072053 Ga0265316_100720534 95
350 3300031595 Ga0265313_10039991 Ga0265313_100399912 95
351 3300031595 Ga0265313_10165436 Ga0265313_101654361 95
352 3300031711 Ga0265314_10121748 Ga0265314_101217483 95
353 3300031824 Ga0307413_11026150 Ga0307413_110261501 95
354 3300031824 Ga0307413_11439547 Ga0307413_114395471 95
355 3300031852 Ga0307410_11738897 Ga0307410_117388972 95
356 3300031889 Ga0326468_10028146 Ga0326468_100281462 95
357 3300031901 Ga0307406_10137431 Ga0307406_101374311 95
358 3300031901 Ga0307406_11261258 Ga0307406_112612582 95
359 3300031901 Ga0307406_11384905 Ga0307406_113849051 95
360 3300031903 Ga0307407_11113576 Ga0307407_111135762 95
361 3300031995 Ga0307409_100634633 Ga0307409_1006346332 95
362 3300032002 Ga0307416_100528966 Ga0307416_1005289661 95
363 3300032002 Ga0307416_100578112 Ga0307416_1005781122 95
364 3300032004 Ga0307414_11928356 Ga0307414_119283561 95
365 3300032005 Ga0307411_10835188 Ga0307411_108351881 95
366 3300032126 Ga0307415_100863628 Ga0307415_1008636282 95
367 3300032126 Ga0307415_101132784 Ga0307415_1011327842 95
368 3300032126 Ga0307415_101526038 Ga0307415_1015260382 95
369 3300035171 Ga0373946_0080555 Ga0373946_0080555_275_562 95
370 3300035241 Ga0373961_0207481 Ga0373961_0207481_118_405 95
371 3300035692 Ga0373935_1151748 Ga0373935_1151748_81_368 95
372 3300035725 Ga0373947_0339982 Ga0373947_0339982_188_475 95
373 3300037418 Ga0395900_0294161 Ga0395900_0294161_1265_1552 95
374 3300037418 Ga0395900_1375960 Ga0395900_1375960_205_492 95
375 3300037418 Ga0395900_1664319 Ga0395900_1664319_98_385 95
376 3300037466 Ga0395898_1121559 Ga0395898_1121559_175_462 95
377 3300037471 Ga0395905_0902105 Ga0395905_0902105_42_329 95
378 3300038443 Ga0395901_0225079 Ga0395901_0225079_223_510 95
379 3300038443 Ga0395901_0239242 Ga0395901_0239242_167_454 95
380 3300038443 Ga0395901_0457015 Ga0395901_0457015_763_1050 95
381 3300038443 Ga0395901_0656918 Ga0395901_0656918_375_662 95
382 3300038996 Ga0242420_063477 Ga0242420_063477_255_542 95
383 3300039450 Ga0436363_1069811 Ga0436363_1069811_446_733 95
384 3300039450 Ga0436363_1618696 Ga0436363_1618696_149_436 95
385 3300041456 Ga0451795_1071654 Ga0451795_1071654_281_568 95
386 3300041486 Ga0451807_0359264 Ga0451807_0359264_330_617 95
387 3300041491 Ga0451833_0358762 Ga0451833_0358762_208_495 95
388 3300041492 Ga0451835_1000594 Ga0451835_1000594_574_861 95
389 3300041496 Ga0451839_0069234 Ga0451839_0069234_521_811 95
390 3300041512 Ga0451853_2463626 Ga0451853_2463626_794_1081 95
391 3300042005 Ga0439448_0073593 Ga0439448_0073593_417_704 95
392 3300042137 Ga0450902_097072 Ga0450902_097072_21_308 95
393 3300042439 Ga0439464_0212011 Ga0439464_0212011_120_413 95
394 3300042993 Ga0439440_0223008 Ga0439440_0223008_94_381 95
395 3300044658 Ga0466972_0222628 Ga0466972_0222628_324_611 95
396 3300044658 Ga0466972_0629803 Ga0466972_0629803_118_405 95
397 3300044693 Ga0466961_0796199 Ga0466961_0796199_209_496 95
398 3300044694 Ga0466963_0167303 Ga0466963_0167303_144_431 95
399 3300044706 Ga0466964_0058577 Ga0466964_0058577_132_422 95
400 3300044765 Ga0466970_0032472 Ga0466970_0032472_222_509 95
401 3300044901 Ga0466960_0005612 Ga0466960_0005612_3884_4171 95
402 3300044901 Ga0466960_0192905 Ga0466960_0192905_342_629 95
403 3300044901 Ga0466960_0229854 Ga0466960_0229854_384_671 95
404 3300044901 Ga0466960_0864203 Ga0466960_0864203_46_336 95
405 3300044901 Ga0466960_1011754 Ga0466960_1011754_14_304 95
406 3300045049 Ga0466959_0619025 Ga0466959_0619025_229_519 95
407 3300045976 Ga0466967_0016857 Ga0466967_0016857_5402_5689 95
408 3300045976 Ga0466967_0022542 Ga0466967_0022542_1411_1701 95
409 3300045976 Ga0466967_0084611 Ga0466967_0084611_91_378 95
410 3300045976 Ga0466967_0116344 Ga0466967_0116344_2083_2370 95
411 3300045976 Ga0466967_0237946 Ga0466967_0237946_1235_1522 95
412 3300045976 Ga0466967_0322474 Ga0466967_0322474_222_509 95
413 3300045976 Ga0466967_0906928 Ga0466967_0906928_470_760 95
414 3300045976 Ga0466967_1237782 Ga0466967_1237782_146_433 95
415 3300045976 Ga0466967_1459897 Ga0466967_1459897_210_500 95
416 3300045976 Ga0466967_2189466 Ga0466967_2189466_237_524 95
417 3300046455 Ga0495603_0087534 Ga0495603_0087534_322_609 95
418 3300046457 Ga0495590_0254730 Ga0495590_0254730_249_536 95
419 3300046471 Ga0495650_0000063 Ga0495650_0000063_126865_127152 95
420 3300046472 Ga0495580_0636541 Ga0495580_0636541_211_498 95
421 3300046491 Ga0495584_0687171 Ga0495584_0687171_195_482 95
422 3300046492 Ga0495585_0100003 Ga0495585_0100003_89_376 95
423 3300046499 Ga0495594_0146038 Ga0495594_0146038_561_848 95
424 3300046517 Ga0495630_1389017 Ga0495630_1389017_216_506 95
425 3300046520 Ga0495637_0138304 Ga0495637_0138304_217_504 95
426 3300046520 Ga0495637_0335947 Ga0495637_0335947_42_329 95
427 3300046523 Ga0495644_0043755 Ga0495644_0043755_1168_1455 95
428 3300046529 Ga0495652_0056967 Ga0495652_0056967_1919_2206 95
429 3300046537 Ga0495598_0331695 Ga0495598_0331695_185_472 95
430 3300046538 Ga0495609_0063723 Ga0495609_0063723_209_496 95
431 3300046543 Ga0495645_0000228 Ga0495645_0000228_1150_1437 95
432 3300046615 Ga0495656_0152203 Ga0495656_0152203_720_1007 95
433 3300046648 Ga0495611_0180078 Ga0495611_0180078_318_605 95
434 3300046681 Ga0495647_0572998 Ga0495647_0572998_105_392 95
435 3300046683 Ga0495658_0180595 Ga0495658_0180595_175_462 95
436 3300046690 Ga0495624_0586964 Ga0495624_0586964_304_591 95
437 3300046794 Ga0495589_0543547 Ga0495589_0543547_184_471 95
438 3300046809 Ga0495600_0040734 Ga0495600_0040734_2234_2521 95
439 3300047315 Ga0495581_0124794 Ga0495581_0124794_1025_1312 95
440 3300047321 Ga0495676_0828000 Ga0495676_0828000_102_389 95
441 3300047446 Ga0495679_135130 Ga0495679_135130_278_565 95
442 3300047472 Ga0495686_0415546 Ga0495686_0415546_367_654 95
443 3300048903 Ga0496100_0000118 Ga0496100_0000118_38507_38794 95
444 3300048903 Ga0496100_0034385 Ga0496100_0034385_2680_2967 95
445 3300048903 Ga0496100_0060369 Ga0496100_0060369_2003_2290 95
446 3300048903 Ga0496100_0103064 Ga0496100_0103064_287_574 95
447 3300048904 Ga0496101_0001916 Ga0496101_0001916_3712_3999 95
448 3300048904 Ga0496101_0020718 Ga0496101_0020718_3254_3541 95
449 3300048904 Ga0496101_0132735 Ga0496101_0132735_1450_1737 95
450 3300048905 Ga0496102_0000096 Ga0496102_0000096_5906_6193 95
451 3300048905 Ga0496102_0488809 Ga0496102_0488809_203_490 95
452 3300048905 Ga0496102_0580846 Ga0496102_0580846_176_463 95
453 3300048905 Ga0496102_0581406 Ga0496102_0581406_596_883 95
454 3300048905 Ga0496102_0889225 Ga0496102_0889225_397_684 95
455 3300048905 Ga0496102_0954199 Ga0496102_0954199_424_711 95
456 3300048905 Ga0496102_1393595 Ga0496102_1393595_61_348 95
457 3300048906 Ga0496103_0000035 Ga0496103_0000035_5719_6006 95
458 3300048906 Ga0496103_0230116 Ga0496103_0230116_710_997 95
459 3300048906 Ga0496103_0415074 Ga0496103_0415074_537_824 95
460 3300048906 Ga0496103_0865843 Ga0496103_0865843_221_508 95
461 3300048907 Ga0496104_0000028 Ga0496104_0000028_66915_67202 95
462 3300048907 Ga0496104_0647244 Ga0496104_0647244_515_802 95
463 3300048907 Ga0496104_1390854 Ga0496104_1390854_95_382 95
464 3300048908 Ga0496105_0055331 Ga0496105_0055331_2632_2919 95
465 3300048908 Ga0496105_0392581 Ga0496105_0392581_415_702 95
466 3300048908 Ga0496105_0589519 Ga0496105_0589519_20_307 95
467 3300048909 Ga0496106_0033377 Ga0496106_0033377_3206_3493 95
468 3300048909 Ga0496106_0070133 Ga0496106_0070133_1451_1738 95
469 3300048909 Ga0496106_0351609 Ga0496106_0351609_566_853 95
470 3300048909 Ga0496106_0385847 Ga0496106_0385847_712_999 95
471 3300048909 Ga0496106_0438732 Ga0496106_0438732_508_795 95
472 3300048910 Ga0496107_0062928 Ga0496107_0062928_817_1104 95
473 3300048910 Ga0496107_0164592 Ga0496107_0164592_1237_1524 95
474 3300048911 Ga0496108_0025154 Ga0496108_0025154_3197_3484 95
475 3300048911 Ga0496108_0035761 Ga0496108_0035761_3478_3765 95
476 3300048911 Ga0496108_0051472 Ga0496108_0051472_2300_2587 95
477 3300048912 Ga0496109_0024720 Ga0496109_0024720_370_657 95
478 3300048912 Ga0496109_0031619 Ga0496109_0031619_1360_1647 95
479 3300048912 Ga0496109_0166556 Ga0496109_0166556_1751_2038 95
480 3300048912 Ga0496109_0190042 Ga0496109_0190042_155_442 95
481 3300048912 Ga0496109_0583072 Ga0496109_0583072_141_440 95
482 3300048913 Ga0496110_0000666 Ga0496110_0000666_16676_16963 95
483 3300048913 Ga0496110_0002467 Ga0496110_0002467_6161_6448 95
484 3300048913 Ga0496110_0038554 Ga0496110_0038554_2285_2572 95
485 3300048913 Ga0496110_1025414 Ga0496110_1025414_96_383 95
486 3300048913 Ga0496110_1075948 Ga0496110_1075948_212_499 95
487 3300048913 Ga0496110_1362120 Ga0496110_1362120_57_344 95
488 3300048914 Ga0496111_0000229 Ga0496111_0000229_19864_20151 95
489 3300048914 Ga0496111_0009578 Ga0496111_0009578_4930_5217 95
490 3300048914 Ga0496111_0070554 Ga0496111_0070554_1270_1557 95
491 3300048914 Ga0496111_0094422 Ga0496111_0094422_283_570 95
492 3300048914 Ga0496111_0159737 Ga0496111_0159737_1344_1631 95
493 3300048914 Ga0496111_0815151 Ga0496111_0815151_367_654 95
494 3300048914 Ga0496111_1279686 Ga0496111_1279686_74_361 95
495 3300048914 Ga0496111_1332845 Ga0496111_1332845_116_403 95
496 3300048915 Ga0496112_0000418 Ga0496112_0000418_23179_23466 95
497 3300048915 Ga0496112_0008662 Ga0496112_0008662_2560_2847 95
498 3300048915 Ga0496112_0194143 Ga0496112_0194143_549_836 95
499 3300048915 Ga0496112_0330288 Ga0496112_0330288_371_658 95
500 3300048916 Ga0496113_0007595 Ga0496113_0007595_3913_4200 95
501 3300048916 Ga0496113_0083405 Ga0496113_0083405_289_576 95
502 3300048916 Ga0496113_0178810 Ga0496113_0178810_1303_1590 95
503 3300048916 Ga0496113_0920044 Ga0496113_0920044_216_503 95
504 3300048917 Ga0496114_0110111 Ga0496114_0110111_520_807 95
505 3300048917 Ga0496114_0255675 Ga0496114_0255675_554_841 95
506 3300048917 Ga0496114_0791113 Ga0496114_0791113_268_555 95
507 3300048917 Ga0496114_1005583 Ga0496114_1005583_346_633 95
508 3300048918 Ga0496115_0000350 Ga0496115_0000350_6687_7010 95
509 3300048918 Ga0496115_0022745 Ga0496115_0022745_3249_3536 95
510 3300048918 Ga0496115_0315187 Ga0496115_0315187_729_1016 95
511 3300048918 Ga0496115_0797346 Ga0496115_0797346_391_678 95
512 3300048924 Ga0496121_0024042 Ga0496121_0024042_1382_1669 95
513 3300048924 Ga0496121_0058090 Ga0496121_0058090_2093_2380 95
514 3300048927 Ga0496124_0364444 Ga0496124_0364444_469_756 95
515 3300049568 Ga0501031_0046243 Ga0501031_0046243_1385_1672 95
516 3300049568 Ga0501031_0178515 Ga0501031_0178515_990_1277 95
517 3300049568 Ga0501031_0263232 Ga0501031_0263232_428_715 95
518 3300049568 Ga0501031_0388887 Ga0501031_0388887_354_641 95
519 3300049571 Ga0501034_0021900 Ga0501034_0021900_2128_2415 95
520 3300049572 Ga0501036_0047983 Ga0501036_0047983_1360_1647 95
521 3300049572 Ga0501036_0221600 Ga0501036_0221600_1137_1424 95
522 3300049573 Ga0501037_0203658 Ga0501037_0203658_583_870 95
523 3300049574 Ga0501038_0289437 Ga0501038_0289437_858_1145 95
524 3300049574 Ga0501038_0615036 Ga0501038_0615036_310_597 95
525 3300049575 Ga0501039_0014617 Ga0501039_0014617_3656_3943 95
526 3300049575 Ga0501039_0292558 Ga0501039_0292558_823_1110 95
527 3300049576 Ga0501040_0045310 Ga0501040_0045310_2108_2395 95
528 3300049576 Ga0501040_0061416 Ga0501040_0061416_1227_1514 95
529 3300049576 Ga0501040_0719846 Ga0501040_0719846_112_399 95
530 3300049577 Ga0501041_0048537 Ga0501041_0048537_1341_1628 95
531 3300049577 Ga0501041_0053572 Ga0501041_0053572_1848_2135 95
532 3300049578 Ga0501042_0014356 Ga0501042_0014356_4310_4597 95
533 3300049578 Ga0501042_0019959 Ga0501042_0019959_2253_2540 95
534 3300049578 Ga0501042_0148998 Ga0501042_0148998_1210_1497 95
535 3300049578 Ga0501042_0535081 Ga0501042_0535081_482_769 95
536 3300049579 Ga0501043_0497543 Ga0501043_0497543_440_727 95
537 3300049580 Ga0501046_0049634 Ga0501046_0049634_1076_1363 95
538 3300049580 Ga0501046_0289936 Ga0501046_0289936_358_645 95
539 3300049582 Ga0501048_0149280 Ga0501048_0149280_1101_1388 95
540 3300049582 Ga0501048_1131475 Ga0501048_1131475_266_553 95
541 3300049583 Ga0501067_0341433 Ga0501067_0341433_529_816 95
542 3300049583 Ga0501067_0634285 Ga0501067_0634285_40_327 95
543 3300049585 Ga0501069_0562494 Ga0501069_0562494_374_661 95
544 3300049586 Ga0501070_0656567 Ga0501070_0656567_459_746 95
545 3300049586 Ga0501070_1027339 Ga0501070_1027339_70_357 95
546 3300049587 Ga0501071_0030118 Ga0501071_0030118_3300_3587 95
547 3300049587 Ga0501071_0031317 Ga0501071_0031317_3422_3709 95
548 3300049587 Ga0501071_0766459 Ga0501071_0766459_36_323 95
549 3300049588 Ga0501072_0014032 Ga0501072_0014032_3563_3850 95
550 3300049588 Ga0501072_0138152 Ga0501072_0138152_649_936 95
551 3300049588 Ga0501072_0247583 Ga0501072_0247583_732_1019 95
552 3300049588 Ga0501072_0510585 Ga0501072_0510585_501_788 95
553 3300049589 Ga0501073_0127537 Ga0501073_0127537_481_768 95
554 3300049590 Ga0501074_0209437 Ga0501074_0209437_340_627 95
555 3300049590 Ga0501074_0466369 Ga0501074_0466369_136_423 95
556 3300049590 Ga0501074_0798641 Ga0501074_0798641_129_416 95
557 3300049591 Ga0501075_0134829 Ga0501075_0134829_918_1205 95
558 3300049591 Ga0501075_0411957 Ga0501075_0411957_272_559 95
559 3300049591 Ga0501075_0557687 Ga0501075_0557687_431_718 95
560 3300049592 Ga0501076_0186900 Ga0501076_0186900_1041_1328 95
561 3300049592 Ga0501076_0326530 Ga0501076_0326530_272_559 95
562 3300049592 Ga0501076_0422768 Ga0501076_0422768_776_1063 95
563 3300049592 Ga0501076_0495827 Ga0501076_0495827_556_843 95
564 3300049593 Ga0501077_0480221 Ga0501077_0480221_431_718 95
565 3300049741 Ga0501079_0125805 Ga0501079_0125805_1456_1743 95
566 3300049741 Ga0501079_0170709 Ga0501079_0170709_1163_1450 95
567 3300049741 Ga0501079_0387193 Ga0501079_0387193_549_836 95
568 3300049742 Ga0501080_0174862 Ga0501080_0174862_92_379 95
569 3300049742 Ga0501080_0554841 Ga0501080_0554841_460_747 95
570 3300049743 Ga0501081_0057198 Ga0501081_0057198_2051_2338 95
571 3300049743 Ga0501081_0114490 Ga0501081_0114490_778_1065 95
572 3300049743 Ga0501081_0855663 Ga0501081_0855663_93_380 95
573 3300049744 Ga0501083_0117203 Ga0501083_0117203_46_333 95
574 3300049744 Ga0501083_0381953 Ga0501083_0381953_79_366 95
575 3300049822 Ga0501035_0428582 Ga0501035_0428582_447_734 95
576 3300049824 Ga0501045_0054352 Ga0501045_0054352_359_646 95
577 3300049824 Ga0501045_0186115 Ga0501045_0186115_521_808 95
578 3300049824 Ga0501045_0808607 Ga0501045_0808607_17_304 95
579 3300049824 Ga0501045_0820991 Ga0501045_0820991_374_661 95
580 3300050508 nmdc:mga09592_196946_c1 nmdc:mga09592_196946_c1_1148_1435 95
581 3300050510 nmdc:mga06r32_1885615_c1 nmdc:mga06r32_1885615_c1_43_330 95
582 3300050511 nmdc:mga08y16_311413_c1 nmdc:mga08y16_311413_c1_558_845 95
583 3300050511 nmdc:mga08y16_47162_c1 nmdc:mga08y16_47162_c1_1809_2096 95
584 3300050511 nmdc:mga08y16_475046_c1 nmdc:mga08y16_475046_c1_607_894 95
585 3300050512 nmdc:mga0n895_1441545_c1 nmdc:mga0n895_1441545_c1_148_435 95
586 3300050512 nmdc:mga0n895_223369_c1 nmdc:mga0n895_223369_c1_1415_1702 95
587 3300050512 nmdc:mga0n895_596557_c1 nmdc:mga0n895_596557_c1_641_940 95
588 3300050513 nmdc:mga0rr50_140212_c1 nmdc:mga0rr50_140212_c1_881_1168 95
589 3300050515 nmdc:mga0a205_822468_c1 nmdc:mga0a205_822468_c1_191_478 95
590 3300053077 Ga0495601_0118739 Ga0495601_0118739_275_562 95
591 3300053153 Ga0500616_0005144 Ga0500616_0005144_1041_1328 95
592 3300054114 Ga0501084_0067962 Ga0501084_0067962_1743_2030 95
593 3300054114 Ga0501084_0734270 Ga0501084_0734270_415_702 95
594 3300054114 Ga0501084_0924440 Ga0501084_0924440_243_530 95
595 3300059631 Ga0587130_047276 Ga0587130_047276_94_381 95
596 3300059644 Ga0587075_113150 Ga0587075_113150_116_403 95
597 3300060353 Ga0501082_0105558 Ga0501082_0105558_1665_1952 95
598 3300060353 Ga0501082_0181989 Ga0501082_0181989_1386_1673 95
599 3300061719 Ga0466962_0685134 Ga0466962_0685134_211_498 95
600 3300061734 Ga0530510_0013210 Ga0530510_0013210_1908_2195 95
601 3300061734 Ga0530510_0032831 Ga0530510_0032831_2804_3091 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

22

94

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9332 17 93
4o2x-assembly2.cif.gz_B structure of a malarial protein 0.9171 20 93
4o2x-assembly1.cif.gz_A structure of a malarial protein 0.9122 20 95
3dnj-assembly2.cif.gz_A the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide 0.8893 21 95
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.8887 17 93
ID Description Score Start End Superfamily
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9522 21 93 3.30.1390.10
af_Q8IEB2_84_184_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9428 18 94 3.30.1390.10
3o1fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8673 19 95 3.30.1390.10
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8606 21 93 3.30.1390.10
af_Q9VX91_228_322_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8516 14 82 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A2W4VXJ9-F1-model_v4 Clp protease ClpS 0.9698 23 95 GO:0006508
GO:0008233
GO:0030163
AF-U6MKK3-F1-model_v4 ATP-dependent Clp protease adaptor domain-containing protein, putative 0.9622 21 94 GO:0006508
GO:0008233
GO:0030163
AF-A0A7S1BRN6-F1-model_v4 Adaptor protein ClpS core domain-containing protein 0.9574 21 94 GO:0006508
GO:0030163
AF-A0A538CPT5-F1-model_v4 Clp protease ClpS 0.955 23 95 GO:0006508
GO:0008233
GO:0030163
AF-A0A4V2PXQ9-F1-model_v4 ATP-dependent Clp protease adaptor protein ClpS 0.9542 20 93 GO:0006508
GO:0008233
GO:0030163

Feature Viewer

pLDDT pTM Quality
81.59 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map