F467988

General Info

Members Datasets Scaffolds Average Seq Length
600 338 575 208

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10893062|Ga0268266_108930622
Length 243
Sequence MQVEITTLDQTSAGTADLPDAIFATVPRADIMARVVHWQLAKRRAGTHKVKSLKEVSGTTKKPYRQKGTGNARQGSLRAPQFRTGGVVHGPVVRSHEYSLNKKVRRLGLISALSQKQVEGKLVVLDAANGTAKTAELAKKLKALGWSSALIVDDSVDPGFLRASRNIPGIDVLPTVGANVYDILRHDVLAITAAGVEGLKQRLGASDAEAPDDEPVNANPGQSXLXXXAVITEHAAPGEGATA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
10 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
11 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
12 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
13 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
14 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
15 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
16 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
17 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
18 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
19 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
20 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
21 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
22 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
23 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
24 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
25 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
30 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
197 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
309 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
312 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
313 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
314 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
315 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
316 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
317 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
325 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
337 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
338 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.67
Metatranscriptomes 3.17
Isolates 4.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 12
Nodule 0.17
Rhizoplane 4.33
Rhizosphere 71
Stem 0
Stem Tuber 0
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1707570 2162886007 Bacteria 1694
2 ARcpr5oldR_c000791 3300000041 Bacteria 3571
3 JGI24740J21852_10008905 3300001979 Bacteria 3967
4 JGI24751J29686_10000325 3300002459 Bacteria 17611
5 JGI24751J29686_10043971 3300002459 Bacteria 923
6 JGI25406J46586_10001890 3300003203 Bacteria 9855
7 Ga0055536_1007883 3300003781 Bacteria 4679
8 Ga0058862_12358730 3300004803 Bacteria 1568
9 Ga0065704_10005096 3300005289 Bacteria 5772
10 Ga0065704_10009321 3300005289 Bacteria 3045
11 Ga0065704_10070214 3300005289 Bacteria 70706
12 Ga0065704_10133643 3300005289 Bacteria 1598
13 Ga0065707_10007537 3300005295 Bacteria 4124
14 Ga0070658_10000808 3300005327 Bacteria 26765
15 Ga0070658_10311392 3300005327 Bacteria 1343
16 Ga0070683_100606046 3300005329 Bacteria 1048
17 Ga0070690_100035558 3300005330 Bacteria 3126
18 Ga0070670_100024275 3300005331 Bacteria 5215
19 Ga0070670_100077325 3300005331 Bacteria 2860
20 Ga0070666_10077888 3300005335 Bacteria 2262
21 Ga0070666_10141818 3300005335 Bacteria 1674
22 Ga0070666_10204101 3300005335 Bacteria 1391
23 Ga0070680_100205764 3300005336 Bacteria 1660
24 Ga0070689_100539526 3300005340 Bacteria 1004
25 Ga0070668_100046306 3300005347 Bacteria 3339
26 Ga0070668_100201095 3300005347 Bacteria 1636
27 Ga0070668_100352101 3300005347 Bacteria 1247
28 Ga0070669_100002856 3300005353 Bacteria 12479
29 Ga0070669_100004937 3300005353 Bacteria 9634
30 Ga0070671_100002671 3300005355 Bacteria 13821
31 Ga0070671_100031516 3300005355 Bacteria 4380
32 Ga0070671_100201010 3300005355 Bacteria 1690
33 Ga0070667_100000088 3300005367 Bacteria 113956
34 Ga0070667_100019254 3300005367 Bacteria 5662
35 Ga0070667_100052979 3300005367 Bacteria 3424
36 Ga0070667_100092578 3300005367 Bacteria 2601
37 Ga0070714_100029929 3300005435 Bacteria 4530
38 Ga0070713_100001675 3300005436 Bacteria 14235
39 Ga0070713_100070192 3300005436 Bacteria 2957
40 Ga0070713_100389647 3300005436 Bacteria 1300
41 Ga0070711_100263075 3300005439 Bacteria 1358
42 Ga0070711_100578006 3300005439 Bacteria 935
43 Ga0070705_100127772 3300005440 Bacteria 1653
44 Ga0070694_100101335 3300005444 Bacteria 2037
45 Ga0070663_100224453 3300005455 Bacteria 1476
46 Ga0070678_100149989 3300005456 Bacteria 1877
47 Ga0070679_100277979 3300005530 Bacteria 1627
48 Ga0068853_100001213 3300005539 Bacteria 18388
49 Ga0068853_100404879 3300005539 Bacteria 1277
50 Ga0070686_100238127 3300005544 Bacteria 1324
51 Ga0070696_100114044 3300005546 Bacteria 1949
52 Ga0070665_100001143 3300005548 Bacteria 32613
53 Ga0070665_100015146 3300005548 Bacteria 7741
54 Ga0070665_100080805 3300005548 Bacteria 3256
55 Ga0070665_100840700 3300005548 Bacteria 931
56 Ga0070665_101072993 3300005548 Bacteria 817
57 Ga0070704_100320926 3300005549 Bacteria 1298
58 Ga0068855_100106749 3300005563 Bacteria 3218
59 Ga0068855_100598311 3300005563 Bacteria 1189
60 Ga0068857_100123572 3300005577 Bacteria 2332
61 Ga0068857_100262080 3300005577 Bacteria 1587
62 Ga0068857_100358901 3300005577 Bacteria 1351
63 Ga0068857_100650980 3300005577 Bacteria 999
64 Ga0068854_100009263 3300005578 Bacteria 6354
65 Ga0068854_100048934 3300005578 Bacteria 3018
66 Ga0068856_100242910 3300005614 Bacteria 1816
67 Ga0068856_100436011 3300005614 Bacteria 1330
68 Ga0068856_100549835 3300005614 Bacteria 1176
69 Ga0068852_100200291 3300005616 Bacteria 1889
70 Ga0068852_100360610 3300005616 Bacteria 1422
71 Ga0068852_100563934 3300005616 Bacteria 1140
72 Ga0068852_100602980 3300005616 Bacteria 1102
73 Ga0068859_100001416 3300005617 Bacteria 24328
74 Ga0068859_100006387 3300005617 Bacteria 11959
75 Ga0068859_100042049 3300005617 Bacteria 4590
76 Ga0068859_100138380 3300005617 Bacteria 2508
77 Ga0068864_100014199 3300005618 Bacteria 6612
78 Ga0068864_100209740 3300005618 Bacteria 1793
79 Ga0068861_100000040 3300005719 Bacteria 59725
80 Ga0068861_100002700 3300005719 Bacteria 11613
81 Ga0068863_100000072 3300005841 Bacteria 113996
82 Ga0068863_100008669 3300005841 Bacteria 9938
83 Ga0068863_100084537 3300005841 Bacteria 3007
84 Ga0068863_100109631 3300005841 Bacteria 2628
85 Ga0068858_100054285 3300005842 Bacteria 3705
86 Ga0068858_100097011 3300005842 Bacteria 2747
87 Ga0068858_100219257 3300005842 Bacteria 1801
88 Ga0068860_100000220 3300005843 Bacteria 89460
89 Ga0068860_100000247 3300005843 Bacteria 81527
90 Ga0068860_100028664 3300005843 Bacteria 5359
91 Ga0068860_100159782 3300005843 Bacteria 2172
92 Ga0068862_100000126 3300005844 Bacteria 89210
93 Ga0068862_100037303 3300005844 Bacteria 4119
94 Ga0068862_100227549 3300005844 Bacteria 1691
95 Ga0081539_10000072 3300005985 Bacteria 232726
96 Ga0070717_10085206 3300006028 Bacteria 2659
97 Ga0070717_10179677 3300006028 Bacteria 1844
98 Ga0075365_10003441 3300006038 Bacteria 8155
99 Ga0075368_10000063 3300006042 Bacteria 25834
100 Ga0075363_100000434 3300006048 Bacteria 13047
101 Ga0075363_100000592 3300006048 Bacteria 11936
102 Ga0075364_10001520 3300006051 Bacteria 12625
103 Ga0075364_10039797 3300006051 Bacteria 3048
104 Ga0075364_10105823 3300006051 Bacteria 1874
105 Ga0075364_10263989 3300006051 Bacteria 1170
106 Ga0075432_10000042 3300006058 Bacteria 24212
107 Ga0070712_100004619 3300006175 Bacteria 8513
108 Ga0075362_10000383 3300006177 Bacteria 12678
109 Ga0075362_10001156 3300006177 Bacteria 8246
110 Ga0075362_10085808 3300006177 Bacteria 1456
111 Ga0075369_10007430 3300006186 Bacteria 4172
112 Ga0075369_10010979 3300006186 Bacteria 3553
113 Ga0075369_10024906 3300006186 Bacteria 2484
114 Ga0075369_10091481 3300006186 Bacteria 1358
115 Ga0075366_10015361 3300006195 Bacteria 4386
116 Ga0097621_100698497 3300006237 Bacteria 934
117 Ga0075370_10000004 3300006353 Bacteria 121166
118 Ga0075370_10017297 3300006353 Bacteria 3894
119 Ga0075370_10063490 3300006353 Bacteria 2106
120 Ga0075370_10066123 3300006353 Bacteria 2062
121 Ga0075429_100368822 3300006880 Bacteria 1257
122 Ga0097620_100001416 3300006931 Bacteria 24328
123 Ga0097620_100006388 3300006931 Bacteria 11959
124 Ga0097620_100042049 3300006931 Bacteria 4590
125 Ga0097620_100138381 3300006931 Bacteria 2508
126 Ga0079104_1044117 3300006946 Bacteria 1024
127 Ga0105251_10117856 3300009011 Bacteria 1207
128 Ga0105240_10077028 3300009093 Bacteria 4110
129 Ga0105240_10327247 3300009093 Bacteria 1745
130 Ga0105245_10261274 3300009098 Bacteria 1685
131 Ga0105247_10060490 3300009101 Bacteria 2347
132 Ga0105247_10233359 3300009101 Bacteria 1250
133 Ga0105247_10290639 3300009101 Bacteria 1130
134 Ga0105242_11552165 3300009176 Bacteria 694
135 Ga0105248_10043335 3300009177 Bacteria 5045
136 Ga0105248_10052852 3300009177 Bacteria 4559
137 Ga0105248_10293477 3300009177 Bacteria 1831
138 Ga0105248_10610630 3300009177 Bacteria 1230
139 Ga0105248_10959828 3300009177 Bacteria 965
140 Ga0105237_10002858 3300009545 Bacteria 20999
141 Ga0105237_10362718 3300009545 Bacteria 1453
142 Ga0105249_10352460 3300009553 Bacteria 1491
143 Ga0105249_11049980 3300009553 Bacteria 884
144 Ga0105239_10377514 3300010375 Bacteria 1602
145 Ga0105246_10461360 3300011119 Bacteria 1070
146 Ga0157326_1000431 3300012513 Bacteria 4985
147 Ga0157371_10022628 3300013102 Bacteria 4601
148 Ga0157371_10094239 3300013102 Bacteria 2122
149 Ga0157370_10677811 3300013104 Bacteria 942
150 Ga0163162_10207028 3300013306 Bacteria 2091
151 Ga0163163_10093123 3300014325 Bacteria 3029
152 Ga0163163_10151103 3300014325 Bacteria 2366
153 Ga0157380_10032640 3300014326 Bacteria 4007
154 Ga0157380_10184182 3300014326 Bacteria 1838
155 Ga0182008_10371231 3300014497 Bacteria 763
156 Ga0157379_10366262 3300014968 Bacteria 1321
157 Ga0163161_10062553 3300017792 Bacteria 2712
158 Ga0163161_10130698 3300017792 Bacteria 1894
159 Ga0206350_10208363 3300020080 Bacteria 819
160 Ga0213874_10021385 3300021377 Bacteria 1783
161 Ga0213875_10001918 3300021388 Bacteria 12881
162 Ga0213875_10008279 3300021388 Bacteria 5333
163 Ga0213875_10014923 3300021388 Bacteria 3784
164 Ga0213875_10039023 3300021388 Bacteria 2237
165 Ga0213875_10070517 3300021388 Bacteria 1631
166 Ga0213871_10012207 3300021441 Bacteria 1990
167 Ga0213871_10013452 3300021441 Bacteria 1923
168 Ga0209676_1000092 3300025292 Bacteria 250453
169 Ga0209050_1001064 3300025298 Bacteria 33727
170 Ga0209050_1040571 3300025298 Bacteria 1294
171 Ga0207697_10060257 3300025315 Bacteria 1578
172 Ga0207713_1023315 3300025735 Bacteria 2915
173 Ga0207710_10125321 3300025900 Bacteria 1230
174 Ga0207710_10225364 3300025900 Bacteria 932
175 Ga0207680_10040390 3300025903 Bacteria 2714
176 Ga0207680_10151589 3300025903 Bacteria 1546
177 Ga0207680_10379343 3300025903 Bacteria 997
178 Ga0207647_10009694 3300025904 Bacteria 6833
179 Ga0207647_10215776 3300025904 Bacteria 1107
180 Ga0207699_10321316 3300025906 Bacteria 1086
181 Ga0207705_10000009 3300025909 Bacteria 576128
182 Ga0207705_10025305 3300025909 Bacteria 4238
183 Ga0207705_10345673 3300025909 Bacteria 1145
184 Ga0207705_10811037 3300025909 Bacteria 726
185 Ga0207695_10055829 3300025913 Bacteria 4113
186 Ga0207695_10179522 3300025913 Bacteria 2038
187 Ga0207695_10254886 3300025913 Bacteria 1653
188 Ga0207671_10043377 3300025914 Bacteria 3326
189 Ga0207671_10358676 3300025914 Bacteria 1157
190 Ga0207693_10029783 3300025915 Bacteria 4309
191 Ga0207663_10603548 3300025916 Bacteria 862
192 Ga0207660_10377463 3300025917 Bacteria 1139
193 Ga0207657_10061755 3300025919 Bacteria 3211
194 Ga0207681_10000005 3300025923 Bacteria 555724
195 Ga0207681_10024084 3300025923 Bacteria 3902
196 Ga0207681_10024920 3300025923 Bacteria 3843
197 Ga0207681_10342072 3300025923 Bacteria 1195
198 Ga0207694_10017336 3300025924 Bacteria 5445
199 Ga0207694_10483360 3300025924 Bacteria 1036
200 Ga0207650_10000004 3300025925 Bacteria 743372
201 Ga0207700_10830337 3300025928 Bacteria 827
202 Ga0207664_10075173 3300025929 Bacteria 2731
203 Ga0207644_10000005 3300025931 Bacteria 441948
204 Ga0207644_10002200 3300025931 Bacteria 12646
205 Ga0207644_10291104 3300025931 Bacteria 1313
206 Ga0207644_10523860 3300025931 Bacteria 979
207 Ga0207709_10176594 3300025935 Bacteria 1504
208 Ga0207711_10007295 3300025941 Bacteria 9260
209 Ga0207711_10020060 3300025941 Bacteria 5571
210 Ga0207711_10023215 3300025941 Bacteria 5191
211 Ga0207711_10042359 3300025941 Bacteria 3879
212 Ga0207711_10196000 3300025941 Bacteria 1842
213 Ga0207711_10922948 3300025941 Bacteria 811
214 Ga0207667_10021256 3300025949 Bacteria 7193
215 Ga0207667_10113219 3300025949 Bacteria 2798
216 Ga0207667_10467319 3300025949 Bacteria 1281
217 Ga0207712_10077730 3300025961 Bacteria 2406
218 Ga0207668_10032423 3300025972 Bacteria 3452
219 Ga0207668_10038990 3300025972 Bacteria 3193
220 Ga0207668_10123359 3300025972 Bacteria 1965
221 Ga0207668_10338982 3300025972 Bacteria 1253
222 Ga0207640_10014726 3300025981 Bacteria 4508
223 Ga0207640_10055933 3300025981 Bacteria 2587
224 Ga0207640_10060540 3300025981 Bacteria 2503
225 Ga0207640_10146592 3300025981 Bacteria 1728
226 Ga0207658_10000064 3300025986 Bacteria 117779
227 Ga0207658_10002550 3300025986 Bacteria 13234
228 Ga0207658_10005381 3300025986 Bacteria 8790
229 Ga0207658_10022322 3300025986 Bacteria 4406
230 Ga0207658_10086347 3300025986 Bacteria 2419
231 Ga0207677_10696806 3300026023 Bacteria 901
232 Ga0207703_10041284 3300026035 Bacteria 3695
233 Ga0207703_10109804 3300026035 Bacteria 2352
234 Ga0207703_10287246 3300026035 Bacteria 1496
235 Ga0207703_10376093 3300026035 Bacteria 1313
236 Ga0207678_10091778 3300026067 Bacteria 2596
237 Ga0207702_10058181 3300026078 Bacteria 3289
238 Ga0207702_10182476 3300026078 Bacteria 1934
239 Ga0207702_10272141 3300026078 Bacteria 1598
240 Ga0207641_10000084 3300026088 Bacteria 133555
241 Ga0207641_10003421 3300026088 Bacteria 14060
242 Ga0207641_10026844 3300026088 Bacteria 4754
243 Ga0207641_10047020 3300026088 Bacteria 3638
244 Ga0207648_10855189 3300026089 Bacteria 848
245 Ga0207676_10000006 3300026095 Bacteria 681936
246 Ga0207676_10045268 3300026095 Bacteria 3399
247 Ga0207674_10099906 3300026116 Bacteria 2883
248 Ga0207674_10164362 3300026116 Bacteria 2174
249 Ga0207674_10349915 3300026116 Bacteria 1428
250 Ga0207674_10896968 3300026116 Bacteria 855
251 Ga0207675_100000157 3300026118 Bacteria 59865
252 Ga0207675_100001117 3300026118 Bacteria 26571
253 Ga0207683_10300692 3300026121 Bacteria 1468
254 Ga0207698_10000537 3300026142 Bacteria 22020
255 Ga0207698_10061955 3300026142 Bacteria 2918
256 Ga0207698_10495876 3300026142 Bacteria 1187
257 Ga0207698_11446527 3300026142 Bacteria 702
258 Ga0209813_10000047 3300027866 Bacteria 49657
259 Ga0207428_10020170 3300027907 Bacteria 5667
260 Ga0268266_10000879 3300028379 Bacteria 38938
261 Ga0268266_10023261 3300028379 Bacteria 5276
262 Ga0268266_10843184 3300028379 Bacteria 886
263 Ga0268266_10893062 3300028379 Bacteria 859
264 Ga0268265_10000001 3300028380 Bacteria 1230727
265 Ga0268265_10051345 3300028380 Bacteria 3112
266 Ga0268265_10076395 3300028380 Bacteria 2627
267 Ga0268264_10000253 3300028381 Bacteria 98587
268 Ga0268264_10000384 3300028381 Bacteria 63602
269 Ga0268264_10062575 3300028381 Bacteria 3125
270 Ga0268264_10103721 3300028381 Bacteria 2477
271 Ga0268264_10133809 3300028381 Bacteria 2202
272 Ga0265338_10008853 3300028800 Bacteria 12137
273 Ga0265338_10301074 3300028800 Bacteria 1166
274 Ga0265324_10004791 3300029957 Bacteria 5979
275 Ga0268256_1061693 3300030500 Bacteria 750
276 Ga0265328_10034096 3300031239 Bacteria 1885
277 Ga0265331_10000543 3300031250 Bacteria 34421
278 Ga0307513_10048601 3300031456 Bacteria 4603
279 Ga0307405_10431158 3300031731 Bacteria 1040
280 Ga0307413_10073593 3300031824 Bacteria 2160
281 Ga0307413_10183538 3300031824 Bacteria 1494
282 Ga0307410_10139679 3300031852 Bacteria 1790
283 Ga0307406_10692540 3300031901 Bacteria 850
284 Ga0307412_10001378 3300031911 Bacteria 13503
285 Ga0307412_10077699 3300031911 Bacteria 2284
286 Ga0307412_10269370 3300031911 Bacteria 1332
287 Ga0307412_10487847 3300031911 Bacteria 1023
288 Ga0307409_100065664 3300031995 Bacteria 2857
289 Ga0307416_100112421 3300032002 Bacteria 2403
290 Ga0307416_100489888 3300032002 Bacteria 1291
291 Ga0307416_100740185 3300032002 Bacteria 1075
292 Ga0307414_10094751 3300032004 Bacteria 2229
293 Ga0307414_10108978 3300032004 Bacteria 2103
294 Ga0307411_10151988 3300032005 Bacteria 1721
295 Ga0307411_10651396 3300032005 Bacteria 912
296 Ga0316593_10070083 3300032168 Bacteria 1212
297 Ga0373948_0046414 3300034817 Bacteria 923
298 Ga0373948_0079258 3300034817 Bacteria 747
299 Ga0373936_0065571 3300035113 Bacteria 1490
300 Ga0373953_0004557 3300035117 Bacteria 4422
301 Ga0373954_0040905 3300035118 Bacteria 2160
302 Ga0373957_0007801 3300035120 Bacteria 3439
303 Ga0373943_0053387 3300035170 Bacteria 1996
304 Ga0373946_0250961 3300035171 Bacteria 863
305 Ga0373924_0049234 3300035410 Bacteria 1743
306 Ga0373924_0071221 3300035410 Bacteria 1467
307 Ga0373931_0033785 3300035691 Bacteria 2652
308 Ga0373927_0134843 3300035695 Bacteria 1613
309 Ga0373927_0398801 3300035695 Bacteria 908
310 Ga0373933_0019715 3300035724 Bacteria 3815
311 Ga0373947_0036450 3300035725 Bacteria 2917
312 Ga0373937_0000922 3300036401 Bacteria 24939
313 Ga0373937_0061124 3300036401 Bacteria 3463
314 Ga0373937_0074325 3300036401 Bacteria 3136
315 Ga0373937_0144757 3300036401 Bacteria 2224
316 Ga0373925_0008231 3300037068 Bacteria 7590
317 Ga0373925_0095519 3300037068 Bacteria 2277
318 Ga0373925_0220977 3300037068 Bacteria 1512
319 Ga0373925_0270235 3300037068 Bacteria 1367
320 Ga0436364_0000682 3300037853 Bacteria 2241
321 Ga0436364_0026312 3300037853 Bacteria 5505
322 Ga0436364_0052675 3300037853 Bacteria 2449
323 Ga0436364_0242204 3300037853 Bacteria 1864
324 Ga0436364_0389284 3300037853 Bacteria 5767
325 Ga0436364_0586291 3300037853 Bacteria 97560
326 Ga0436364_0727247 3300037853 Bacteria 1283
327 Ga0436364_0866406 3300037853 Bacteria 4069
328 Ga0436364_1453650 3300037853 Bacteria 1031
329 Ga0436365_0340931 3300039437 Bacteria 1168
330 Ga0436365_0599891 3300039437 Bacteria 2660
331 Ga0436365_0636449 3300039437 Bacteria 2343
332 Ga0436365_1337727 3300039437 Bacteria 1310
333 Ga0436365_1915576 3300039437 Bacteria 1400
334 Ga0436360_0333232 3300039438 Bacteria 5402
335 Ga0436360_0452772 3300039438 Bacteria 2288
336 Ga0436360_0639768 3300039438 Bacteria 2249
337 Ga0436360_0712409 3300039438 Bacteria 2297
338 Ga0436360_0851339 3300039438 Bacteria 1036
339 Ga0436360_1332781 3300039438 Bacteria 3795
340 Ga0436361_0278088 3300039447 Bacteria 3953
341 Ga0436361_0718732 3300039447 Bacteria 1769
342 Ga0436361_0808720 3300039447 Bacteria 911
343 Ga0436361_0907344 3300039447 Bacteria 1338
344 Ga0436361_1156340 3300039447 Unclassified 1782
345 Ga0436363_0130967 3300039450 Bacteria 1391
346 Ga0436363_0301585 3300039450 Bacteria 2291
347 Ga0436363_0409499 3300039450 Bacteria 1473
348 Ga0436363_1180028 3300039450 Bacteria 1043
349 Ga0436362_0446646 3300039453 Bacteria 2374
350 Ga0436362_0558767 3300039453 Bacteria 1205
351 Ga0436362_1070743 3300039453 Bacteria 1881
352 Ga0451841_1147862 3300041498 Bacteria 1077
353 Ga0451853_3234207 3300041512 Bacteria 1799
354 Ga0451577_0018151 3300042876 Bacteria 6483
355 Ga0466963_0193871 3300044694 Bacteria 1420
356 Ga0453684_0811091 3300044712 Bacteria 1009
357 Ga0451576_0273618 3300045051 Bacteria 1766
358 Ga0466958_0184377 3300045836 Bacteria 1325
359 Ga0466958_0260636 3300045836 Bacteria 1110
360 Ga0466967_0600243 3300045976 Bacteria 1086
361 Ga0495617_028132 3300046452 Bacteria 1890
362 Ga0495627_001182 3300046453 Bacteria 16582
363 Ga0495592_0089301 3300046454 Bacteria 2214
364 Ga0495629_0482080 3300046459 Bacteria 838
365 Ga0495638_0000012 3300046460 Bacteria 435577
366 Ga0495638_0001566 3300046460 Bacteria 20510
367 Ga0495638_0163241 3300046460 Bacteria 1284
368 Ga0495638_0174766 3300046460 Bacteria 1230
369 Ga0495651_0078288 3300046462 Bacteria 2501
370 Ga0495651_0246566 3300046462 Bacteria 1222
371 Ga0495653_0213658 3300046463 Bacteria 1301
372 Ga0495650_0018352 3300046471 Bacteria 3477
373 Ga0495582_0290773 3300046473 Bacteria 939
374 Ga0495664_0026792 3300046477 Bacteria 3358
375 Ga0495594_0334035 3300046499 Bacteria 863
376 Ga0495596_0000054 3300046500 Bacteria 83068
377 Ga0495596_0007788 3300046500 Bacteria 4806
378 Ga0495583_0006701 3300046506 Bacteria 7462
379 Ga0495583_0191574 3300046506 Bacteria 834
380 Ga0495606_0131411 3300046507 Bacteria 1488
381 Ga0495608_0025697 3300046511 Bacteria 4020
382 Ga0495608_0063375 3300046511 Bacteria 2426
383 Ga0495610_0000033 3300046512 Bacteria 204151
384 Ga0495610_0002336 3300046512 Bacteria 16035
385 Ga0495610_0023572 3300046512 Bacteria 3341
386 Ga0495616_0000390 3300046513 Bacteria 34071
387 Ga0495618_0453623 3300046514 Bacteria 778
388 Ga0495620_0016521 3300046515 Bacteria 3700
389 Ga0495628_0085528 3300046516 Bacteria 2446
390 Ga0495631_0218280 3300046518 Bacteria 814
391 Ga0495632_0004429 3300046519 Bacteria 9546
392 Ga0495632_0111602 3300046519 Bacteria 1283
393 Ga0495632_0290779 3300046519 Bacteria 726
394 Ga0495643_0018247 3300046522 Bacteria 4082
395 Ga0495643_0019518 3300046522 Bacteria 3920
396 Ga0495648_0000038 3300046524 Bacteria 191612
397 Ga0495640_0031131 3300046533 Bacteria 3811
398 Ga0495587_0045036 3300046536 Bacteria 2623
399 Ga0495609_0078741 3300046538 Bacteria 1442
400 Ga0495597_0015301 3300046542 Bacteria 3634
401 Ga0495645_0006077 3300046543 Bacteria 8353
402 Ga0495622_0039363 3300046557 Bacteria 2202
403 Ga0495633_0015715 3300046558 Bacteria 3923
404 Ga0495633_0221524 3300046558 Bacteria 866
405 Ga0495667_0047390 3300046559 Bacteria 2840
406 Ga0495667_0145498 3300046559 Bacteria 1527
407 Ga0495668_0080044 3300046616 Bacteria 1793
408 Ga0495668_0107355 3300046616 Bacteria 1527
409 Ga0495625_0068887 3300046660 Bacteria 2486
410 Ga0495635_0033840 3300046663 Bacteria 3545
411 Ga0495635_0128144 3300046663 Bacteria 1730
412 Ga0495657_0110681 3300046675 Bacteria 1740
413 Ga0495599_0382309 3300046678 Bacteria 840
414 Ga0495646_0115336 3300046680 Bacteria 1525
415 Ga0495658_0229094 3300046683 Bacteria 1165
416 Ga0495671_0000034 3300046692 Bacteria 195385
417 Ga0495671_0008086 3300046692 Bacteria 5938
418 Ga0495671_0356557 3300046692 Bacteria 701
419 Ga0495600_0321218 3300046809 Bacteria 973
420 Ga0495680_0343730 3300047322 Bacteria 1040
421 Ga0495687_112923 3300047443 Bacteria 995
422 Ga0495675_0014092 3300047444 Bacteria 5054
423 Ga0495673_0000013 3300047469 Bacteria 612902
424 Ga0495681_0000360 3300047470 Bacteria 35550
425 Ga0495684_0030744 3300047471 Bacteria 4123
426 Ga0495684_0107081 3300047471 Bacteria 2112
427 Ga0495684_0302264 3300047471 Bacteria 1149
428 Ga0495593_0336938 3300047673 Bacteria 754
429 Ga0495602_0000485 3300048088 Bacteria 36933
430 Ga0495615_0000152 3300048090 Bacteria 17446
431 Ga0495626_0000356 3300048091 Bacteria 47831
432 Ga0496100_0031287 3300048903 Bacteria 3307
433 Ga0496101_0153248 3300048904 Bacteria 1764
434 Ga0496102_0038393 3300048905 Bacteria 4321
435 Ga0496103_0018485 3300048906 Bacteria 4180
436 Ga0496103_0036159 3300048906 Bacteria 3024
437 Ga0496103_0291843 3300048906 Bacteria 1049
438 Ga0496104_0037438 3300048907 Bacteria 4537
439 Ga0496104_0145578 3300048907 Bacteria 2275
440 Ga0496105_0040695 3300048908 Bacteria 3832
441 Ga0496106_0004127 3300048909 Bacteria 10825
442 Ga0496107_0005217 3300048910 Bacteria 8870
443 Ga0496108_0017449 3300048911 Bacteria 5873
444 Ga0496108_0289760 3300048911 Bacteria 1425
445 Ga0496109_0151602 3300048912 Bacteria 2170
446 Ga0496109_0353578 3300048912 Bacteria 1388
447 Ga0496109_0546009 3300048912 Bacteria 1093
448 Ga0496110_0032770 3300048913 Bacteria 4491
449 Ga0496110_0059519 3300048913 Bacteria 3367
450 Ga0496111_0056586 3300048914 Bacteria 2837
451 Ga0496111_0099018 3300048914 Bacteria 2141
452 Ga0496112_0324546 3300048915 Bacteria 1483
453 Ga0496113_0011540 3300048916 Bacteria 5901
454 Ga0496113_0693574 3300048916 Bacteria 813
455 Ga0496114_0020434 3300048917 Bacteria 5375
456 Ga0496115_0703053 3300048918 Bacteria 794
457 Ga0496116_0000035 3300048919 Bacteria 402424
458 Ga0496117_0002537 3300048920 Bacteria 22802
459 Ga0496118_0051401 3300048921 Bacteria 3153
460 Ga0496118_0052343 3300048921 Bacteria 3115
461 Ga0496118_0056128 3300048921 Bacteria 2963
462 Ga0496119_0014326 3300048922 Bacteria 6218
463 Ga0496119_0041645 3300048922 Bacteria 2922
464 Ga0496120_0022737 3300048923 Bacteria 3941
465 Ga0496120_0141626 3300048923 Bacteria 1220
466 Ga0496120_0284805 3300048923 Bacteria 762
467 Ga0496121_0000031 3300048924 Bacteria 384119
468 Ga0496121_0000136 3300048924 Bacteria 165350
469 Ga0496121_0005190 3300048924 Bacteria 16883
470 Ga0496121_0040965 3300048924 Bacteria 4055
471 Ga0496122_0008028 3300048925 Bacteria 11524
472 Ga0496122_0009631 3300048925 Bacteria 10115
473 Ga0496122_0111886 3300048925 Bacteria 1789
474 Ga0496123_0003623 3300048926 Bacteria 17095
475 Ga0496123_0085572 3300048926 Bacteria 1896
476 Ga0496123_0091203 3300048926 Bacteria 1808
477 Ga0496123_0128746 3300048926 Bacteria 1407
478 Ga0496124_0005247 3300048927 Bacteria 14676
479 Ga0496124_0005829 3300048927 Bacteria 13673
480 Ga0496124_0068836 3300048927 Bacteria 2940
481 Ga0496124_0241315 3300048927 Bacteria 1343
482 Ga0496125_0018829 3300048928 Bacteria 6538
483 Ga0496125_0024671 3300048928 Bacteria 5523
484 Ga0496126_0000084 3300048929 Bacteria 217111
485 Ga0496126_0058301 3300048929 Bacteria 3481
486 Ga0496126_0124609 3300048929 Bacteria 2231
487 Ga0496126_0148093 3300048929 Bacteria 2014
488 Ga0496126_0545030 3300048929 Bacteria 921
489 Ga0501310_009069 3300049130 Bacteria 1090
490 Ga0501307_002308 3300049162 Bacteria 1760
491 Ga0501311_011720 3300049527 Bacteria 1085
492 Ga0501312_010889 3300049528 Bacteria 1226
493 Ga0501318_013220 3300049534 Bacteria 956
494 Ga0501318_019557 3300049534 Bacteria 846
495 Ga0501324_031777 3300049540 Bacteria 579
496 Ga0501034_0310441 3300049571 Bacteria 1512
497 Ga0501038_0153974 3300049574 Bacteria 1873
498 Ga0501038_0612680 3300049574 Bacteria 823
499 Ga0501039_0110912 3300049575 Bacteria 2145
500 Ga0501041_0079160 3300049577 Bacteria 2023
501 Ga0501047_0541197 3300049581 Bacteria 989
502 Ga0501071_0068245 3300049587 Bacteria 2587
503 Ga0501075_0057064 3300049591 Bacteria 2940
504 Ga0501075_0159159 3300049591 Bacteria 1723
505 Ga0501076_0023871 3300049592 Bacteria 4718
506 Ga0501077_0030811 3300049593 Bacteria 3414
507 Ga0501253_010293 3300049683 Bacteria 1404
508 Ga0501079_0471340 3300049741 Bacteria 986
509 Ga0501080_0144875 3300049742 Bacteria 2196
510 Ga0501080_0600744 3300049742 Bacteria 977
511 Ga0501035_0701899 3300049822 Bacteria 816
512 Ga0501035_0817170 3300049822 Bacteria 744
513 Ga0501044_0021221 3300049823 Bacteria 6933
514 Ga0501044_0614444 3300049823 Bacteria 979
515 nmdc:mga03683_129576_c1 3300050489 Bacteria 1127
516 nmdc:mga03683_31_c1 3300050489 Bacteria 69502
517 nmdc:mga03683_86394_c1 3300050489 Bacteria 1362
518 nmdc:mga03n38_4566_c1 3300050490 Bacteria 4608
519 nmdc:mga03n38_78102_c1 3300050490 Bacteria 1549
520 nmdc:mga00v17_131476_c1 3300050491 Bacteria 1600
521 nmdc:mga00v17_195100_c1 3300050491 Bacteria 1308
522 nmdc:mga00v17_3048_c1 3300050491 Bacteria 8615
523 nmdc:mga00v17_4783_c1 3300050491 Bacteria 3192
524 nmdc:mga0yw44_172505_c1 3300050492 Bacteria 1421
525 nmdc:mga0k408_18_c1 3300050493 Bacteria 112318
526 nmdc:mga0k408_52034_c1 3300050493 Bacteria 2373
527 nmdc:mga0k408_77479_c1 3300050493 Bacteria 1944
528 nmdc:mga06z11_517_c1 3300050494 Bacteria 14236
529 nmdc:mga04h51_91_c1 3300050495 Bacteria 28026
530 nmdc:mga07m45_12983_c1 3300050496 Bacteria 4406
531 nmdc:mga07m45_164_c1 3300050496 Bacteria 26629
532 nmdc:mga07m45_19_c1 3300050496 Bacteria 133476
533 nmdc:mga0sz30_10969_c1 3300050516 Bacteria 3486
534 nmdc:mga0sz30_132684_c1 3300050516 Bacteria 1098
535 nmdc:mga0sz30_163581_c1 3300050516 Bacteria 986
536 nmdc:mga0sz30_167_c1 3300050516 Bacteria 24409
537 nmdc:mga0sz30_6381_c2 3300050516 Bacteria 3871
538 Ga0495601_0005148 3300053077 Bacteria 7599
539 Ga0495612_0001186 3300053078 Bacteria 10745
540 Ga0495595_0114179 3300053084 Bacteria 1312
541 Ga0495619_0008993 3300053085 Bacteria 6303
542 Ga0500643_030855 3300053087 Bacteria 1638
543 Ga0500647_0116128 3300053091 Bacteria 1269
544 Ga0500562_045321 3300053108 Bacteria 1172
545 Ga0500594_0005507 3300053118 Bacteria 2809
546 Ga0500595_068569 3300053119 Bacteria 1056
547 Ga0500607_005191 3300053121 Bacteria 8593
548 Ga0500607_010159 3300053121 Bacteria 5622
549 Ga0500608_000284 3300053122 Bacteria 19721
550 Ga0500618_012335 3300053125 Bacteria 2239
551 Ga0500655_000570 3300053133 Bacteria 7397
552 Ga0500559_0022505 3300053136 Bacteria 2672
553 Ga0500559_0054969 3300053136 Bacteria 1764
554 Ga0500564_002258 3300053138 Bacteria 7055
555 Ga0500568_0092028 3300053139 Bacteria 1143
556 Ga0500590_003606 3300053148 Bacteria 7176
557 Ga0500590_096832 3300053148 Bacteria 1423
558 Ga0500604_0076435 3300053151 Bacteria 1076
559 Ga0500622_0002768 3300053156 Bacteria 12339
560 Ga0500627_0072415 3300053158 Bacteria 1528
561 Ga0500637_0226026 3300053178 Bacteria 1056
562 Ga0500567_003882 3300053723 Bacteria 6741
563 Ga0500625_000002 3300053729 Bacteria 371909
564 Ga0500645_004674 3300053730 Bacteria 5209
565 Ga0500645_008472 3300053730 Bacteria 3510
566 Ga0587070_001986 3300059491 Bacteria 2238
567 Ga0587077_000001 3300059493 Bacteria 12872
568 Ga0587082_000512 3300059504 Bacteria 3301
569 Ga0587085_003253 3300059506 Bacteria 1747
570 Ga0587086_003087 3300059507 Bacteria 1644
571 Ga0587090_000037 3300059510 Bacteria 7126
572 Ga0587072_003713 3300059643 Bacteria 2167
573 Ga0587076_002352 3300059645 Bacteria 2107
574 Ga0587111_0028178 3300060346 Bacteria 1130
575 Ga0530510_0039009 3300061734 Bacteria 3429

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100123572 Ga0068857_1001235723 170
2 3300009545 Ga0105237_10002858 Ga0105237_1000285824 170
3 3300025914 Ga0207671_10043377 Ga0207671_100433772 170
4 3300025981 Ga0207640_10146592 Ga0207640_101465922 170
5 3300026116 Ga0207674_10099906 Ga0207674_100999063 170
6 3300048925 Ga0496122_0111886 Ga0496122_0111886_1003_1629 170
7 3300049540 Ga0501324_031777 Ga0501324_031777_33_548 170
8 3300039437 Ga0436365_0340931 Ga0436365_0340931_529_1158 174
9 3300048926 Ga0496123_0091203 Ga0496123_0091203_591_1217 175
10 3300048927 Ga0496124_0005829 Ga0496124_0005829_12457_13083 175
11 3300005335 Ga0070666_10204101 Ga0070666_102041013 177
12 3300005367 Ga0070667_100000088 Ga0070667_10000008857 177
13 3300005841 Ga0068863_100008669 Ga0068863_1000086692 177
14 3300005843 Ga0068860_100000220 Ga0068860_10000022037 177
15 3300025903 Ga0207680_10151589 Ga0207680_101515892 177
16 3300025986 Ga0207658_10000064 Ga0207658_1000006460 177
17 3300026088 Ga0207641_10003421 Ga0207641_100034212 177
18 3300028381 Ga0268264_10000384 Ga0268264_100003843 177
19 3300031911 Ga0307412_10077699 Ga0307412_100776994 177
20 3300032002 Ga0307416_100489888 Ga0307416_1004898883 177
21 3300048923 Ga0496120_0284805 Ga0496120_0284805_58_684 177
22 3300048927 Ga0496124_0241315 Ga0496124_0241315_564_1190 177
23 3300006237 Ga0097621_100698497 Ga0097621_1006984972 179
24 3300046542 Ga0495597_0015301 Ga0495597_0015301_229_855 181
25 3300009101 Ga0105247_10290639 Ga0105247_102906392 182
26 3300009553 Ga0105249_10352460 Ga0105249_103524602 182
27 3300005578 Ga0068854_100009263 Ga0068854_10000926310 183
28 3300012513 Ga0157326_1000431 Ga0157326_10004315 183
29 3300025981 Ga0207640_10060540 Ga0207640_100605403 183
30 3300035170 Ga0373943_0053387 Ga0373943_0053387_943_1569 183
31 3300046522 Ga0495643_0019518 Ga0495643_0019518_2491_3117 183
32 3300046616 Ga0495668_0107355 Ga0495668_0107355_332_958 183
33 3300048928 Ga0496125_0018829 Ga0496125_0018829_2820_3446 183
34 3300053125 Ga0500618_012335 Ga0500618_012335_211_837 183
35 3300053133 Ga0500655_000570 Ga0500655_000570_4495_5121 183
36 3300053148 Ga0500590_003606 Ga0500590_003606_2080_2706 183
37 3300006353 Ga0075370_10063490 Ga0075370_100634901 186
38 3300006051 Ga0075364_10001520 Ga0075364_1000152021 188
39 3300006177 Ga0075362_10085808 Ga0075362_100858082 188
40 3300006186 Ga0075369_10010979 Ga0075369_100109793 188
41 3300050489 nmdc:mga03683_86394_c1 nmdc:mga03683_86394_c1_497_1123 188
42 3300050491 nmdc:mga00v17_4783_c1 nmdc:mga00v17_4783_c1_390_1016 188
43 3300050516 nmdc:mga0sz30_10969_c1 nmdc:mga0sz30_10969_c1_1214_1840 188
44 3300014968 Ga0157379_10366262 Ga0157379_103662622 189
45 3300002459 JGI24751J29686_10000325 JGI24751J29686_100003259 190
46 3300005295 Ga0065707_10007537 Ga0065707_100075375 190
47 3300005331 Ga0070670_100024275 Ga0070670_1000242759 190
48 3300005347 Ga0070668_100352101 Ga0070668_1003521012 190
49 3300005367 Ga0070667_100019254 Ga0070667_1000192545 190
50 3300005617 Ga0068859_100006387 Ga0068859_1000063879 190
51 3300005618 Ga0068864_100014199 Ga0068864_1000141994 190
52 3300005719 Ga0068861_100002700 Ga0068861_1000027006 190
53 3300005844 Ga0068862_100000126 Ga0068862_10000012610 190
54 3300006931 Ga0097620_100006388 Ga0097620_1000063889 190
55 3300009177 Ga0105248_10052852 Ga0105248_100528524 190
56 3300013306 Ga0163162_10207028 Ga0163162_102070282 190
57 3300014325 Ga0163163_10093123 Ga0163163_100931233 190
58 3300014326 Ga0157380_10032640 Ga0157380_100326404 190
59 3300017792 Ga0163161_10130698 Ga0163161_101306981 190
60 3300025903 Ga0207680_10379343 Ga0207680_103793432 190
61 3300025923 Ga0207681_10000005 Ga0207681_1000000571 190
62 3300025925 Ga0207650_10000004 Ga0207650_10000004650 190
63 3300025972 Ga0207668_10123359 Ga0207668_101233592 190
64 3300025986 Ga0207658_10005381 Ga0207658_100053816 190
65 3300026095 Ga0207676_10000006 Ga0207676_1000000662 190
66 3300026118 Ga0207675_100001117 Ga0207675_10000111732 190
67 3300028380 Ga0268265_10000001 Ga0268265_100000011116 190
68 3300049591 Ga0501075_0057064 Ga0501075_0057064_1093_1677 193
69 3300061734 Ga0530510_0039009 Ga0530510_0039009_2121_2705 193
70 3300001979 JGI24740J21852_10008905 JGI24740J21852_100089052 195
71 3300031911 Ga0307412_10001378 Ga0307412_1000137817 195
72 3300049571 Ga0501034_0310441 Ga0501034_0310441_812_1462 197
73 3300049581 Ga0501047_0541197 Ga0501047_0541197_239_892 198
74 3300049742 Ga0501080_0144875 Ga0501080_0144875_1426_2079 198
75 3300053121 Ga0500607_005191 Ga0500607_005191_2012_2638 198
76 3300053136 Ga0500559_0054969 Ga0500559_0054969_355_981 198
77 3300053148 Ga0500590_096832 Ga0500590_096832_385_1011 198
78 3300053178 Ga0500637_0226026 Ga0500637_0226026_94_720 198
79 3300053730 Ga0500645_004674 Ga0500645_004674_2352_2978 198
80 iso_pu_bacteria 2830075706 2830079060 199
81 iso_pu_bacteria 2842775625 2842778814 200
82 iso_pu_bacteria 2894772417 2894774429 200
83 iso_pu_bacteria 2929199973 2929200704 200
84 iso_pu_bacteria 8055909800 8055913921 200
85 3300035118 Ga0373954_0040905 Ga0373954_0040905_391_1032 201
86 3300025928 Ga0207700_10830337 Ga0207700_108303372 202
87 3300005456 Ga0070678_100149989 Ga0070678_1001499894 203
88 3300011119 Ga0105246_10461360 Ga0105246_104613602 203
89 3300021388 Ga0213875_10008279 Ga0213875_100082796 203
90 3300021441 Ga0213871_10013452 Ga0213871_100134524 203
91 3300025909 Ga0207705_10345673 Ga0207705_103456732 203
92 3300026023 Ga0207677_10696806 Ga0207677_106968061 203
93 3300026121 Ga0207683_10300692 Ga0207683_103006922 203
94 3300037853 Ga0436364_0866406 Ga0436364_0866406_2436_3071 203
95 3300037853 Ga0436364_1453650 Ga0436364_1453650_344_958 203
96 3300039438 Ga0436360_0712409 Ga0436360_0712409_1501_2115 203
97 3300039438 Ga0436360_0851339 Ga0436360_0851339_24_638 203
98 3300039447 Ga0436361_0808720 Ga0436361_0808720_212_826 203
99 3300039447 Ga0436361_1156340 Ga0436361_1156340_447_1061 203
100 3300039450 Ga0436363_0130967 Ga0436363_0130967_378_992 203
101 3300039450 Ga0436363_1180028 Ga0436363_1180028_233_847 203
102 3300046511 Ga0495608_0063375 Ga0495608_0063375_1062_1706 203
103 3300046514 Ga0495618_0453623 Ga0495618_0453623_58_702 203
104 3300046663 Ga0495635_0033840 Ga0495635_0033840_870_1514 203
105 3300047443 Ga0495687_112923 Ga0495687_112923_215_841 203
106 3300047471 Ga0495684_0030744 Ga0495684_0030744_3438_4082 203
107 3300053091 Ga0500647_0116128 Ga0500647_0116128_281_907 203
108 3300053122 Ga0500608_000284 Ga0500608_000284_1127_1753 203
109 3300053136 Ga0500559_0022505 Ga0500559_0022505_36_662 203
110 3300053138 Ga0500564_002258 Ga0500564_002258_527_1153 203
111 3300053723 Ga0500567_003882 Ga0500567_003882_4464_5090 203
112 3300053729 Ga0500625_000002 Ga0500625_000002_215186_215812 203
113 iso_pu_bacteria 2582581305 2585262490 203
114 iso_pu_bacteria 2599185359 2600225732 203
115 iso_pu_bacteria 2643221541 2643729045 203
116 iso_pu_bacteria 2643221605 2644039620 203
117 iso_pu_bacteria 2643221606 2644045058 203
118 iso_pu_bacteria 2643221671 2644391231 203
119 iso_pu_bacteria 2818991466 2819716466 203
120 iso_pu_bacteria 2848297114 2848298229 203
121 iso_pu_bacteria 2879163058 2879165249 203
122 iso_pu_bacteria 2882806704 2882808227 203
123 iso_pu_bacteria 2895880812 2895882713 203
124 iso_pu_bacteria 2928027323 2928028504 203
125 iso_pu_bacteria 2928526807 2928528725 203
126 iso_pu_bacteria 2928968154 2928970277 203
127 iso_pu_bacteria 2984555340 2984555920 203
128 iso_pu_bacteria 2984564862 2984565974 203
129 iso_pu_bacteria 2993356040 2993356983 203
130 3300003203 JGI25406J46586_10001890 JGI25406J46586_1000189019 204
131 3300003781 Ga0055536_1007883 Ga0055536_10078833 204
132 3300004803 Ga0058862_12358730 Ga0058862_123587303 204
133 3300005329 Ga0070683_100606046 Ga0070683_1006060462 204
134 3300005336 Ga0070680_100205764 Ga0070680_1002057643 204
135 3300005435 Ga0070714_100029929 Ga0070714_1000299292 204
136 3300005436 Ga0070713_100001675 Ga0070713_10000167524 204
137 3300005436 Ga0070713_100070192 Ga0070713_1000701924 204
138 3300005436 Ga0070713_100389647 Ga0070713_1003896472 204
139 3300005439 Ga0070711_100263075 Ga0070711_1002630752 204
140 3300005439 Ga0070711_100578006 Ga0070711_1005780062 204
141 3300005548 Ga0070665_101072993 Ga0070665_1010729931 204
142 3300005614 Ga0068856_100242910 Ga0068856_1002429103 204
143 3300005614 Ga0068856_100549835 Ga0068856_1005498353 204
144 3300005616 Ga0068852_100563934 Ga0068852_1005639342 204
145 3300005985 Ga0081539_10000072 Ga0081539_100000724 204
146 3300006028 Ga0070717_10085206 Ga0070717_100852062 204
147 3300006028 Ga0070717_10179677 Ga0070717_101796772 204
148 3300006175 Ga0070712_100004619 Ga0070712_1000046192 204
149 3300006186 Ga0075369_10091481 Ga0075369_100914812 204
150 3300009098 Ga0105245_10261274 Ga0105245_102612742 204
151 3300009176 Ga0105242_11552165 Ga0105242_115521651 204
152 3300010375 Ga0105239_10377514 Ga0105239_103775141 204
153 3300014325 Ga0163163_10151103 Ga0163163_101511032 204
154 3300014497 Ga0182008_10371231 Ga0182008_103712311 204
155 3300020080 Ga0206350_10208363 Ga0206350_102083631 204
156 3300021388 Ga0213875_10014923 Ga0213875_100149232 204
157 3300021441 Ga0213871_10012207 Ga0213871_100122072 204
158 3300025292 Ga0209676_1000092 Ga0209676_10000924 204
159 3300025298 Ga0209050_1040571 Ga0209050_10405713 204
160 3300025906 Ga0207699_10321316 Ga0207699_103213163 204
161 3300025915 Ga0207693_10029783 Ga0207693_100297834 204
162 3300025916 Ga0207663_10603548 Ga0207663_106035481 204
163 3300025917 Ga0207660_10377463 Ga0207660_103774633 204
164 3300025924 Ga0207694_10483360 Ga0207694_104833602 204
165 3300025929 Ga0207664_10075173 Ga0207664_100751734 204
166 3300025941 Ga0207711_10020060 Ga0207711_100200607 204
167 3300026078 Ga0207702_10272141 Ga0207702_102721413 204
168 3300026089 Ga0207648_10855189 Ga0207648_108551892 204
169 3300026116 Ga0207674_10896968 Ga0207674_108969682 204
170 3300026142 Ga0207698_10495876 Ga0207698_104958763 204
171 3300028379 Ga0268266_10893062 Ga0268266_108930622 204
172 3300028800 Ga0265338_10008853 Ga0265338_100088534 204
173 3300028800 Ga0265338_10301074 Ga0265338_103010742 204
174 3300029957 Ga0265324_10004791 Ga0265324_100047913 204
175 3300031239 Ga0265328_10034096 Ga0265328_100340963 204
176 3300031250 Ga0265331_10000543 Ga0265331_1000054350 204
177 3300032004 Ga0307414_10108978 Ga0307414_101089782 204
178 3300032168 Ga0316593_10070083 Ga0316593_100700832 204
179 3300035113 Ga0373936_0065571 Ga0373936_0065571_729_1382 204
180 3300035117 Ga0373953_0004557 Ga0373953_0004557_1021_1671 204
181 3300035120 Ga0373957_0007801 Ga0373957_0007801_998_1648 204
182 3300035171 Ga0373946_0250961 Ga0373946_0250961_184_837 204
183 3300035410 Ga0373924_0049234 Ga0373924_0049234_324_977 204
184 3300035410 Ga0373924_0071221 Ga0373924_0071221_750_1388 204
185 3300035695 Ga0373927_0134843 Ga0373927_0134843_269_919 204
186 3300035695 Ga0373927_0398801 Ga0373927_0398801_155_802 204
187 3300035724 Ga0373933_0019715 Ga0373933_0019715_768_1418 204
188 3300035725 Ga0373947_0036450 Ga0373947_0036450_274_924 204
189 3300036401 Ga0373937_0000922 Ga0373937_0000922_19519_20169 204
190 3300036401 Ga0373937_0061124 Ga0373937_0061124_476_1129 204
191 3300036401 Ga0373937_0074325 Ga0373937_0074325_1276_1914 204
192 3300036401 Ga0373937_0144757 Ga0373937_0144757_814_1461 204
193 3300037068 Ga0373925_0008231 Ga0373925_0008231_6254_6904 204
194 3300037068 Ga0373925_0095519 Ga0373925_0095519_1071_1724 204
195 3300037068 Ga0373925_0220977 Ga0373925_0220977_82_732 204
196 3300037068 Ga0373925_0270235 Ga0373925_0270235_44_682 204
197 3300037853 Ga0436364_0000682 Ga0436364_0000682_188_817 204
198 3300037853 Ga0436364_0586291 Ga0436364_0586291_1308_2000 204
199 3300039437 Ga0436365_1337727 Ga0436365_1337727_308_937 204
200 3300039437 Ga0436365_1915576 Ga0436365_1915576_558_1268 204
201 3300039438 Ga0436360_0452772 Ga0436360_0452772_751_1416 204
202 3300039438 Ga0436360_0639768 Ga0436360_0639768_1075_1737 204
203 3300039438 Ga0436360_1332781 Ga0436360_1332781_1635_2300 204
204 3300039447 Ga0436361_0278088 Ga0436361_0278088_3256_3903 204
205 3300039447 Ga0436361_0718732 Ga0436361_0718732_158_820 204
206 3300039447 Ga0436361_0907344 Ga0436361_0907344_341_1003 204
207 3300039450 Ga0436363_0301585 Ga0436363_0301585_1055_1672 204
208 3300039453 Ga0436362_0558767 Ga0436362_0558767_174_917 204
209 3300039453 Ga0436362_1070743 Ga0436362_1070743_345_1007 204
210 3300044694 Ga0466963_0193871 Ga0466963_0193871_238_858 204
211 3300045836 Ga0466958_0184377 Ga0466958_0184377_611_1270 204
212 3300045836 Ga0466958_0260636 Ga0466958_0260636_244_972 204
213 3300045976 Ga0466967_0600243 Ga0466967_0600243_369_989 204
214 3300046454 Ga0495592_0089301 Ga0495592_0089301_943_1593 204
215 3300046459 Ga0495629_0482080 Ga0495629_0482080_130_768 204
216 3300046462 Ga0495651_0078288 Ga0495651_0078288_1372_2025 204
217 3300046462 Ga0495651_0246566 Ga0495651_0246566_50_700 204
218 3300046463 Ga0495653_0213658 Ga0495653_0213658_150_788 204
219 3300046473 Ga0495582_0290773 Ga0495582_0290773_46_696 204
220 3300046477 Ga0495664_0026792 Ga0495664_0026792_1534_2184 204
221 3300046499 Ga0495594_0334035 Ga0495594_0334035_136_786 204
222 3300046511 Ga0495608_0025697 Ga0495608_0025697_2182_2832 204
223 3300046516 Ga0495628_0085528 Ga0495628_0085528_163_813 204
224 3300046533 Ga0495640_0031131 Ga0495640_0031131_672_1322 204
225 3300046536 Ga0495587_0045036 Ga0495587_0045036_1792_2442 204
226 3300046543 Ga0495645_0006077 Ga0495645_0006077_6249_6899 204
227 3300046559 Ga0495667_0047390 Ga0495667_0047390_904_1554 204
228 3300046559 Ga0495667_0145498 Ga0495667_0145498_33_686 204
229 3300046663 Ga0495635_0128144 Ga0495635_0128144_300_950 204
230 3300046675 Ga0495657_0110681 Ga0495657_0110681_758_1408 204
231 3300046678 Ga0495599_0382309 Ga0495599_0382309_161_811 204
232 3300046680 Ga0495646_0115336 Ga0495646_0115336_214_864 204
233 3300046683 Ga0495658_0229094 Ga0495658_0229094_443_1093 204
234 3300046809 Ga0495600_0321218 Ga0495600_0321218_79_729 204
235 3300047322 Ga0495680_0343730 Ga0495680_0343730_15_668 204
236 3300047444 Ga0495675_0014092 Ga0495675_0014092_2425_3075 204
237 3300047471 Ga0495684_0107081 Ga0495684_0107081_1329_1982 204
238 3300047471 Ga0495684_0302264 Ga0495684_0302264_186_836 204
239 3300047673 Ga0495593_0336938 Ga0495593_0336938_66_716 204
240 3300048088 Ga0495602_0000485 Ga0495602_0000485_26291_26941 204
241 3300048912 Ga0496109_0353578 Ga0496109_0353578_312_932 204
242 3300048922 Ga0496119_0014326 Ga0496119_0014326_1221_1883 204
243 3300048929 Ga0496126_0545030 Ga0496126_0545030_222_878 204
244 3300049130 Ga0501310_009069 Ga0501310_009069_170_787 204
245 3300049162 Ga0501307_002308 Ga0501307_002308_233_850 204
246 3300049527 Ga0501311_011720 Ga0501311_011720_34_651 204
247 3300049528 Ga0501312_010889 Ga0501312_010889_75_692 204
248 3300049534 Ga0501318_013220 Ga0501318_013220_33_650 204
249 3300049534 Ga0501318_019557 Ga0501318_019557_177_797 204
250 3300049574 Ga0501038_0612680 Ga0501038_0612680_95_712 204
251 3300049591 Ga0501075_0159159 Ga0501075_0159159_856_1473 204
252 3300053077 Ga0495601_0005148 Ga0495601_0005148_665_1315 204
253 3300053078 Ga0495612_0001186 Ga0495612_0001186_9805_10455 204
254 3300053084 Ga0495595_0114179 Ga0495595_0114179_406_1059 204
255 3300053085 Ga0495619_0008993 Ga0495619_0008993_1641_2291 204
256 iso_pu_bacteria 2510917021 2511127737 204
257 iso_pu_bacteria 2818991438 2819552563 204
258 iso_pu_bacteria 8054302542 8054304448 204
259 3300005548 Ga0070665_100840700 Ga0070665_1008407002 205
260 3300005563 Ga0068855_100106749 Ga0068855_1001067492 205
261 3300009093 Ga0105240_10077028 Ga0105240_100770286 205
262 3300021377 Ga0213874_10021385 Ga0213874_100213853 205
263 3300021388 Ga0213875_10001918 Ga0213875_1000191819 205
264 3300021388 Ga0213875_10039023 Ga0213875_100390234 205
265 3300021388 Ga0213875_10070517 Ga0213875_100705173 205
266 3300025913 Ga0207695_10055829 Ga0207695_100558296 205
267 3300028379 Ga0268266_10843184 Ga0268266_108431842 205
268 3300037853 Ga0436364_0026312 Ga0436364_0026312_4653_5330 205
269 3300037853 Ga0436364_0052675 Ga0436364_0052675_608_1237 205
270 3300037853 Ga0436364_0242204 Ga0436364_0242204_350_979 205
271 3300037853 Ga0436364_0389284 Ga0436364_0389284_1390_2058 205
272 3300037853 Ga0436364_0727247 Ga0436364_0727247_248_973 205
273 3300039437 Ga0436365_0599891 Ga0436365_0599891_1087_1743 205
274 3300039437 Ga0436365_0636449 Ga0436365_0636449_1418_2047 205
275 3300039438 Ga0436360_0333232 Ga0436360_0333232_2593_3261 205
276 3300039450 Ga0436363_0409499 Ga0436363_0409499_794_1447 205
277 3300039453 Ga0436362_0446646 Ga0436362_0446646_376_1032 205
278 3300045051 Ga0451576_0273618 Ga0451576_0273618_358_978 205
279 3300049574 Ga0501038_0153974 Ga0501038_0153974_1228_1848 205
280 3300049577 Ga0501041_0079160 Ga0501041_0079160_543_1163 205
281 3300049587 Ga0501071_0068245 Ga0501071_0068245_389_1009 205
282 3300049592 Ga0501076_0023871 Ga0501076_0023871_318_938 205
283 3300049593 Ga0501077_0030811 Ga0501077_0030811_2319_2939 205
284 3300049741 Ga0501079_0471340 Ga0501079_0471340_311_931 205
285 3300049742 Ga0501080_0600744 Ga0501080_0600744_261_887 205
286 3300005444 Ga0070694_100101335 Ga0070694_1001013354 206
287 3300005539 Ga0068853_100001213 Ga0068853_10000121315 206
288 3300005546 Ga0070696_100114044 Ga0070696_1001140442 206
289 3300005549 Ga0070704_100320926 Ga0070704_1003209262 206
290 3300005617 Ga0068859_100001416 Ga0068859_1000014166 206
291 3300005719 Ga0068861_100000040 Ga0068861_10000004020 206
292 3300006051 Ga0075364_10263989 Ga0075364_102639892 206
293 3300006880 Ga0075429_100368822 Ga0075429_1003688222 206
294 3300006931 Ga0097620_100001416 Ga0097620_10000141636 206
295 3300025931 Ga0207644_10523860 Ga0207644_105238602 206
296 3300025941 Ga0207711_10023215 Ga0207711_100232153 206
297 3300026118 Ga0207675_100000157 Ga0207675_10000015749 206
298 3300031456 Ga0307513_10048601 Ga0307513_100486016 206
299 3300034817 Ga0373948_0046414 Ga0373948_0046414_125_808 206
300 3300042876 Ga0451577_0018151 Ga0451577_0018151_5494_6177 206
301 3300046452 Ga0495617_028132 Ga0495617_028132_585_1208 206
302 3300046460 Ga0495638_0000012 Ga0495638_0000012_35873_36496 206
303 3300046506 Ga0495583_0006701 Ga0495583_0006701_2151_2774 206
304 3300046513 Ga0495616_0000390 Ga0495616_0000390_30344_30967 206
305 3300046519 Ga0495632_0004429 Ga0495632_0004429_3662_4285 206
306 3300046524 Ga0495648_0000038 Ga0495648_0000038_155117_155740 206
307 3300046558 Ga0495633_0015715 Ga0495633_0015715_2127_2750 206
308 3300046692 Ga0495671_0000034 Ga0495671_0000034_142615_143238 206
309 3300047469 Ga0495673_0000013 Ga0495673_0000013_215316_215939 206
310 3300050491 nmdc:mga00v17_195100_c1 nmdc:mga00v17_195100_c1_15_662 206
311 3300053158 Ga0500627_0072415 Ga0500627_0072415_272_895 206
312 3300005289 Ga0065704_10005096 Ga0065704_100050967 207
313 3300005289 Ga0065704_10133643 Ga0065704_101336433 207
314 3300005327 Ga0070658_10000808 Ga0070658_100008083 207
315 3300005327 Ga0070658_10311392 Ga0070658_103113922 207
316 3300005330 Ga0070690_100035558 Ga0070690_1000355583 207
317 3300005335 Ga0070666_10077888 Ga0070666_100778882 207
318 3300005340 Ga0070689_100539526 Ga0070689_1005395261 207
319 3300005347 Ga0070668_100201095 Ga0070668_1002010953 207
320 3300005353 Ga0070669_100004937 Ga0070669_10000493710 207
321 3300005355 Ga0070671_100031516 Ga0070671_1000315163 207
322 3300005355 Ga0070671_100201010 Ga0070671_1002010103 207
323 3300005440 Ga0070705_100127772 Ga0070705_1001277723 207
324 3300005455 Ga0070663_100224453 Ga0070663_1002244532 207
325 3300005530 Ga0070679_100277979 Ga0070679_1002779792 207
326 3300005539 Ga0068853_100404879 Ga0068853_1004048792 207
327 3300005544 Ga0070686_100238127 Ga0070686_1002381272 207
328 3300005548 Ga0070665_100080805 Ga0070665_1000808052 207
329 3300005563 Ga0068855_100598311 Ga0068855_1005983112 207
330 3300005577 Ga0068857_100262080 Ga0068857_1002620802 207
331 3300005577 Ga0068857_100650980 Ga0068857_1006509802 207
332 3300005578 Ga0068854_100048934 Ga0068854_1000489342 207
333 3300005614 Ga0068856_100436011 Ga0068856_1004360112 207
334 3300005616 Ga0068852_100200291 Ga0068852_1002002911 207
335 3300005616 Ga0068852_100602980 Ga0068852_1006029801 207
336 3300005617 Ga0068859_100042049 Ga0068859_1000420494 207
337 3300005617 Ga0068859_100138380 Ga0068859_1001383804 207
338 3300005618 Ga0068864_100209740 Ga0068864_1002097402 207
339 3300005842 Ga0068858_100097011 Ga0068858_1000970113 207
340 3300005842 Ga0068858_100219257 Ga0068858_1002192573 207
341 3300006931 Ga0097620_100042049 Ga0097620_1000420495 207
342 3300006931 Ga0097620_100138381 Ga0097620_1001383814 207
343 3300009093 Ga0105240_10327247 Ga0105240_103272473 207
344 3300009101 Ga0105247_10060490 Ga0105247_100604902 207
345 3300009177 Ga0105248_10043335 Ga0105248_100433355 207
346 3300009545 Ga0105237_10362718 Ga0105237_103627182 207
347 3300009553 Ga0105249_11049980 Ga0105249_110499802 207
348 3300013102 Ga0157371_10094239 Ga0157371_100942392 207
349 3300013104 Ga0157370_10677811 Ga0157370_106778111 207
350 3300025315 Ga0207697_10060257 Ga0207697_100602572 207
351 3300025903 Ga0207680_10040390 Ga0207680_100403906 207
352 3300025904 Ga0207647_10009694 Ga0207647_100096944 207
353 3300025904 Ga0207647_10215776 Ga0207647_102157762 207
354 3300025909 Ga0207705_10000009 Ga0207705_10000009355 207
355 3300025909 Ga0207705_10025305 Ga0207705_100253054 207
356 3300025909 Ga0207705_10811037 Ga0207705_108110371 207
357 3300025913 Ga0207695_10179522 Ga0207695_101795223 207
358 3300025913 Ga0207695_10254886 Ga0207695_102548863 207
359 3300025914 Ga0207671_10358676 Ga0207671_103586762 207
360 3300025919 Ga0207657_10061755 Ga0207657_100617553 207
361 3300025923 Ga0207681_10024084 Ga0207681_100240843 207
362 3300025924 Ga0207694_10017336 Ga0207694_100173363 207
363 3300025931 Ga0207644_10000005 Ga0207644_10000005322 207
364 3300025931 Ga0207644_10291104 Ga0207644_102911043 207
365 3300025935 Ga0207709_10176594 Ga0207709_101765942 207
366 3300025941 Ga0207711_10007295 Ga0207711_100072954 207
367 3300025949 Ga0207667_10021256 Ga0207667_100212564 207
368 3300025949 Ga0207667_10113219 Ga0207667_101132192 207
369 3300025949 Ga0207667_10467319 Ga0207667_104673192 207
370 3300025961 Ga0207712_10077730 Ga0207712_100777303 207
371 3300025972 Ga0207668_10032423 Ga0207668_100324234 207
372 3300025972 Ga0207668_10338982 Ga0207668_103389822 207
373 3300025981 Ga0207640_10014726 Ga0207640_100147265 207
374 3300026035 Ga0207703_10041284 Ga0207703_100412843 207
375 3300026035 Ga0207703_10376093 Ga0207703_103760933 207
376 3300026067 Ga0207678_10091778 Ga0207678_100917783 207
377 3300026078 Ga0207702_10058181 Ga0207702_100581811 207
378 3300026078 Ga0207702_10182476 Ga0207702_101824763 207
379 3300026116 Ga0207674_10164362 Ga0207674_101643623 207
380 3300026142 Ga0207698_10000537 Ga0207698_100005371 207
381 3300026142 Ga0207698_10061955 Ga0207698_100619553 207
382 3300026142 Ga0207698_11446527 Ga0207698_114465271 207
383 3300028379 Ga0268266_10023261 Ga0268266_100232615 207
384 3300028381 Ga0268264_10103721 Ga0268264_101037213 207
385 3300031911 Ga0307412_10487847 Ga0307412_104878472 207
386 3300041498 Ga0451841_1147862 Ga0451841_1147862_292_918 207
387 3300046557 Ga0495622_0039363 Ga0495622_0039363_1259_1885 207
388 3300046692 Ga0495671_0008086 Ga0495671_0008086_3306_3932 207
389 3300048903 Ga0496100_0031287 Ga0496100_0031287_240_863 207
390 3300048905 Ga0496102_0038393 Ga0496102_0038393_3271_3894 207
391 3300048906 Ga0496103_0036159 Ga0496103_0036159_117_740 207
392 3300048907 Ga0496104_0037438 Ga0496104_0037438_3190_3813 207
393 3300048909 Ga0496106_0004127 Ga0496106_0004127_7348_7971 207
394 3300048910 Ga0496107_0005217 Ga0496107_0005217_1054_1677 207
395 3300048911 Ga0496108_0017449 Ga0496108_0017449_2083_2706 207
396 3300048911 Ga0496108_0289760 Ga0496108_0289760_445_1068 207
397 3300048912 Ga0496109_0151602 Ga0496109_0151602_386_1009 207
398 3300048912 Ga0496109_0546009 Ga0496109_0546009_26_649 207
399 3300048913 Ga0496110_0032770 Ga0496110_0032770_2143_2766 207
400 3300048913 Ga0496110_0059519 Ga0496110_0059519_462_1085 207
401 3300048914 Ga0496111_0056586 Ga0496111_0056586_96_719 207
402 3300048914 Ga0496111_0099018 Ga0496111_0099018_1070_1693 207
403 3300048915 Ga0496112_0324546 Ga0496112_0324546_281_904 207
404 3300048916 Ga0496113_0011540 Ga0496113_0011540_343_966 207
405 3300048917 Ga0496114_0020434 Ga0496114_0020434_3388_4011 207
406 3300048918 Ga0496115_0703053 Ga0496115_0703053_64_687 207
407 3300048929 Ga0496126_0058301 Ga0496126_0058301_436_1059 207
408 3300048929 Ga0496126_0124609 Ga0496126_0124609_228_851 207
409 3300049575 Ga0501039_0110912 Ga0501039_0110912_72_695 207
410 3300049822 Ga0501035_0817170 Ga0501035_0817170_44_667 207
411 3300050489 nmdc:mga03683_129576_c1 nmdc:mga03683_129576_c1_327_950 207
412 3300050493 nmdc:mga0k408_52034_c1 nmdc:mga0k408_52034_c1_1723_2349 207
413 3300050516 nmdc:mga0sz30_132684_c1 nmdc:mga0sz30_132684_c1_214_837 207
414 3300053108 Ga0500562_045321 Ga0500562_045321_118_744 207
415 3300053118 Ga0500594_0005507 Ga0500594_0005507_667_1293 207
416 3300053151 Ga0500604_0076435 Ga0500604_0076435_39_665 207
417 3300059491 Ga0587070_001986 Ga0587070_001986_514_1137 207
418 3300059493 Ga0587077_000001 Ga0587077_000001_6286_6909 207
419 3300059504 Ga0587082_000512 Ga0587082_000512_964_1587 207
420 3300059506 Ga0587085_003253 Ga0587085_003253_519_1142 207
421 3300059507 Ga0587086_003087 Ga0587086_003087_512_1135 207
422 3300059510 Ga0587090_000037 Ga0587090_000037_753_1376 207
423 3300059643 Ga0587072_003713 Ga0587072_003713_983_1606 207
424 3300059645 Ga0587076_002352 Ga0587076_002352_967_1590 207
425 3300060346 Ga0587111_0028178 Ga0587111_0028178_379_1002 207
426 2162886007 SwRhRL2b_contig_1707570 SwRhRL2b_0876.00001880 208
427 3300000041 ARcpr5oldR_c000791 ARcpr5oldR_0007913 208
428 3300002459 JGI24751J29686_10043971 JGI24751J29686_100439712 208
429 3300005289 Ga0065704_10009321 Ga0065704_100093216 208
430 3300005289 Ga0065704_10070214 Ga0065704_1007021439 208
431 3300005331 Ga0070670_100077325 Ga0070670_1000773253 208
432 3300005335 Ga0070666_10141818 Ga0070666_101418181 208
433 3300005347 Ga0070668_100046306 Ga0070668_1000463063 208
434 3300005353 Ga0070669_100002856 Ga0070669_1000028562 208
435 3300005355 Ga0070671_100002671 Ga0070671_10000267111 208
436 3300005367 Ga0070667_100052979 Ga0070667_1000529791 208
437 3300005367 Ga0070667_100092578 Ga0070667_1000925782 208
438 3300005548 Ga0070665_100001143 Ga0070665_1000011437 208
439 3300005548 Ga0070665_100015146 Ga0070665_1000151466 208
440 3300005577 Ga0068857_100358901 Ga0068857_1003589012 208
441 3300005616 Ga0068852_100360610 Ga0068852_1003606103 208
442 3300005841 Ga0068863_100000072 Ga0068863_1000000724 208
443 3300005841 Ga0068863_100084537 Ga0068863_1000845372 208
444 3300005841 Ga0068863_100109631 Ga0068863_1001096313 208
445 3300005842 Ga0068858_100054285 Ga0068858_1000542856 208
446 3300005843 Ga0068860_100000247 Ga0068860_10000024793 208
447 3300005843 Ga0068860_100028664 Ga0068860_1000286646 208
448 3300005843 Ga0068860_100159782 Ga0068860_1001597823 208
449 3300005844 Ga0068862_100037303 Ga0068862_1000373036 208
450 3300005844 Ga0068862_100227549 Ga0068862_1002275492 208
451 3300006038 Ga0075365_10003441 Ga0075365_100034415 208
452 3300006042 Ga0075368_10000063 Ga0075368_1000006321 208
453 3300006048 Ga0075363_100000434 Ga0075363_1000004348 208
454 3300006048 Ga0075363_100000592 Ga0075363_10000059210 208
455 3300006051 Ga0075364_10039797 Ga0075364_100397975 208
456 3300006051 Ga0075364_10105823 Ga0075364_101058233 208
457 3300006058 Ga0075432_10000042 Ga0075432_1000004231 208
458 3300006177 Ga0075362_10000383 Ga0075362_1000038320 208
459 3300006177 Ga0075362_10001156 Ga0075362_1000115614 208
460 3300006186 Ga0075369_10007430 Ga0075369_100074305 208
461 3300006186 Ga0075369_10024906 Ga0075369_100249063 208
462 3300006195 Ga0075366_10015361 Ga0075366_100153614 208
463 3300006353 Ga0075370_10000004 Ga0075370_10000004101 208
464 3300006353 Ga0075370_10017297 Ga0075370_100172976 208
465 3300006353 Ga0075370_10066123 Ga0075370_100661232 208
466 3300006946 Ga0079104_1044117 Ga0079104_10441172 208
467 3300009011 Ga0105251_10117856 Ga0105251_101178562 208
468 3300009101 Ga0105247_10233359 Ga0105247_102333592 208
469 3300009177 Ga0105248_10293477 Ga0105248_102934772 208
470 3300009177 Ga0105248_10610630 Ga0105248_106106302 208
471 3300009177 Ga0105248_10959828 Ga0105248_109598282 208
472 3300013102 Ga0157371_10022628 Ga0157371_100226284 208
473 3300014326 Ga0157380_10184182 Ga0157380_101841823 208
474 3300017792 Ga0163161_10062553 Ga0163161_100625535 208
475 3300025298 Ga0209050_1001064 Ga0209050_100106410 208
476 3300025735 Ga0207713_1023315 Ga0207713_10233156 208
477 3300025900 Ga0207710_10125321 Ga0207710_101253212 208
478 3300025900 Ga0207710_10225364 Ga0207710_102253641 208
479 3300025923 Ga0207681_10024920 Ga0207681_100249206 208
480 3300025923 Ga0207681_10342072 Ga0207681_103420722 208
481 3300025931 Ga0207644_10002200 Ga0207644_100022005 208
482 3300025941 Ga0207711_10042359 Ga0207711_100423593 208
483 3300025941 Ga0207711_10196000 Ga0207711_101960003 208
484 3300025941 Ga0207711_10922948 Ga0207711_109229481 208
485 3300025972 Ga0207668_10038990 Ga0207668_100389903 208
486 3300025981 Ga0207640_10055933 Ga0207640_100559332 208
487 3300025986 Ga0207658_10002550 Ga0207658_1000255017 208
488 3300025986 Ga0207658_10022322 Ga0207658_100223225 208
489 3300025986 Ga0207658_10086347 Ga0207658_100863472 208
490 3300026035 Ga0207703_10109804 Ga0207703_101098043 208
491 3300026035 Ga0207703_10287246 Ga0207703_102872462 208
492 3300026088 Ga0207641_10000084 Ga0207641_100000845 208
493 3300026088 Ga0207641_10026844 Ga0207641_100268442 208
494 3300026088 Ga0207641_10047020 Ga0207641_100470207 208
495 3300026095 Ga0207676_10045268 Ga0207676_100452682 208
496 3300026116 Ga0207674_10349915 Ga0207674_103499152 208
497 3300027866 Ga0209813_10000047 Ga0209813_1000004742 208
498 3300027907 Ga0207428_10020170 Ga0207428_100201709 208
499 3300028379 Ga0268266_10000879 Ga0268266_1000087937 208
500 3300028380 Ga0268265_10051345 Ga0268265_100513453 208
501 3300028380 Ga0268265_10076395 Ga0268265_100763953 208
502 3300028381 Ga0268264_10000253 Ga0268264_10000253107 208
503 3300028381 Ga0268264_10062575 Ga0268264_100625756 208
504 3300028381 Ga0268264_10133809 Ga0268264_101338092 208
505 3300030500 Ga0268256_1061693 Ga0268256_10616932 208
506 3300031731 Ga0307405_10431158 Ga0307405_104311582 208
507 3300031824 Ga0307413_10073593 Ga0307413_100735932 208
508 3300031824 Ga0307413_10183538 Ga0307413_101835382 208
509 3300031852 Ga0307410_10139679 Ga0307410_101396791 208
510 3300031901 Ga0307406_10692540 Ga0307406_106925402 208
511 3300031911 Ga0307412_10269370 Ga0307412_102693702 208
512 3300031995 Ga0307409_100065664 Ga0307409_1000656643 208
513 3300032002 Ga0307416_100112421 Ga0307416_1001124213 208
514 3300032002 Ga0307416_100740185 Ga0307416_1007401853 208
515 3300032004 Ga0307414_10094751 Ga0307414_100947512 208
516 3300032005 Ga0307411_10151988 Ga0307411_101519882 208
517 3300032005 Ga0307411_10651396 Ga0307411_106513962 208
518 3300034817 Ga0373948_0079258 Ga0373948_0079258_37_678 208
519 3300035691 Ga0373931_0033785 Ga0373931_0033785_832_1473 208
520 3300041512 Ga0451853_3234207 Ga0451853_3234207_678_1304 208
521 3300044712 Ga0453684_0811091 Ga0453684_0811091_365_991 208
522 3300046453 Ga0495627_001182 Ga0495627_001182_14516_15142 208
523 3300046460 Ga0495638_0001566 Ga0495638_0001566_15435_16064 208
524 3300046460 Ga0495638_0163241 Ga0495638_0163241_471_1097 208
525 3300046460 Ga0495638_0174766 Ga0495638_0174766_446_1072 208
526 3300046471 Ga0495650_0018352 Ga0495650_0018352_1666_2292 208
527 3300046500 Ga0495596_0000054 Ga0495596_0000054_462_1088 208
528 3300046500 Ga0495596_0007788 Ga0495596_0007788_3413_4039 208
529 3300046506 Ga0495583_0191574 Ga0495583_0191574_42_668 208
530 3300046507 Ga0495606_0131411 Ga0495606_0131411_454_1080 208
531 3300046512 Ga0495610_0000033 Ga0495610_0000033_273_899 208
532 3300046512 Ga0495610_0002336 Ga0495610_0002336_452_1078 208
533 3300046512 Ga0495610_0023572 Ga0495610_0023572_2443_3069 208
534 3300046515 Ga0495620_0016521 Ga0495620_0016521_2225_2851 208
535 3300046518 Ga0495631_0218280 Ga0495631_0218280_120_746 208
536 3300046519 Ga0495632_0111602 Ga0495632_0111602_174_800 208
537 3300046519 Ga0495632_0290779 Ga0495632_0290779_90_716 208
538 3300046522 Ga0495643_0018247 Ga0495643_0018247_780_1406 208
539 3300046538 Ga0495609_0078741 Ga0495609_0078741_195_821 208
540 3300046558 Ga0495633_0221524 Ga0495633_0221524_206_832 208
541 3300046616 Ga0495668_0080044 Ga0495668_0080044_744_1370 208
542 3300046660 Ga0495625_0068887 Ga0495625_0068887_579_1205 208
543 3300046692 Ga0495671_0356557 Ga0495671_0356557_38_664 208
544 3300047470 Ga0495681_0000360 Ga0495681_0000360_5258_5884 208
545 3300048090 Ga0495615_0000152 Ga0495615_0000152_2210_2836 208
546 3300048091 Ga0495626_0000356 Ga0495626_0000356_21280_21906 208
547 3300048904 Ga0496101_0153248 Ga0496101_0153248_992_1618 208
548 3300048906 Ga0496103_0018485 Ga0496103_0018485_1276_1917 208
549 3300048906 Ga0496103_0291843 Ga0496103_0291843_221_847 208
550 3300048907 Ga0496104_0145578 Ga0496104_0145578_581_1207 208
551 3300048908 Ga0496105_0040695 Ga0496105_0040695_2816_3442 208
552 3300048916 Ga0496113_0693574 Ga0496113_0693574_25_651 208
553 3300048919 Ga0496116_0000035 Ga0496116_0000035_162584_163210 208
554 3300048920 Ga0496117_0002537 Ga0496117_0002537_70_711 208
555 3300048921 Ga0496118_0051401 Ga0496118_0051401_381_1007 208
556 3300048921 Ga0496118_0052343 Ga0496118_0052343_2406_3032 208
557 3300048921 Ga0496118_0056128 Ga0496118_0056128_298_939 208
558 3300048922 Ga0496119_0041645 Ga0496119_0041645_1282_1923 208
559 3300048923 Ga0496120_0022737 Ga0496120_0022737_1919_2560 208
560 3300048923 Ga0496120_0141626 Ga0496120_0141626_121_747 208
561 3300048924 Ga0496121_0000031 Ga0496121_0000031_186958_187584 208
562 3300048924 Ga0496121_0000136 Ga0496121_0000136_30558_31184 208
563 3300048924 Ga0496121_0005190 Ga0496121_0005190_13311_13952 208
564 3300048924 Ga0496121_0040965 Ga0496121_0040965_2929_3555 208
565 3300048925 Ga0496122_0008028 Ga0496122_0008028_10561_11187 208
566 3300048925 Ga0496122_0009631 Ga0496122_0009631_3596_4222 208
567 3300048926 Ga0496123_0003623 Ga0496123_0003623_7046_7672 208
568 3300048926 Ga0496123_0085572 Ga0496123_0085572_1077_1718 208
569 3300048926 Ga0496123_0128746 Ga0496123_0128746_444_1070 208
570 3300048927 Ga0496124_0005247 Ga0496124_0005247_11166_11792 208
571 3300048927 Ga0496124_0068836 Ga0496124_0068836_749_1390 208
572 3300048928 Ga0496125_0024671 Ga0496125_0024671_913_1554 208
573 3300048929 Ga0496126_0000084 Ga0496126_0000084_70847_71473 208
574 3300048929 Ga0496126_0148093 Ga0496126_0148093_838_1479 208
575 3300049683 Ga0501253_010293 Ga0501253_010293_106_744 208
576 3300049822 Ga0501035_0701899 Ga0501035_0701899_98_724 208
577 3300049823 Ga0501044_0021221 Ga0501044_0021221_384_1010 208
578 3300049823 Ga0501044_0614444 Ga0501044_0614444_185_811 208
579 3300050489 nmdc:mga03683_31_c1 nmdc:mga03683_31_c1_21170_21811 208
580 3300050490 nmdc:mga03n38_4566_c1 nmdc:mga03n38_4566_c1_2001_2642 208
581 3300050490 nmdc:mga03n38_78102_c1 nmdc:mga03n38_78102_c1_669_1295 208
582 3300050491 nmdc:mga00v17_131476_c1 nmdc:mga00v17_131476_c1_888_1529 208
583 3300050491 nmdc:mga00v17_3048_c1 nmdc:mga00v17_3048_c1_2149_2775 208
584 3300050492 nmdc:mga0yw44_172505_c1 nmdc:mga0yw44_172505_c1_541_1167 208
585 3300050493 nmdc:mga0k408_18_c1 nmdc:mga0k408_18_c1_111216_111857 208
586 3300050493 nmdc:mga0k408_77479_c1 nmdc:mga0k408_77479_c1_418_1044 208
587 3300050494 nmdc:mga06z11_517_c1 nmdc:mga06z11_517_c1_541_1167 208
588 3300050495 nmdc:mga04h51_91_c1 nmdc:mga04h51_91_c1_15324_15950 208
589 3300050496 nmdc:mga07m45_12983_c1 nmdc:mga07m45_12983_c1_3397_4023 208
590 3300050496 nmdc:mga07m45_164_c1 nmdc:mga07m45_164_c1_11759_12385 208
591 3300050496 nmdc:mga07m45_19_c1 nmdc:mga07m45_19_c1_21264_21905 208
592 3300050516 nmdc:mga0sz30_163581_c1 nmdc:mga0sz30_163581_c1_177_803 208
593 3300050516 nmdc:mga0sz30_167_c1 nmdc:mga0sz30_167_c1_13449_14075 208
594 3300050516 nmdc:mga0sz30_6381_c2 nmdc:mga0sz30_6381_c2_1059_1700 208
595 3300053087 Ga0500643_030855 Ga0500643_030855_648_1274 208
596 3300053119 Ga0500595_068569 Ga0500595_068569_253_879 208
597 3300053121 Ga0500607_010159 Ga0500607_010159_2081_2707 208
598 3300053139 Ga0500568_0092028 Ga0500568_0092028_137_763 208
599 3300053156 Ga0500622_0002768 Ga0500622_0002768_3468_4094 208
600 3300053730 Ga0500645_008472 Ga0500645_008472_843_1481 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

16

202

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.899 13 205
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8922 3 204
7ode-assembly1.cif.gz_M e. coli 50s ribosome licl core particle 0.8775 3 205
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8729 3 204
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8697 3 204
ID Description Score Start End Superfamily
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8036 1 208 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8003 1 205 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7964 1 208 3.40.1370.10
af_P60723_1_201_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7934 1 205 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7929 1 205 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A2I0W1L9-F1-model_v4 Large ribosomal subunit protein uL4m 0.9168 89 208 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2P2JVQ7-F1-model_v4 Large ribosomal subunit protein uL4m 0.916 89 208 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3L6TNT1-F1-model_v4 Large ribosomal subunit protein uL4m 0.9023 1 205 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A118JYH2-F1-model_v4 Large ribosomal subunit protein uL4m 0.8954 1 208 GO:0003729
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D2HGN9-F1-model_v4 deleted 0.8903 95 208

Feature Viewer

pLDDT pTM Quality
82.96 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map