F467988
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 600 | 338 | 575 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300028379|Ga0268266_10893062|Ga0268266_108930622 |
| Length | 243 |
| Sequence | MQVEITTLDQTSAGTADLPDAIFATVPRADIMARVVHWQLAKRRAGTHKVKSLKEVSGTTKKPYRQKGTGNARQGSLRAPQFRTGGVVHGPVVRSHEYSLNKKVRRLGLISALSQKQVEGKLVVLDAANGTAKTAELAKKLKALGWSSALIVDDSVDPGFLRASRNIPGIDVLPTVGANVYDILRHDVLAITAAGVEGLKQRLGASDAEAPDDEPVNANPGQSXLXXXAVITEHAAPGEGATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 6 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 7 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 8 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 9 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 10 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 11 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 12 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 13 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 14 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 15 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 16 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 17 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 18 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 19 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 20 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 21 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 22 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 23 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 24 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 25 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 26 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 185 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 188 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 264 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 265 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 266 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 267 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 270 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 271 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 272 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 295 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 299 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 308 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 309 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 310 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 311 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 312 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 313 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 316 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 317 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 320 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 322 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 324 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 325 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 326 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 327 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 337 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 338 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.67 |
| Metatranscriptomes | 3.17 |
| Isolates | 4.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.5 |
| Bulb | 0 |
| Endosphere | 12 |
| Nodule | 0.17 |
| Rhizoplane | 4.33 |
| Rhizosphere | 71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1707570 | 2162886007 | Bacteria | 1694 |
| 2 | ARcpr5oldR_c000791 | 3300000041 | Bacteria | 3571 |
| 3 | JGI24740J21852_10008905 | 3300001979 | Bacteria | 3967 |
| 4 | JGI24751J29686_10000325 | 3300002459 | Bacteria | 17611 |
| 5 | JGI24751J29686_10043971 | 3300002459 | Bacteria | 923 |
| 6 | JGI25406J46586_10001890 | 3300003203 | Bacteria | 9855 |
| 7 | Ga0055536_1007883 | 3300003781 | Bacteria | 4679 |
| 8 | Ga0058862_12358730 | 3300004803 | Bacteria | 1568 |
| 9 | Ga0065704_10005096 | 3300005289 | Bacteria | 5772 |
| 10 | Ga0065704_10009321 | 3300005289 | Bacteria | 3045 |
| 11 | Ga0065704_10070214 | 3300005289 | Bacteria | 70706 |
| 12 | Ga0065704_10133643 | 3300005289 | Bacteria | 1598 |
| 13 | Ga0065707_10007537 | 3300005295 | Bacteria | 4124 |
| 14 | Ga0070658_10000808 | 3300005327 | Bacteria | 26765 |
| 15 | Ga0070658_10311392 | 3300005327 | Bacteria | 1343 |
| 16 | Ga0070683_100606046 | 3300005329 | Bacteria | 1048 |
| 17 | Ga0070690_100035558 | 3300005330 | Bacteria | 3126 |
| 18 | Ga0070670_100024275 | 3300005331 | Bacteria | 5215 |
| 19 | Ga0070670_100077325 | 3300005331 | Bacteria | 2860 |
| 20 | Ga0070666_10077888 | 3300005335 | Bacteria | 2262 |
| 21 | Ga0070666_10141818 | 3300005335 | Bacteria | 1674 |
| 22 | Ga0070666_10204101 | 3300005335 | Bacteria | 1391 |
| 23 | Ga0070680_100205764 | 3300005336 | Bacteria | 1660 |
| 24 | Ga0070689_100539526 | 3300005340 | Bacteria | 1004 |
| 25 | Ga0070668_100046306 | 3300005347 | Bacteria | 3339 |
| 26 | Ga0070668_100201095 | 3300005347 | Bacteria | 1636 |
| 27 | Ga0070668_100352101 | 3300005347 | Bacteria | 1247 |
| 28 | Ga0070669_100002856 | 3300005353 | Bacteria | 12479 |
| 29 | Ga0070669_100004937 | 3300005353 | Bacteria | 9634 |
| 30 | Ga0070671_100002671 | 3300005355 | Bacteria | 13821 |
| 31 | Ga0070671_100031516 | 3300005355 | Bacteria | 4380 |
| 32 | Ga0070671_100201010 | 3300005355 | Bacteria | 1690 |
| 33 | Ga0070667_100000088 | 3300005367 | Bacteria | 113956 |
| 34 | Ga0070667_100019254 | 3300005367 | Bacteria | 5662 |
| 35 | Ga0070667_100052979 | 3300005367 | Bacteria | 3424 |
| 36 | Ga0070667_100092578 | 3300005367 | Bacteria | 2601 |
| 37 | Ga0070714_100029929 | 3300005435 | Bacteria | 4530 |
| 38 | Ga0070713_100001675 | 3300005436 | Bacteria | 14235 |
| 39 | Ga0070713_100070192 | 3300005436 | Bacteria | 2957 |
| 40 | Ga0070713_100389647 | 3300005436 | Bacteria | 1300 |
| 41 | Ga0070711_100263075 | 3300005439 | Bacteria | 1358 |
| 42 | Ga0070711_100578006 | 3300005439 | Bacteria | 935 |
| 43 | Ga0070705_100127772 | 3300005440 | Bacteria | 1653 |
| 44 | Ga0070694_100101335 | 3300005444 | Bacteria | 2037 |
| 45 | Ga0070663_100224453 | 3300005455 | Bacteria | 1476 |
| 46 | Ga0070678_100149989 | 3300005456 | Bacteria | 1877 |
| 47 | Ga0070679_100277979 | 3300005530 | Bacteria | 1627 |
| 48 | Ga0068853_100001213 | 3300005539 | Bacteria | 18388 |
| 49 | Ga0068853_100404879 | 3300005539 | Bacteria | 1277 |
| 50 | Ga0070686_100238127 | 3300005544 | Bacteria | 1324 |
| 51 | Ga0070696_100114044 | 3300005546 | Bacteria | 1949 |
| 52 | Ga0070665_100001143 | 3300005548 | Bacteria | 32613 |
| 53 | Ga0070665_100015146 | 3300005548 | Bacteria | 7741 |
| 54 | Ga0070665_100080805 | 3300005548 | Bacteria | 3256 |
| 55 | Ga0070665_100840700 | 3300005548 | Bacteria | 931 |
| 56 | Ga0070665_101072993 | 3300005548 | Bacteria | 817 |
| 57 | Ga0070704_100320926 | 3300005549 | Bacteria | 1298 |
| 58 | Ga0068855_100106749 | 3300005563 | Bacteria | 3218 |
| 59 | Ga0068855_100598311 | 3300005563 | Bacteria | 1189 |
| 60 | Ga0068857_100123572 | 3300005577 | Bacteria | 2332 |
| 61 | Ga0068857_100262080 | 3300005577 | Bacteria | 1587 |
| 62 | Ga0068857_100358901 | 3300005577 | Bacteria | 1351 |
| 63 | Ga0068857_100650980 | 3300005577 | Bacteria | 999 |
| 64 | Ga0068854_100009263 | 3300005578 | Bacteria | 6354 |
| 65 | Ga0068854_100048934 | 3300005578 | Bacteria | 3018 |
| 66 | Ga0068856_100242910 | 3300005614 | Bacteria | 1816 |
| 67 | Ga0068856_100436011 | 3300005614 | Bacteria | 1330 |
| 68 | Ga0068856_100549835 | 3300005614 | Bacteria | 1176 |
| 69 | Ga0068852_100200291 | 3300005616 | Bacteria | 1889 |
| 70 | Ga0068852_100360610 | 3300005616 | Bacteria | 1422 |
| 71 | Ga0068852_100563934 | 3300005616 | Bacteria | 1140 |
| 72 | Ga0068852_100602980 | 3300005616 | Bacteria | 1102 |
| 73 | Ga0068859_100001416 | 3300005617 | Bacteria | 24328 |
| 74 | Ga0068859_100006387 | 3300005617 | Bacteria | 11959 |
| 75 | Ga0068859_100042049 | 3300005617 | Bacteria | 4590 |
| 76 | Ga0068859_100138380 | 3300005617 | Bacteria | 2508 |
| 77 | Ga0068864_100014199 | 3300005618 | Bacteria | 6612 |
| 78 | Ga0068864_100209740 | 3300005618 | Bacteria | 1793 |
| 79 | Ga0068861_100000040 | 3300005719 | Bacteria | 59725 |
| 80 | Ga0068861_100002700 | 3300005719 | Bacteria | 11613 |
| 81 | Ga0068863_100000072 | 3300005841 | Bacteria | 113996 |
| 82 | Ga0068863_100008669 | 3300005841 | Bacteria | 9938 |
| 83 | Ga0068863_100084537 | 3300005841 | Bacteria | 3007 |
| 84 | Ga0068863_100109631 | 3300005841 | Bacteria | 2628 |
| 85 | Ga0068858_100054285 | 3300005842 | Bacteria | 3705 |
| 86 | Ga0068858_100097011 | 3300005842 | Bacteria | 2747 |
| 87 | Ga0068858_100219257 | 3300005842 | Bacteria | 1801 |
| 88 | Ga0068860_100000220 | 3300005843 | Bacteria | 89460 |
| 89 | Ga0068860_100000247 | 3300005843 | Bacteria | 81527 |
| 90 | Ga0068860_100028664 | 3300005843 | Bacteria | 5359 |
| 91 | Ga0068860_100159782 | 3300005843 | Bacteria | 2172 |
| 92 | Ga0068862_100000126 | 3300005844 | Bacteria | 89210 |
| 93 | Ga0068862_100037303 | 3300005844 | Bacteria | 4119 |
| 94 | Ga0068862_100227549 | 3300005844 | Bacteria | 1691 |
| 95 | Ga0081539_10000072 | 3300005985 | Bacteria | 232726 |
| 96 | Ga0070717_10085206 | 3300006028 | Bacteria | 2659 |
| 97 | Ga0070717_10179677 | 3300006028 | Bacteria | 1844 |
| 98 | Ga0075365_10003441 | 3300006038 | Bacteria | 8155 |
| 99 | Ga0075368_10000063 | 3300006042 | Bacteria | 25834 |
| 100 | Ga0075363_100000434 | 3300006048 | Bacteria | 13047 |
| 101 | Ga0075363_100000592 | 3300006048 | Bacteria | 11936 |
| 102 | Ga0075364_10001520 | 3300006051 | Bacteria | 12625 |
| 103 | Ga0075364_10039797 | 3300006051 | Bacteria | 3048 |
| 104 | Ga0075364_10105823 | 3300006051 | Bacteria | 1874 |
| 105 | Ga0075364_10263989 | 3300006051 | Bacteria | 1170 |
| 106 | Ga0075432_10000042 | 3300006058 | Bacteria | 24212 |
| 107 | Ga0070712_100004619 | 3300006175 | Bacteria | 8513 |
| 108 | Ga0075362_10000383 | 3300006177 | Bacteria | 12678 |
| 109 | Ga0075362_10001156 | 3300006177 | Bacteria | 8246 |
| 110 | Ga0075362_10085808 | 3300006177 | Bacteria | 1456 |
| 111 | Ga0075369_10007430 | 3300006186 | Bacteria | 4172 |
| 112 | Ga0075369_10010979 | 3300006186 | Bacteria | 3553 |
| 113 | Ga0075369_10024906 | 3300006186 | Bacteria | 2484 |
| 114 | Ga0075369_10091481 | 3300006186 | Bacteria | 1358 |
| 115 | Ga0075366_10015361 | 3300006195 | Bacteria | 4386 |
| 116 | Ga0097621_100698497 | 3300006237 | Bacteria | 934 |
| 117 | Ga0075370_10000004 | 3300006353 | Bacteria | 121166 |
| 118 | Ga0075370_10017297 | 3300006353 | Bacteria | 3894 |
| 119 | Ga0075370_10063490 | 3300006353 | Bacteria | 2106 |
| 120 | Ga0075370_10066123 | 3300006353 | Bacteria | 2062 |
| 121 | Ga0075429_100368822 | 3300006880 | Bacteria | 1257 |
| 122 | Ga0097620_100001416 | 3300006931 | Bacteria | 24328 |
| 123 | Ga0097620_100006388 | 3300006931 | Bacteria | 11959 |
| 124 | Ga0097620_100042049 | 3300006931 | Bacteria | 4590 |
| 125 | Ga0097620_100138381 | 3300006931 | Bacteria | 2508 |
| 126 | Ga0079104_1044117 | 3300006946 | Bacteria | 1024 |
| 127 | Ga0105251_10117856 | 3300009011 | Bacteria | 1207 |
| 128 | Ga0105240_10077028 | 3300009093 | Bacteria | 4110 |
| 129 | Ga0105240_10327247 | 3300009093 | Bacteria | 1745 |
| 130 | Ga0105245_10261274 | 3300009098 | Bacteria | 1685 |
| 131 | Ga0105247_10060490 | 3300009101 | Bacteria | 2347 |
| 132 | Ga0105247_10233359 | 3300009101 | Bacteria | 1250 |
| 133 | Ga0105247_10290639 | 3300009101 | Bacteria | 1130 |
| 134 | Ga0105242_11552165 | 3300009176 | Bacteria | 694 |
| 135 | Ga0105248_10043335 | 3300009177 | Bacteria | 5045 |
| 136 | Ga0105248_10052852 | 3300009177 | Bacteria | 4559 |
| 137 | Ga0105248_10293477 | 3300009177 | Bacteria | 1831 |
| 138 | Ga0105248_10610630 | 3300009177 | Bacteria | 1230 |
| 139 | Ga0105248_10959828 | 3300009177 | Bacteria | 965 |
| 140 | Ga0105237_10002858 | 3300009545 | Bacteria | 20999 |
| 141 | Ga0105237_10362718 | 3300009545 | Bacteria | 1453 |
| 142 | Ga0105249_10352460 | 3300009553 | Bacteria | 1491 |
| 143 | Ga0105249_11049980 | 3300009553 | Bacteria | 884 |
| 144 | Ga0105239_10377514 | 3300010375 | Bacteria | 1602 |
| 145 | Ga0105246_10461360 | 3300011119 | Bacteria | 1070 |
| 146 | Ga0157326_1000431 | 3300012513 | Bacteria | 4985 |
| 147 | Ga0157371_10022628 | 3300013102 | Bacteria | 4601 |
| 148 | Ga0157371_10094239 | 3300013102 | Bacteria | 2122 |
| 149 | Ga0157370_10677811 | 3300013104 | Bacteria | 942 |
| 150 | Ga0163162_10207028 | 3300013306 | Bacteria | 2091 |
| 151 | Ga0163163_10093123 | 3300014325 | Bacteria | 3029 |
| 152 | Ga0163163_10151103 | 3300014325 | Bacteria | 2366 |
| 153 | Ga0157380_10032640 | 3300014326 | Bacteria | 4007 |
| 154 | Ga0157380_10184182 | 3300014326 | Bacteria | 1838 |
| 155 | Ga0182008_10371231 | 3300014497 | Bacteria | 763 |
| 156 | Ga0157379_10366262 | 3300014968 | Bacteria | 1321 |
| 157 | Ga0163161_10062553 | 3300017792 | Bacteria | 2712 |
| 158 | Ga0163161_10130698 | 3300017792 | Bacteria | 1894 |
| 159 | Ga0206350_10208363 | 3300020080 | Bacteria | 819 |
| 160 | Ga0213874_10021385 | 3300021377 | Bacteria | 1783 |
| 161 | Ga0213875_10001918 | 3300021388 | Bacteria | 12881 |
| 162 | Ga0213875_10008279 | 3300021388 | Bacteria | 5333 |
| 163 | Ga0213875_10014923 | 3300021388 | Bacteria | 3784 |
| 164 | Ga0213875_10039023 | 3300021388 | Bacteria | 2237 |
| 165 | Ga0213875_10070517 | 3300021388 | Bacteria | 1631 |
| 166 | Ga0213871_10012207 | 3300021441 | Bacteria | 1990 |
| 167 | Ga0213871_10013452 | 3300021441 | Bacteria | 1923 |
| 168 | Ga0209676_1000092 | 3300025292 | Bacteria | 250453 |
| 169 | Ga0209050_1001064 | 3300025298 | Bacteria | 33727 |
| 170 | Ga0209050_1040571 | 3300025298 | Bacteria | 1294 |
| 171 | Ga0207697_10060257 | 3300025315 | Bacteria | 1578 |
| 172 | Ga0207713_1023315 | 3300025735 | Bacteria | 2915 |
| 173 | Ga0207710_10125321 | 3300025900 | Bacteria | 1230 |
| 174 | Ga0207710_10225364 | 3300025900 | Bacteria | 932 |
| 175 | Ga0207680_10040390 | 3300025903 | Bacteria | 2714 |
| 176 | Ga0207680_10151589 | 3300025903 | Bacteria | 1546 |
| 177 | Ga0207680_10379343 | 3300025903 | Bacteria | 997 |
| 178 | Ga0207647_10009694 | 3300025904 | Bacteria | 6833 |
| 179 | Ga0207647_10215776 | 3300025904 | Bacteria | 1107 |
| 180 | Ga0207699_10321316 | 3300025906 | Bacteria | 1086 |
| 181 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 182 | Ga0207705_10025305 | 3300025909 | Bacteria | 4238 |
| 183 | Ga0207705_10345673 | 3300025909 | Bacteria | 1145 |
| 184 | Ga0207705_10811037 | 3300025909 | Bacteria | 726 |
| 185 | Ga0207695_10055829 | 3300025913 | Bacteria | 4113 |
| 186 | Ga0207695_10179522 | 3300025913 | Bacteria | 2038 |
| 187 | Ga0207695_10254886 | 3300025913 | Bacteria | 1653 |
| 188 | Ga0207671_10043377 | 3300025914 | Bacteria | 3326 |
| 189 | Ga0207671_10358676 | 3300025914 | Bacteria | 1157 |
| 190 | Ga0207693_10029783 | 3300025915 | Bacteria | 4309 |
| 191 | Ga0207663_10603548 | 3300025916 | Bacteria | 862 |
| 192 | Ga0207660_10377463 | 3300025917 | Bacteria | 1139 |
| 193 | Ga0207657_10061755 | 3300025919 | Bacteria | 3211 |
| 194 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 195 | Ga0207681_10024084 | 3300025923 | Bacteria | 3902 |
| 196 | Ga0207681_10024920 | 3300025923 | Bacteria | 3843 |
| 197 | Ga0207681_10342072 | 3300025923 | Bacteria | 1195 |
| 198 | Ga0207694_10017336 | 3300025924 | Bacteria | 5445 |
| 199 | Ga0207694_10483360 | 3300025924 | Bacteria | 1036 |
| 200 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 201 | Ga0207700_10830337 | 3300025928 | Bacteria | 827 |
| 202 | Ga0207664_10075173 | 3300025929 | Bacteria | 2731 |
| 203 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 204 | Ga0207644_10002200 | 3300025931 | Bacteria | 12646 |
| 205 | Ga0207644_10291104 | 3300025931 | Bacteria | 1313 |
| 206 | Ga0207644_10523860 | 3300025931 | Bacteria | 979 |
| 207 | Ga0207709_10176594 | 3300025935 | Bacteria | 1504 |
| 208 | Ga0207711_10007295 | 3300025941 | Bacteria | 9260 |
| 209 | Ga0207711_10020060 | 3300025941 | Bacteria | 5571 |
| 210 | Ga0207711_10023215 | 3300025941 | Bacteria | 5191 |
| 211 | Ga0207711_10042359 | 3300025941 | Bacteria | 3879 |
| 212 | Ga0207711_10196000 | 3300025941 | Bacteria | 1842 |
| 213 | Ga0207711_10922948 | 3300025941 | Bacteria | 811 |
| 214 | Ga0207667_10021256 | 3300025949 | Bacteria | 7193 |
| 215 | Ga0207667_10113219 | 3300025949 | Bacteria | 2798 |
| 216 | Ga0207667_10467319 | 3300025949 | Bacteria | 1281 |
| 217 | Ga0207712_10077730 | 3300025961 | Bacteria | 2406 |
| 218 | Ga0207668_10032423 | 3300025972 | Bacteria | 3452 |
| 219 | Ga0207668_10038990 | 3300025972 | Bacteria | 3193 |
| 220 | Ga0207668_10123359 | 3300025972 | Bacteria | 1965 |
| 221 | Ga0207668_10338982 | 3300025972 | Bacteria | 1253 |
| 222 | Ga0207640_10014726 | 3300025981 | Bacteria | 4508 |
| 223 | Ga0207640_10055933 | 3300025981 | Bacteria | 2587 |
| 224 | Ga0207640_10060540 | 3300025981 | Bacteria | 2503 |
| 225 | Ga0207640_10146592 | 3300025981 | Bacteria | 1728 |
| 226 | Ga0207658_10000064 | 3300025986 | Bacteria | 117779 |
| 227 | Ga0207658_10002550 | 3300025986 | Bacteria | 13234 |
| 228 | Ga0207658_10005381 | 3300025986 | Bacteria | 8790 |
| 229 | Ga0207658_10022322 | 3300025986 | Bacteria | 4406 |
| 230 | Ga0207658_10086347 | 3300025986 | Bacteria | 2419 |
| 231 | Ga0207677_10696806 | 3300026023 | Bacteria | 901 |
| 232 | Ga0207703_10041284 | 3300026035 | Bacteria | 3695 |
| 233 | Ga0207703_10109804 | 3300026035 | Bacteria | 2352 |
| 234 | Ga0207703_10287246 | 3300026035 | Bacteria | 1496 |
| 235 | Ga0207703_10376093 | 3300026035 | Bacteria | 1313 |
| 236 | Ga0207678_10091778 | 3300026067 | Bacteria | 2596 |
| 237 | Ga0207702_10058181 | 3300026078 | Bacteria | 3289 |
| 238 | Ga0207702_10182476 | 3300026078 | Bacteria | 1934 |
| 239 | Ga0207702_10272141 | 3300026078 | Bacteria | 1598 |
| 240 | Ga0207641_10000084 | 3300026088 | Bacteria | 133555 |
| 241 | Ga0207641_10003421 | 3300026088 | Bacteria | 14060 |
| 242 | Ga0207641_10026844 | 3300026088 | Bacteria | 4754 |
| 243 | Ga0207641_10047020 | 3300026088 | Bacteria | 3638 |
| 244 | Ga0207648_10855189 | 3300026089 | Bacteria | 848 |
| 245 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 246 | Ga0207676_10045268 | 3300026095 | Bacteria | 3399 |
| 247 | Ga0207674_10099906 | 3300026116 | Bacteria | 2883 |
| 248 | Ga0207674_10164362 | 3300026116 | Bacteria | 2174 |
| 249 | Ga0207674_10349915 | 3300026116 | Bacteria | 1428 |
| 250 | Ga0207674_10896968 | 3300026116 | Bacteria | 855 |
| 251 | Ga0207675_100000157 | 3300026118 | Bacteria | 59865 |
| 252 | Ga0207675_100001117 | 3300026118 | Bacteria | 26571 |
| 253 | Ga0207683_10300692 | 3300026121 | Bacteria | 1468 |
| 254 | Ga0207698_10000537 | 3300026142 | Bacteria | 22020 |
| 255 | Ga0207698_10061955 | 3300026142 | Bacteria | 2918 |
| 256 | Ga0207698_10495876 | 3300026142 | Bacteria | 1187 |
| 257 | Ga0207698_11446527 | 3300026142 | Bacteria | 702 |
| 258 | Ga0209813_10000047 | 3300027866 | Bacteria | 49657 |
| 259 | Ga0207428_10020170 | 3300027907 | Bacteria | 5667 |
| 260 | Ga0268266_10000879 | 3300028379 | Bacteria | 38938 |
| 261 | Ga0268266_10023261 | 3300028379 | Bacteria | 5276 |
| 262 | Ga0268266_10843184 | 3300028379 | Bacteria | 886 |
| 263 | Ga0268266_10893062 | 3300028379 | Bacteria | 859 |
| 264 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 265 | Ga0268265_10051345 | 3300028380 | Bacteria | 3112 |
| 266 | Ga0268265_10076395 | 3300028380 | Bacteria | 2627 |
| 267 | Ga0268264_10000253 | 3300028381 | Bacteria | 98587 |
| 268 | Ga0268264_10000384 | 3300028381 | Bacteria | 63602 |
| 269 | Ga0268264_10062575 | 3300028381 | Bacteria | 3125 |
| 270 | Ga0268264_10103721 | 3300028381 | Bacteria | 2477 |
| 271 | Ga0268264_10133809 | 3300028381 | Bacteria | 2202 |
| 272 | Ga0265338_10008853 | 3300028800 | Bacteria | 12137 |
| 273 | Ga0265338_10301074 | 3300028800 | Bacteria | 1166 |
| 274 | Ga0265324_10004791 | 3300029957 | Bacteria | 5979 |
| 275 | Ga0268256_1061693 | 3300030500 | Bacteria | 750 |
| 276 | Ga0265328_10034096 | 3300031239 | Bacteria | 1885 |
| 277 | Ga0265331_10000543 | 3300031250 | Bacteria | 34421 |
| 278 | Ga0307513_10048601 | 3300031456 | Bacteria | 4603 |
| 279 | Ga0307405_10431158 | 3300031731 | Bacteria | 1040 |
| 280 | Ga0307413_10073593 | 3300031824 | Bacteria | 2160 |
| 281 | Ga0307413_10183538 | 3300031824 | Bacteria | 1494 |
| 282 | Ga0307410_10139679 | 3300031852 | Bacteria | 1790 |
| 283 | Ga0307406_10692540 | 3300031901 | Bacteria | 850 |
| 284 | Ga0307412_10001378 | 3300031911 | Bacteria | 13503 |
| 285 | Ga0307412_10077699 | 3300031911 | Bacteria | 2284 |
| 286 | Ga0307412_10269370 | 3300031911 | Bacteria | 1332 |
| 287 | Ga0307412_10487847 | 3300031911 | Bacteria | 1023 |
| 288 | Ga0307409_100065664 | 3300031995 | Bacteria | 2857 |
| 289 | Ga0307416_100112421 | 3300032002 | Bacteria | 2403 |
| 290 | Ga0307416_100489888 | 3300032002 | Bacteria | 1291 |
| 291 | Ga0307416_100740185 | 3300032002 | Bacteria | 1075 |
| 292 | Ga0307414_10094751 | 3300032004 | Bacteria | 2229 |
| 293 | Ga0307414_10108978 | 3300032004 | Bacteria | 2103 |
| 294 | Ga0307411_10151988 | 3300032005 | Bacteria | 1721 |
| 295 | Ga0307411_10651396 | 3300032005 | Bacteria | 912 |
| 296 | Ga0316593_10070083 | 3300032168 | Bacteria | 1212 |
| 297 | Ga0373948_0046414 | 3300034817 | Bacteria | 923 |
| 298 | Ga0373948_0079258 | 3300034817 | Bacteria | 747 |
| 299 | Ga0373936_0065571 | 3300035113 | Bacteria | 1490 |
| 300 | Ga0373953_0004557 | 3300035117 | Bacteria | 4422 |
| 301 | Ga0373954_0040905 | 3300035118 | Bacteria | 2160 |
| 302 | Ga0373957_0007801 | 3300035120 | Bacteria | 3439 |
| 303 | Ga0373943_0053387 | 3300035170 | Bacteria | 1996 |
| 304 | Ga0373946_0250961 | 3300035171 | Bacteria | 863 |
| 305 | Ga0373924_0049234 | 3300035410 | Bacteria | 1743 |
| 306 | Ga0373924_0071221 | 3300035410 | Bacteria | 1467 |
| 307 | Ga0373931_0033785 | 3300035691 | Bacteria | 2652 |
| 308 | Ga0373927_0134843 | 3300035695 | Bacteria | 1613 |
| 309 | Ga0373927_0398801 | 3300035695 | Bacteria | 908 |
| 310 | Ga0373933_0019715 | 3300035724 | Bacteria | 3815 |
| 311 | Ga0373947_0036450 | 3300035725 | Bacteria | 2917 |
| 312 | Ga0373937_0000922 | 3300036401 | Bacteria | 24939 |
| 313 | Ga0373937_0061124 | 3300036401 | Bacteria | 3463 |
| 314 | Ga0373937_0074325 | 3300036401 | Bacteria | 3136 |
| 315 | Ga0373937_0144757 | 3300036401 | Bacteria | 2224 |
| 316 | Ga0373925_0008231 | 3300037068 | Bacteria | 7590 |
| 317 | Ga0373925_0095519 | 3300037068 | Bacteria | 2277 |
| 318 | Ga0373925_0220977 | 3300037068 | Bacteria | 1512 |
| 319 | Ga0373925_0270235 | 3300037068 | Bacteria | 1367 |
| 320 | Ga0436364_0000682 | 3300037853 | Bacteria | 2241 |
| 321 | Ga0436364_0026312 | 3300037853 | Bacteria | 5505 |
| 322 | Ga0436364_0052675 | 3300037853 | Bacteria | 2449 |
| 323 | Ga0436364_0242204 | 3300037853 | Bacteria | 1864 |
| 324 | Ga0436364_0389284 | 3300037853 | Bacteria | 5767 |
| 325 | Ga0436364_0586291 | 3300037853 | Bacteria | 97560 |
| 326 | Ga0436364_0727247 | 3300037853 | Bacteria | 1283 |
| 327 | Ga0436364_0866406 | 3300037853 | Bacteria | 4069 |
| 328 | Ga0436364_1453650 | 3300037853 | Bacteria | 1031 |
| 329 | Ga0436365_0340931 | 3300039437 | Bacteria | 1168 |
| 330 | Ga0436365_0599891 | 3300039437 | Bacteria | 2660 |
| 331 | Ga0436365_0636449 | 3300039437 | Bacteria | 2343 |
| 332 | Ga0436365_1337727 | 3300039437 | Bacteria | 1310 |
| 333 | Ga0436365_1915576 | 3300039437 | Bacteria | 1400 |
| 334 | Ga0436360_0333232 | 3300039438 | Bacteria | 5402 |
| 335 | Ga0436360_0452772 | 3300039438 | Bacteria | 2288 |
| 336 | Ga0436360_0639768 | 3300039438 | Bacteria | 2249 |
| 337 | Ga0436360_0712409 | 3300039438 | Bacteria | 2297 |
| 338 | Ga0436360_0851339 | 3300039438 | Bacteria | 1036 |
| 339 | Ga0436360_1332781 | 3300039438 | Bacteria | 3795 |
| 340 | Ga0436361_0278088 | 3300039447 | Bacteria | 3953 |
| 341 | Ga0436361_0718732 | 3300039447 | Bacteria | 1769 |
| 342 | Ga0436361_0808720 | 3300039447 | Bacteria | 911 |
| 343 | Ga0436361_0907344 | 3300039447 | Bacteria | 1338 |
| 344 | Ga0436361_1156340 | 3300039447 | Unclassified | 1782 |
| 345 | Ga0436363_0130967 | 3300039450 | Bacteria | 1391 |
| 346 | Ga0436363_0301585 | 3300039450 | Bacteria | 2291 |
| 347 | Ga0436363_0409499 | 3300039450 | Bacteria | 1473 |
| 348 | Ga0436363_1180028 | 3300039450 | Bacteria | 1043 |
| 349 | Ga0436362_0446646 | 3300039453 | Bacteria | 2374 |
| 350 | Ga0436362_0558767 | 3300039453 | Bacteria | 1205 |
| 351 | Ga0436362_1070743 | 3300039453 | Bacteria | 1881 |
| 352 | Ga0451841_1147862 | 3300041498 | Bacteria | 1077 |
| 353 | Ga0451853_3234207 | 3300041512 | Bacteria | 1799 |
| 354 | Ga0451577_0018151 | 3300042876 | Bacteria | 6483 |
| 355 | Ga0466963_0193871 | 3300044694 | Bacteria | 1420 |
| 356 | Ga0453684_0811091 | 3300044712 | Bacteria | 1009 |
| 357 | Ga0451576_0273618 | 3300045051 | Bacteria | 1766 |
| 358 | Ga0466958_0184377 | 3300045836 | Bacteria | 1325 |
| 359 | Ga0466958_0260636 | 3300045836 | Bacteria | 1110 |
| 360 | Ga0466967_0600243 | 3300045976 | Bacteria | 1086 |
| 361 | Ga0495617_028132 | 3300046452 | Bacteria | 1890 |
| 362 | Ga0495627_001182 | 3300046453 | Bacteria | 16582 |
| 363 | Ga0495592_0089301 | 3300046454 | Bacteria | 2214 |
| 364 | Ga0495629_0482080 | 3300046459 | Bacteria | 838 |
| 365 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 366 | Ga0495638_0001566 | 3300046460 | Bacteria | 20510 |
| 367 | Ga0495638_0163241 | 3300046460 | Bacteria | 1284 |
| 368 | Ga0495638_0174766 | 3300046460 | Bacteria | 1230 |
| 369 | Ga0495651_0078288 | 3300046462 | Bacteria | 2501 |
| 370 | Ga0495651_0246566 | 3300046462 | Bacteria | 1222 |
| 371 | Ga0495653_0213658 | 3300046463 | Bacteria | 1301 |
| 372 | Ga0495650_0018352 | 3300046471 | Bacteria | 3477 |
| 373 | Ga0495582_0290773 | 3300046473 | Bacteria | 939 |
| 374 | Ga0495664_0026792 | 3300046477 | Bacteria | 3358 |
| 375 | Ga0495594_0334035 | 3300046499 | Bacteria | 863 |
| 376 | Ga0495596_0000054 | 3300046500 | Bacteria | 83068 |
| 377 | Ga0495596_0007788 | 3300046500 | Bacteria | 4806 |
| 378 | Ga0495583_0006701 | 3300046506 | Bacteria | 7462 |
| 379 | Ga0495583_0191574 | 3300046506 | Bacteria | 834 |
| 380 | Ga0495606_0131411 | 3300046507 | Bacteria | 1488 |
| 381 | Ga0495608_0025697 | 3300046511 | Bacteria | 4020 |
| 382 | Ga0495608_0063375 | 3300046511 | Bacteria | 2426 |
| 383 | Ga0495610_0000033 | 3300046512 | Bacteria | 204151 |
| 384 | Ga0495610_0002336 | 3300046512 | Bacteria | 16035 |
| 385 | Ga0495610_0023572 | 3300046512 | Bacteria | 3341 |
| 386 | Ga0495616_0000390 | 3300046513 | Bacteria | 34071 |
| 387 | Ga0495618_0453623 | 3300046514 | Bacteria | 778 |
| 388 | Ga0495620_0016521 | 3300046515 | Bacteria | 3700 |
| 389 | Ga0495628_0085528 | 3300046516 | Bacteria | 2446 |
| 390 | Ga0495631_0218280 | 3300046518 | Bacteria | 814 |
| 391 | Ga0495632_0004429 | 3300046519 | Bacteria | 9546 |
| 392 | Ga0495632_0111602 | 3300046519 | Bacteria | 1283 |
| 393 | Ga0495632_0290779 | 3300046519 | Bacteria | 726 |
| 394 | Ga0495643_0018247 | 3300046522 | Bacteria | 4082 |
| 395 | Ga0495643_0019518 | 3300046522 | Bacteria | 3920 |
| 396 | Ga0495648_0000038 | 3300046524 | Bacteria | 191612 |
| 397 | Ga0495640_0031131 | 3300046533 | Bacteria | 3811 |
| 398 | Ga0495587_0045036 | 3300046536 | Bacteria | 2623 |
| 399 | Ga0495609_0078741 | 3300046538 | Bacteria | 1442 |
| 400 | Ga0495597_0015301 | 3300046542 | Bacteria | 3634 |
| 401 | Ga0495645_0006077 | 3300046543 | Bacteria | 8353 |
| 402 | Ga0495622_0039363 | 3300046557 | Bacteria | 2202 |
| 403 | Ga0495633_0015715 | 3300046558 | Bacteria | 3923 |
| 404 | Ga0495633_0221524 | 3300046558 | Bacteria | 866 |
| 405 | Ga0495667_0047390 | 3300046559 | Bacteria | 2840 |
| 406 | Ga0495667_0145498 | 3300046559 | Bacteria | 1527 |
| 407 | Ga0495668_0080044 | 3300046616 | Bacteria | 1793 |
| 408 | Ga0495668_0107355 | 3300046616 | Bacteria | 1527 |
| 409 | Ga0495625_0068887 | 3300046660 | Bacteria | 2486 |
| 410 | Ga0495635_0033840 | 3300046663 | Bacteria | 3545 |
| 411 | Ga0495635_0128144 | 3300046663 | Bacteria | 1730 |
| 412 | Ga0495657_0110681 | 3300046675 | Bacteria | 1740 |
| 413 | Ga0495599_0382309 | 3300046678 | Bacteria | 840 |
| 414 | Ga0495646_0115336 | 3300046680 | Bacteria | 1525 |
| 415 | Ga0495658_0229094 | 3300046683 | Bacteria | 1165 |
| 416 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 417 | Ga0495671_0008086 | 3300046692 | Bacteria | 5938 |
| 418 | Ga0495671_0356557 | 3300046692 | Bacteria | 701 |
| 419 | Ga0495600_0321218 | 3300046809 | Bacteria | 973 |
| 420 | Ga0495680_0343730 | 3300047322 | Bacteria | 1040 |
| 421 | Ga0495687_112923 | 3300047443 | Bacteria | 995 |
| 422 | Ga0495675_0014092 | 3300047444 | Bacteria | 5054 |
| 423 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 424 | Ga0495681_0000360 | 3300047470 | Bacteria | 35550 |
| 425 | Ga0495684_0030744 | 3300047471 | Bacteria | 4123 |
| 426 | Ga0495684_0107081 | 3300047471 | Bacteria | 2112 |
| 427 | Ga0495684_0302264 | 3300047471 | Bacteria | 1149 |
| 428 | Ga0495593_0336938 | 3300047673 | Bacteria | 754 |
| 429 | Ga0495602_0000485 | 3300048088 | Bacteria | 36933 |
| 430 | Ga0495615_0000152 | 3300048090 | Bacteria | 17446 |
| 431 | Ga0495626_0000356 | 3300048091 | Bacteria | 47831 |
| 432 | Ga0496100_0031287 | 3300048903 | Bacteria | 3307 |
| 433 | Ga0496101_0153248 | 3300048904 | Bacteria | 1764 |
| 434 | Ga0496102_0038393 | 3300048905 | Bacteria | 4321 |
| 435 | Ga0496103_0018485 | 3300048906 | Bacteria | 4180 |
| 436 | Ga0496103_0036159 | 3300048906 | Bacteria | 3024 |
| 437 | Ga0496103_0291843 | 3300048906 | Bacteria | 1049 |
| 438 | Ga0496104_0037438 | 3300048907 | Bacteria | 4537 |
| 439 | Ga0496104_0145578 | 3300048907 | Bacteria | 2275 |
| 440 | Ga0496105_0040695 | 3300048908 | Bacteria | 3832 |
| 441 | Ga0496106_0004127 | 3300048909 | Bacteria | 10825 |
| 442 | Ga0496107_0005217 | 3300048910 | Bacteria | 8870 |
| 443 | Ga0496108_0017449 | 3300048911 | Bacteria | 5873 |
| 444 | Ga0496108_0289760 | 3300048911 | Bacteria | 1425 |
| 445 | Ga0496109_0151602 | 3300048912 | Bacteria | 2170 |
| 446 | Ga0496109_0353578 | 3300048912 | Bacteria | 1388 |
| 447 | Ga0496109_0546009 | 3300048912 | Bacteria | 1093 |
| 448 | Ga0496110_0032770 | 3300048913 | Bacteria | 4491 |
| 449 | Ga0496110_0059519 | 3300048913 | Bacteria | 3367 |
| 450 | Ga0496111_0056586 | 3300048914 | Bacteria | 2837 |
| 451 | Ga0496111_0099018 | 3300048914 | Bacteria | 2141 |
| 452 | Ga0496112_0324546 | 3300048915 | Bacteria | 1483 |
| 453 | Ga0496113_0011540 | 3300048916 | Bacteria | 5901 |
| 454 | Ga0496113_0693574 | 3300048916 | Bacteria | 813 |
| 455 | Ga0496114_0020434 | 3300048917 | Bacteria | 5375 |
| 456 | Ga0496115_0703053 | 3300048918 | Bacteria | 794 |
| 457 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 458 | Ga0496117_0002537 | 3300048920 | Bacteria | 22802 |
| 459 | Ga0496118_0051401 | 3300048921 | Bacteria | 3153 |
| 460 | Ga0496118_0052343 | 3300048921 | Bacteria | 3115 |
| 461 | Ga0496118_0056128 | 3300048921 | Bacteria | 2963 |
| 462 | Ga0496119_0014326 | 3300048922 | Bacteria | 6218 |
| 463 | Ga0496119_0041645 | 3300048922 | Bacteria | 2922 |
| 464 | Ga0496120_0022737 | 3300048923 | Bacteria | 3941 |
| 465 | Ga0496120_0141626 | 3300048923 | Bacteria | 1220 |
| 466 | Ga0496120_0284805 | 3300048923 | Bacteria | 762 |
| 467 | Ga0496121_0000031 | 3300048924 | Bacteria | 384119 |
| 468 | Ga0496121_0000136 | 3300048924 | Bacteria | 165350 |
| 469 | Ga0496121_0005190 | 3300048924 | Bacteria | 16883 |
| 470 | Ga0496121_0040965 | 3300048924 | Bacteria | 4055 |
| 471 | Ga0496122_0008028 | 3300048925 | Bacteria | 11524 |
| 472 | Ga0496122_0009631 | 3300048925 | Bacteria | 10115 |
| 473 | Ga0496122_0111886 | 3300048925 | Bacteria | 1789 |
| 474 | Ga0496123_0003623 | 3300048926 | Bacteria | 17095 |
| 475 | Ga0496123_0085572 | 3300048926 | Bacteria | 1896 |
| 476 | Ga0496123_0091203 | 3300048926 | Bacteria | 1808 |
| 477 | Ga0496123_0128746 | 3300048926 | Bacteria | 1407 |
| 478 | Ga0496124_0005247 | 3300048927 | Bacteria | 14676 |
| 479 | Ga0496124_0005829 | 3300048927 | Bacteria | 13673 |
| 480 | Ga0496124_0068836 | 3300048927 | Bacteria | 2940 |
| 481 | Ga0496124_0241315 | 3300048927 | Bacteria | 1343 |
| 482 | Ga0496125_0018829 | 3300048928 | Bacteria | 6538 |
| 483 | Ga0496125_0024671 | 3300048928 | Bacteria | 5523 |
| 484 | Ga0496126_0000084 | 3300048929 | Bacteria | 217111 |
| 485 | Ga0496126_0058301 | 3300048929 | Bacteria | 3481 |
| 486 | Ga0496126_0124609 | 3300048929 | Bacteria | 2231 |
| 487 | Ga0496126_0148093 | 3300048929 | Bacteria | 2014 |
| 488 | Ga0496126_0545030 | 3300048929 | Bacteria | 921 |
| 489 | Ga0501310_009069 | 3300049130 | Bacteria | 1090 |
| 490 | Ga0501307_002308 | 3300049162 | Bacteria | 1760 |
| 491 | Ga0501311_011720 | 3300049527 | Bacteria | 1085 |
| 492 | Ga0501312_010889 | 3300049528 | Bacteria | 1226 |
| 493 | Ga0501318_013220 | 3300049534 | Bacteria | 956 |
| 494 | Ga0501318_019557 | 3300049534 | Bacteria | 846 |
| 495 | Ga0501324_031777 | 3300049540 | Bacteria | 579 |
| 496 | Ga0501034_0310441 | 3300049571 | Bacteria | 1512 |
| 497 | Ga0501038_0153974 | 3300049574 | Bacteria | 1873 |
| 498 | Ga0501038_0612680 | 3300049574 | Bacteria | 823 |
| 499 | Ga0501039_0110912 | 3300049575 | Bacteria | 2145 |
| 500 | Ga0501041_0079160 | 3300049577 | Bacteria | 2023 |
| 501 | Ga0501047_0541197 | 3300049581 | Bacteria | 989 |
| 502 | Ga0501071_0068245 | 3300049587 | Bacteria | 2587 |
| 503 | Ga0501075_0057064 | 3300049591 | Bacteria | 2940 |
| 504 | Ga0501075_0159159 | 3300049591 | Bacteria | 1723 |
| 505 | Ga0501076_0023871 | 3300049592 | Bacteria | 4718 |
| 506 | Ga0501077_0030811 | 3300049593 | Bacteria | 3414 |
| 507 | Ga0501253_010293 | 3300049683 | Bacteria | 1404 |
| 508 | Ga0501079_0471340 | 3300049741 | Bacteria | 986 |
| 509 | Ga0501080_0144875 | 3300049742 | Bacteria | 2196 |
| 510 | Ga0501080_0600744 | 3300049742 | Bacteria | 977 |
| 511 | Ga0501035_0701899 | 3300049822 | Bacteria | 816 |
| 512 | Ga0501035_0817170 | 3300049822 | Bacteria | 744 |
| 513 | Ga0501044_0021221 | 3300049823 | Bacteria | 6933 |
| 514 | Ga0501044_0614444 | 3300049823 | Bacteria | 979 |
| 515 | nmdc:mga03683_129576_c1 | 3300050489 | Bacteria | 1127 |
| 516 | nmdc:mga03683_31_c1 | 3300050489 | Bacteria | 69502 |
| 517 | nmdc:mga03683_86394_c1 | 3300050489 | Bacteria | 1362 |
| 518 | nmdc:mga03n38_4566_c1 | 3300050490 | Bacteria | 4608 |
| 519 | nmdc:mga03n38_78102_c1 | 3300050490 | Bacteria | 1549 |
| 520 | nmdc:mga00v17_131476_c1 | 3300050491 | Bacteria | 1600 |
| 521 | nmdc:mga00v17_195100_c1 | 3300050491 | Bacteria | 1308 |
| 522 | nmdc:mga00v17_3048_c1 | 3300050491 | Bacteria | 8615 |
| 523 | nmdc:mga00v17_4783_c1 | 3300050491 | Bacteria | 3192 |
| 524 | nmdc:mga0yw44_172505_c1 | 3300050492 | Bacteria | 1421 |
| 525 | nmdc:mga0k408_18_c1 | 3300050493 | Bacteria | 112318 |
| 526 | nmdc:mga0k408_52034_c1 | 3300050493 | Bacteria | 2373 |
| 527 | nmdc:mga0k408_77479_c1 | 3300050493 | Bacteria | 1944 |
| 528 | nmdc:mga06z11_517_c1 | 3300050494 | Bacteria | 14236 |
| 529 | nmdc:mga04h51_91_c1 | 3300050495 | Bacteria | 28026 |
| 530 | nmdc:mga07m45_12983_c1 | 3300050496 | Bacteria | 4406 |
| 531 | nmdc:mga07m45_164_c1 | 3300050496 | Bacteria | 26629 |
| 532 | nmdc:mga07m45_19_c1 | 3300050496 | Bacteria | 133476 |
| 533 | nmdc:mga0sz30_10969_c1 | 3300050516 | Bacteria | 3486 |
| 534 | nmdc:mga0sz30_132684_c1 | 3300050516 | Bacteria | 1098 |
| 535 | nmdc:mga0sz30_163581_c1 | 3300050516 | Bacteria | 986 |
| 536 | nmdc:mga0sz30_167_c1 | 3300050516 | Bacteria | 24409 |
| 537 | nmdc:mga0sz30_6381_c2 | 3300050516 | Bacteria | 3871 |
| 538 | Ga0495601_0005148 | 3300053077 | Bacteria | 7599 |
| 539 | Ga0495612_0001186 | 3300053078 | Bacteria | 10745 |
| 540 | Ga0495595_0114179 | 3300053084 | Bacteria | 1312 |
| 541 | Ga0495619_0008993 | 3300053085 | Bacteria | 6303 |
| 542 | Ga0500643_030855 | 3300053087 | Bacteria | 1638 |
| 543 | Ga0500647_0116128 | 3300053091 | Bacteria | 1269 |
| 544 | Ga0500562_045321 | 3300053108 | Bacteria | 1172 |
| 545 | Ga0500594_0005507 | 3300053118 | Bacteria | 2809 |
| 546 | Ga0500595_068569 | 3300053119 | Bacteria | 1056 |
| 547 | Ga0500607_005191 | 3300053121 | Bacteria | 8593 |
| 548 | Ga0500607_010159 | 3300053121 | Bacteria | 5622 |
| 549 | Ga0500608_000284 | 3300053122 | Bacteria | 19721 |
| 550 | Ga0500618_012335 | 3300053125 | Bacteria | 2239 |
| 551 | Ga0500655_000570 | 3300053133 | Bacteria | 7397 |
| 552 | Ga0500559_0022505 | 3300053136 | Bacteria | 2672 |
| 553 | Ga0500559_0054969 | 3300053136 | Bacteria | 1764 |
| 554 | Ga0500564_002258 | 3300053138 | Bacteria | 7055 |
| 555 | Ga0500568_0092028 | 3300053139 | Bacteria | 1143 |
| 556 | Ga0500590_003606 | 3300053148 | Bacteria | 7176 |
| 557 | Ga0500590_096832 | 3300053148 | Bacteria | 1423 |
| 558 | Ga0500604_0076435 | 3300053151 | Bacteria | 1076 |
| 559 | Ga0500622_0002768 | 3300053156 | Bacteria | 12339 |
| 560 | Ga0500627_0072415 | 3300053158 | Bacteria | 1528 |
| 561 | Ga0500637_0226026 | 3300053178 | Bacteria | 1056 |
| 562 | Ga0500567_003882 | 3300053723 | Bacteria | 6741 |
| 563 | Ga0500625_000002 | 3300053729 | Bacteria | 371909 |
| 564 | Ga0500645_004674 | 3300053730 | Bacteria | 5209 |
| 565 | Ga0500645_008472 | 3300053730 | Bacteria | 3510 |
| 566 | Ga0587070_001986 | 3300059491 | Bacteria | 2238 |
| 567 | Ga0587077_000001 | 3300059493 | Bacteria | 12872 |
| 568 | Ga0587082_000512 | 3300059504 | Bacteria | 3301 |
| 569 | Ga0587085_003253 | 3300059506 | Bacteria | 1747 |
| 570 | Ga0587086_003087 | 3300059507 | Bacteria | 1644 |
| 571 | Ga0587090_000037 | 3300059510 | Bacteria | 7126 |
| 572 | Ga0587072_003713 | 3300059643 | Bacteria | 2167 |
| 573 | Ga0587076_002352 | 3300059645 | Bacteria | 2107 |
| 574 | Ga0587111_0028178 | 3300060346 | Bacteria | 1130 |
| 575 | Ga0530510_0039009 | 3300061734 | Bacteria | 3429 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005577 | Ga0068857_100123572 | Ga0068857_1001235723 | 170 |
| 2 | 3300009545 | Ga0105237_10002858 | Ga0105237_1000285824 | 170 |
| 3 | 3300025914 | Ga0207671_10043377 | Ga0207671_100433772 | 170 |
| 4 | 3300025981 | Ga0207640_10146592 | Ga0207640_101465922 | 170 |
| 5 | 3300026116 | Ga0207674_10099906 | Ga0207674_100999063 | 170 |
| 6 | 3300048925 | Ga0496122_0111886 | Ga0496122_0111886_1003_1629 | 170 |
| 7 | 3300049540 | Ga0501324_031777 | Ga0501324_031777_33_548 | 170 |
| 8 | 3300039437 | Ga0436365_0340931 | Ga0436365_0340931_529_1158 | 174 |
| 9 | 3300048926 | Ga0496123_0091203 | Ga0496123_0091203_591_1217 | 175 |
| 10 | 3300048927 | Ga0496124_0005829 | Ga0496124_0005829_12457_13083 | 175 |
| 11 | 3300005335 | Ga0070666_10204101 | Ga0070666_102041013 | 177 |
| 12 | 3300005367 | Ga0070667_100000088 | Ga0070667_10000008857 | 177 |
| 13 | 3300005841 | Ga0068863_100008669 | Ga0068863_1000086692 | 177 |
| 14 | 3300005843 | Ga0068860_100000220 | Ga0068860_10000022037 | 177 |
| 15 | 3300025903 | Ga0207680_10151589 | Ga0207680_101515892 | 177 |
| 16 | 3300025986 | Ga0207658_10000064 | Ga0207658_1000006460 | 177 |
| 17 | 3300026088 | Ga0207641_10003421 | Ga0207641_100034212 | 177 |
| 18 | 3300028381 | Ga0268264_10000384 | Ga0268264_100003843 | 177 |
| 19 | 3300031911 | Ga0307412_10077699 | Ga0307412_100776994 | 177 |
| 20 | 3300032002 | Ga0307416_100489888 | Ga0307416_1004898883 | 177 |
| 21 | 3300048923 | Ga0496120_0284805 | Ga0496120_0284805_58_684 | 177 |
| 22 | 3300048927 | Ga0496124_0241315 | Ga0496124_0241315_564_1190 | 177 |
| 23 | 3300006237 | Ga0097621_100698497 | Ga0097621_1006984972 | 179 |
| 24 | 3300046542 | Ga0495597_0015301 | Ga0495597_0015301_229_855 | 181 |
| 25 | 3300009101 | Ga0105247_10290639 | Ga0105247_102906392 | 182 |
| 26 | 3300009553 | Ga0105249_10352460 | Ga0105249_103524602 | 182 |
| 27 | 3300005578 | Ga0068854_100009263 | Ga0068854_10000926310 | 183 |
| 28 | 3300012513 | Ga0157326_1000431 | Ga0157326_10004315 | 183 |
| 29 | 3300025981 | Ga0207640_10060540 | Ga0207640_100605403 | 183 |
| 30 | 3300035170 | Ga0373943_0053387 | Ga0373943_0053387_943_1569 | 183 |
| 31 | 3300046522 | Ga0495643_0019518 | Ga0495643_0019518_2491_3117 | 183 |
| 32 | 3300046616 | Ga0495668_0107355 | Ga0495668_0107355_332_958 | 183 |
| 33 | 3300048928 | Ga0496125_0018829 | Ga0496125_0018829_2820_3446 | 183 |
| 34 | 3300053125 | Ga0500618_012335 | Ga0500618_012335_211_837 | 183 |
| 35 | 3300053133 | Ga0500655_000570 | Ga0500655_000570_4495_5121 | 183 |
| 36 | 3300053148 | Ga0500590_003606 | Ga0500590_003606_2080_2706 | 183 |
| 37 | 3300006353 | Ga0075370_10063490 | Ga0075370_100634901 | 186 |
| 38 | 3300006051 | Ga0075364_10001520 | Ga0075364_1000152021 | 188 |
| 39 | 3300006177 | Ga0075362_10085808 | Ga0075362_100858082 | 188 |
| 40 | 3300006186 | Ga0075369_10010979 | Ga0075369_100109793 | 188 |
| 41 | 3300050489 | nmdc:mga03683_86394_c1 | nmdc:mga03683_86394_c1_497_1123 | 188 |
| 42 | 3300050491 | nmdc:mga00v17_4783_c1 | nmdc:mga00v17_4783_c1_390_1016 | 188 |
| 43 | 3300050516 | nmdc:mga0sz30_10969_c1 | nmdc:mga0sz30_10969_c1_1214_1840 | 188 |
| 44 | 3300014968 | Ga0157379_10366262 | Ga0157379_103662622 | 189 |
| 45 | 3300002459 | JGI24751J29686_10000325 | JGI24751J29686_100003259 | 190 |
| 46 | 3300005295 | Ga0065707_10007537 | Ga0065707_100075375 | 190 |
| 47 | 3300005331 | Ga0070670_100024275 | Ga0070670_1000242759 | 190 |
| 48 | 3300005347 | Ga0070668_100352101 | Ga0070668_1003521012 | 190 |
| 49 | 3300005367 | Ga0070667_100019254 | Ga0070667_1000192545 | 190 |
| 50 | 3300005617 | Ga0068859_100006387 | Ga0068859_1000063879 | 190 |
| 51 | 3300005618 | Ga0068864_100014199 | Ga0068864_1000141994 | 190 |
| 52 | 3300005719 | Ga0068861_100002700 | Ga0068861_1000027006 | 190 |
| 53 | 3300005844 | Ga0068862_100000126 | Ga0068862_10000012610 | 190 |
| 54 | 3300006931 | Ga0097620_100006388 | Ga0097620_1000063889 | 190 |
| 55 | 3300009177 | Ga0105248_10052852 | Ga0105248_100528524 | 190 |
| 56 | 3300013306 | Ga0163162_10207028 | Ga0163162_102070282 | 190 |
| 57 | 3300014325 | Ga0163163_10093123 | Ga0163163_100931233 | 190 |
| 58 | 3300014326 | Ga0157380_10032640 | Ga0157380_100326404 | 190 |
| 59 | 3300017792 | Ga0163161_10130698 | Ga0163161_101306981 | 190 |
| 60 | 3300025903 | Ga0207680_10379343 | Ga0207680_103793432 | 190 |
| 61 | 3300025923 | Ga0207681_10000005 | Ga0207681_1000000571 | 190 |
| 62 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004650 | 190 |
| 63 | 3300025972 | Ga0207668_10123359 | Ga0207668_101233592 | 190 |
| 64 | 3300025986 | Ga0207658_10005381 | Ga0207658_100053816 | 190 |
| 65 | 3300026095 | Ga0207676_10000006 | Ga0207676_1000000662 | 190 |
| 66 | 3300026118 | Ga0207675_100001117 | Ga0207675_10000111732 | 190 |
| 67 | 3300028380 | Ga0268265_10000001 | Ga0268265_100000011116 | 190 |
| 68 | 3300049591 | Ga0501075_0057064 | Ga0501075_0057064_1093_1677 | 193 |
| 69 | 3300061734 | Ga0530510_0039009 | Ga0530510_0039009_2121_2705 | 193 |
| 70 | 3300001979 | JGI24740J21852_10008905 | JGI24740J21852_100089052 | 195 |
| 71 | 3300031911 | Ga0307412_10001378 | Ga0307412_1000137817 | 195 |
| 72 | 3300049571 | Ga0501034_0310441 | Ga0501034_0310441_812_1462 | 197 |
| 73 | 3300049581 | Ga0501047_0541197 | Ga0501047_0541197_239_892 | 198 |
| 74 | 3300049742 | Ga0501080_0144875 | Ga0501080_0144875_1426_2079 | 198 |
| 75 | 3300053121 | Ga0500607_005191 | Ga0500607_005191_2012_2638 | 198 |
| 76 | 3300053136 | Ga0500559_0054969 | Ga0500559_0054969_355_981 | 198 |
| 77 | 3300053148 | Ga0500590_096832 | Ga0500590_096832_385_1011 | 198 |
| 78 | 3300053178 | Ga0500637_0226026 | Ga0500637_0226026_94_720 | 198 |
| 79 | 3300053730 | Ga0500645_004674 | Ga0500645_004674_2352_2978 | 198 |
| 80 | iso_pu_bacteria | 2830075706 | 2830079060 | 199 |
| 81 | iso_pu_bacteria | 2842775625 | 2842778814 | 200 |
| 82 | iso_pu_bacteria | 2894772417 | 2894774429 | 200 |
| 83 | iso_pu_bacteria | 2929199973 | 2929200704 | 200 |
| 84 | iso_pu_bacteria | 8055909800 | 8055913921 | 200 |
| 85 | 3300035118 | Ga0373954_0040905 | Ga0373954_0040905_391_1032 | 201 |
| 86 | 3300025928 | Ga0207700_10830337 | Ga0207700_108303372 | 202 |
| 87 | 3300005456 | Ga0070678_100149989 | Ga0070678_1001499894 | 203 |
| 88 | 3300011119 | Ga0105246_10461360 | Ga0105246_104613602 | 203 |
| 89 | 3300021388 | Ga0213875_10008279 | Ga0213875_100082796 | 203 |
| 90 | 3300021441 | Ga0213871_10013452 | Ga0213871_100134524 | 203 |
| 91 | 3300025909 | Ga0207705_10345673 | Ga0207705_103456732 | 203 |
| 92 | 3300026023 | Ga0207677_10696806 | Ga0207677_106968061 | 203 |
| 93 | 3300026121 | Ga0207683_10300692 | Ga0207683_103006922 | 203 |
| 94 | 3300037853 | Ga0436364_0866406 | Ga0436364_0866406_2436_3071 | 203 |
| 95 | 3300037853 | Ga0436364_1453650 | Ga0436364_1453650_344_958 | 203 |
| 96 | 3300039438 | Ga0436360_0712409 | Ga0436360_0712409_1501_2115 | 203 |
| 97 | 3300039438 | Ga0436360_0851339 | Ga0436360_0851339_24_638 | 203 |
| 98 | 3300039447 | Ga0436361_0808720 | Ga0436361_0808720_212_826 | 203 |
| 99 | 3300039447 | Ga0436361_1156340 | Ga0436361_1156340_447_1061 | 203 |
| 100 | 3300039450 | Ga0436363_0130967 | Ga0436363_0130967_378_992 | 203 |
| 101 | 3300039450 | Ga0436363_1180028 | Ga0436363_1180028_233_847 | 203 |
| 102 | 3300046511 | Ga0495608_0063375 | Ga0495608_0063375_1062_1706 | 203 |
| 103 | 3300046514 | Ga0495618_0453623 | Ga0495618_0453623_58_702 | 203 |
| 104 | 3300046663 | Ga0495635_0033840 | Ga0495635_0033840_870_1514 | 203 |
| 105 | 3300047443 | Ga0495687_112923 | Ga0495687_112923_215_841 | 203 |
| 106 | 3300047471 | Ga0495684_0030744 | Ga0495684_0030744_3438_4082 | 203 |
| 107 | 3300053091 | Ga0500647_0116128 | Ga0500647_0116128_281_907 | 203 |
| 108 | 3300053122 | Ga0500608_000284 | Ga0500608_000284_1127_1753 | 203 |
| 109 | 3300053136 | Ga0500559_0022505 | Ga0500559_0022505_36_662 | 203 |
| 110 | 3300053138 | Ga0500564_002258 | Ga0500564_002258_527_1153 | 203 |
| 111 | 3300053723 | Ga0500567_003882 | Ga0500567_003882_4464_5090 | 203 |
| 112 | 3300053729 | Ga0500625_000002 | Ga0500625_000002_215186_215812 | 203 |
| 113 | iso_pu_bacteria | 2582581305 | 2585262490 | 203 |
| 114 | iso_pu_bacteria | 2599185359 | 2600225732 | 203 |
| 115 | iso_pu_bacteria | 2643221541 | 2643729045 | 203 |
| 116 | iso_pu_bacteria | 2643221605 | 2644039620 | 203 |
| 117 | iso_pu_bacteria | 2643221606 | 2644045058 | 203 |
| 118 | iso_pu_bacteria | 2643221671 | 2644391231 | 203 |
| 119 | iso_pu_bacteria | 2818991466 | 2819716466 | 203 |
| 120 | iso_pu_bacteria | 2848297114 | 2848298229 | 203 |
| 121 | iso_pu_bacteria | 2879163058 | 2879165249 | 203 |
| 122 | iso_pu_bacteria | 2882806704 | 2882808227 | 203 |
| 123 | iso_pu_bacteria | 2895880812 | 2895882713 | 203 |
| 124 | iso_pu_bacteria | 2928027323 | 2928028504 | 203 |
| 125 | iso_pu_bacteria | 2928526807 | 2928528725 | 203 |
| 126 | iso_pu_bacteria | 2928968154 | 2928970277 | 203 |
| 127 | iso_pu_bacteria | 2984555340 | 2984555920 | 203 |
| 128 | iso_pu_bacteria | 2984564862 | 2984565974 | 203 |
| 129 | iso_pu_bacteria | 2993356040 | 2993356983 | 203 |
| 130 | 3300003203 | JGI25406J46586_10001890 | JGI25406J46586_1000189019 | 204 |
| 131 | 3300003781 | Ga0055536_1007883 | Ga0055536_10078833 | 204 |
| 132 | 3300004803 | Ga0058862_12358730 | Ga0058862_123587303 | 204 |
| 133 | 3300005329 | Ga0070683_100606046 | Ga0070683_1006060462 | 204 |
| 134 | 3300005336 | Ga0070680_100205764 | Ga0070680_1002057643 | 204 |
| 135 | 3300005435 | Ga0070714_100029929 | Ga0070714_1000299292 | 204 |
| 136 | 3300005436 | Ga0070713_100001675 | Ga0070713_10000167524 | 204 |
| 137 | 3300005436 | Ga0070713_100070192 | Ga0070713_1000701924 | 204 |
| 138 | 3300005436 | Ga0070713_100389647 | Ga0070713_1003896472 | 204 |
| 139 | 3300005439 | Ga0070711_100263075 | Ga0070711_1002630752 | 204 |
| 140 | 3300005439 | Ga0070711_100578006 | Ga0070711_1005780062 | 204 |
| 141 | 3300005548 | Ga0070665_101072993 | Ga0070665_1010729931 | 204 |
| 142 | 3300005614 | Ga0068856_100242910 | Ga0068856_1002429103 | 204 |
| 143 | 3300005614 | Ga0068856_100549835 | Ga0068856_1005498353 | 204 |
| 144 | 3300005616 | Ga0068852_100563934 | Ga0068852_1005639342 | 204 |
| 145 | 3300005985 | Ga0081539_10000072 | Ga0081539_100000724 | 204 |
| 146 | 3300006028 | Ga0070717_10085206 | Ga0070717_100852062 | 204 |
| 147 | 3300006028 | Ga0070717_10179677 | Ga0070717_101796772 | 204 |
| 148 | 3300006175 | Ga0070712_100004619 | Ga0070712_1000046192 | 204 |
| 149 | 3300006186 | Ga0075369_10091481 | Ga0075369_100914812 | 204 |
| 150 | 3300009098 | Ga0105245_10261274 | Ga0105245_102612742 | 204 |
| 151 | 3300009176 | Ga0105242_11552165 | Ga0105242_115521651 | 204 |
| 152 | 3300010375 | Ga0105239_10377514 | Ga0105239_103775141 | 204 |
| 153 | 3300014325 | Ga0163163_10151103 | Ga0163163_101511032 | 204 |
| 154 | 3300014497 | Ga0182008_10371231 | Ga0182008_103712311 | 204 |
| 155 | 3300020080 | Ga0206350_10208363 | Ga0206350_102083631 | 204 |
| 156 | 3300021388 | Ga0213875_10014923 | Ga0213875_100149232 | 204 |
| 157 | 3300021441 | Ga0213871_10012207 | Ga0213871_100122072 | 204 |
| 158 | 3300025292 | Ga0209676_1000092 | Ga0209676_10000924 | 204 |
| 159 | 3300025298 | Ga0209050_1040571 | Ga0209050_10405713 | 204 |
| 160 | 3300025906 | Ga0207699_10321316 | Ga0207699_103213163 | 204 |
| 161 | 3300025915 | Ga0207693_10029783 | Ga0207693_100297834 | 204 |
| 162 | 3300025916 | Ga0207663_10603548 | Ga0207663_106035481 | 204 |
| 163 | 3300025917 | Ga0207660_10377463 | Ga0207660_103774633 | 204 |
| 164 | 3300025924 | Ga0207694_10483360 | Ga0207694_104833602 | 204 |
| 165 | 3300025929 | Ga0207664_10075173 | Ga0207664_100751734 | 204 |
| 166 | 3300025941 | Ga0207711_10020060 | Ga0207711_100200607 | 204 |
| 167 | 3300026078 | Ga0207702_10272141 | Ga0207702_102721413 | 204 |
| 168 | 3300026089 | Ga0207648_10855189 | Ga0207648_108551892 | 204 |
| 169 | 3300026116 | Ga0207674_10896968 | Ga0207674_108969682 | 204 |
| 170 | 3300026142 | Ga0207698_10495876 | Ga0207698_104958763 | 204 |
| 171 | 3300028379 | Ga0268266_10893062 | Ga0268266_108930622 | 204 |
| 172 | 3300028800 | Ga0265338_10008853 | Ga0265338_100088534 | 204 |
| 173 | 3300028800 | Ga0265338_10301074 | Ga0265338_103010742 | 204 |
| 174 | 3300029957 | Ga0265324_10004791 | Ga0265324_100047913 | 204 |
| 175 | 3300031239 | Ga0265328_10034096 | Ga0265328_100340963 | 204 |
| 176 | 3300031250 | Ga0265331_10000543 | Ga0265331_1000054350 | 204 |
| 177 | 3300032004 | Ga0307414_10108978 | Ga0307414_101089782 | 204 |
| 178 | 3300032168 | Ga0316593_10070083 | Ga0316593_100700832 | 204 |
| 179 | 3300035113 | Ga0373936_0065571 | Ga0373936_0065571_729_1382 | 204 |
| 180 | 3300035117 | Ga0373953_0004557 | Ga0373953_0004557_1021_1671 | 204 |
| 181 | 3300035120 | Ga0373957_0007801 | Ga0373957_0007801_998_1648 | 204 |
| 182 | 3300035171 | Ga0373946_0250961 | Ga0373946_0250961_184_837 | 204 |
| 183 | 3300035410 | Ga0373924_0049234 | Ga0373924_0049234_324_977 | 204 |
| 184 | 3300035410 | Ga0373924_0071221 | Ga0373924_0071221_750_1388 | 204 |
| 185 | 3300035695 | Ga0373927_0134843 | Ga0373927_0134843_269_919 | 204 |
| 186 | 3300035695 | Ga0373927_0398801 | Ga0373927_0398801_155_802 | 204 |
| 187 | 3300035724 | Ga0373933_0019715 | Ga0373933_0019715_768_1418 | 204 |
| 188 | 3300035725 | Ga0373947_0036450 | Ga0373947_0036450_274_924 | 204 |
| 189 | 3300036401 | Ga0373937_0000922 | Ga0373937_0000922_19519_20169 | 204 |
| 190 | 3300036401 | Ga0373937_0061124 | Ga0373937_0061124_476_1129 | 204 |
| 191 | 3300036401 | Ga0373937_0074325 | Ga0373937_0074325_1276_1914 | 204 |
| 192 | 3300036401 | Ga0373937_0144757 | Ga0373937_0144757_814_1461 | 204 |
| 193 | 3300037068 | Ga0373925_0008231 | Ga0373925_0008231_6254_6904 | 204 |
| 194 | 3300037068 | Ga0373925_0095519 | Ga0373925_0095519_1071_1724 | 204 |
| 195 | 3300037068 | Ga0373925_0220977 | Ga0373925_0220977_82_732 | 204 |
| 196 | 3300037068 | Ga0373925_0270235 | Ga0373925_0270235_44_682 | 204 |
| 197 | 3300037853 | Ga0436364_0000682 | Ga0436364_0000682_188_817 | 204 |
| 198 | 3300037853 | Ga0436364_0586291 | Ga0436364_0586291_1308_2000 | 204 |
| 199 | 3300039437 | Ga0436365_1337727 | Ga0436365_1337727_308_937 | 204 |
| 200 | 3300039437 | Ga0436365_1915576 | Ga0436365_1915576_558_1268 | 204 |
| 201 | 3300039438 | Ga0436360_0452772 | Ga0436360_0452772_751_1416 | 204 |
| 202 | 3300039438 | Ga0436360_0639768 | Ga0436360_0639768_1075_1737 | 204 |
| 203 | 3300039438 | Ga0436360_1332781 | Ga0436360_1332781_1635_2300 | 204 |
| 204 | 3300039447 | Ga0436361_0278088 | Ga0436361_0278088_3256_3903 | 204 |
| 205 | 3300039447 | Ga0436361_0718732 | Ga0436361_0718732_158_820 | 204 |
| 206 | 3300039447 | Ga0436361_0907344 | Ga0436361_0907344_341_1003 | 204 |
| 207 | 3300039450 | Ga0436363_0301585 | Ga0436363_0301585_1055_1672 | 204 |
| 208 | 3300039453 | Ga0436362_0558767 | Ga0436362_0558767_174_917 | 204 |
| 209 | 3300039453 | Ga0436362_1070743 | Ga0436362_1070743_345_1007 | 204 |
| 210 | 3300044694 | Ga0466963_0193871 | Ga0466963_0193871_238_858 | 204 |
| 211 | 3300045836 | Ga0466958_0184377 | Ga0466958_0184377_611_1270 | 204 |
| 212 | 3300045836 | Ga0466958_0260636 | Ga0466958_0260636_244_972 | 204 |
| 213 | 3300045976 | Ga0466967_0600243 | Ga0466967_0600243_369_989 | 204 |
| 214 | 3300046454 | Ga0495592_0089301 | Ga0495592_0089301_943_1593 | 204 |
| 215 | 3300046459 | Ga0495629_0482080 | Ga0495629_0482080_130_768 | 204 |
| 216 | 3300046462 | Ga0495651_0078288 | Ga0495651_0078288_1372_2025 | 204 |
| 217 | 3300046462 | Ga0495651_0246566 | Ga0495651_0246566_50_700 | 204 |
| 218 | 3300046463 | Ga0495653_0213658 | Ga0495653_0213658_150_788 | 204 |
| 219 | 3300046473 | Ga0495582_0290773 | Ga0495582_0290773_46_696 | 204 |
| 220 | 3300046477 | Ga0495664_0026792 | Ga0495664_0026792_1534_2184 | 204 |
| 221 | 3300046499 | Ga0495594_0334035 | Ga0495594_0334035_136_786 | 204 |
| 222 | 3300046511 | Ga0495608_0025697 | Ga0495608_0025697_2182_2832 | 204 |
| 223 | 3300046516 | Ga0495628_0085528 | Ga0495628_0085528_163_813 | 204 |
| 224 | 3300046533 | Ga0495640_0031131 | Ga0495640_0031131_672_1322 | 204 |
| 225 | 3300046536 | Ga0495587_0045036 | Ga0495587_0045036_1792_2442 | 204 |
| 226 | 3300046543 | Ga0495645_0006077 | Ga0495645_0006077_6249_6899 | 204 |
| 227 | 3300046559 | Ga0495667_0047390 | Ga0495667_0047390_904_1554 | 204 |
| 228 | 3300046559 | Ga0495667_0145498 | Ga0495667_0145498_33_686 | 204 |
| 229 | 3300046663 | Ga0495635_0128144 | Ga0495635_0128144_300_950 | 204 |
| 230 | 3300046675 | Ga0495657_0110681 | Ga0495657_0110681_758_1408 | 204 |
| 231 | 3300046678 | Ga0495599_0382309 | Ga0495599_0382309_161_811 | 204 |
| 232 | 3300046680 | Ga0495646_0115336 | Ga0495646_0115336_214_864 | 204 |
| 233 | 3300046683 | Ga0495658_0229094 | Ga0495658_0229094_443_1093 | 204 |
| 234 | 3300046809 | Ga0495600_0321218 | Ga0495600_0321218_79_729 | 204 |
| 235 | 3300047322 | Ga0495680_0343730 | Ga0495680_0343730_15_668 | 204 |
| 236 | 3300047444 | Ga0495675_0014092 | Ga0495675_0014092_2425_3075 | 204 |
| 237 | 3300047471 | Ga0495684_0107081 | Ga0495684_0107081_1329_1982 | 204 |
| 238 | 3300047471 | Ga0495684_0302264 | Ga0495684_0302264_186_836 | 204 |
| 239 | 3300047673 | Ga0495593_0336938 | Ga0495593_0336938_66_716 | 204 |
| 240 | 3300048088 | Ga0495602_0000485 | Ga0495602_0000485_26291_26941 | 204 |
| 241 | 3300048912 | Ga0496109_0353578 | Ga0496109_0353578_312_932 | 204 |
| 242 | 3300048922 | Ga0496119_0014326 | Ga0496119_0014326_1221_1883 | 204 |
| 243 | 3300048929 | Ga0496126_0545030 | Ga0496126_0545030_222_878 | 204 |
| 244 | 3300049130 | Ga0501310_009069 | Ga0501310_009069_170_787 | 204 |
| 245 | 3300049162 | Ga0501307_002308 | Ga0501307_002308_233_850 | 204 |
| 246 | 3300049527 | Ga0501311_011720 | Ga0501311_011720_34_651 | 204 |
| 247 | 3300049528 | Ga0501312_010889 | Ga0501312_010889_75_692 | 204 |
| 248 | 3300049534 | Ga0501318_013220 | Ga0501318_013220_33_650 | 204 |
| 249 | 3300049534 | Ga0501318_019557 | Ga0501318_019557_177_797 | 204 |
| 250 | 3300049574 | Ga0501038_0612680 | Ga0501038_0612680_95_712 | 204 |
| 251 | 3300049591 | Ga0501075_0159159 | Ga0501075_0159159_856_1473 | 204 |
| 252 | 3300053077 | Ga0495601_0005148 | Ga0495601_0005148_665_1315 | 204 |
| 253 | 3300053078 | Ga0495612_0001186 | Ga0495612_0001186_9805_10455 | 204 |
| 254 | 3300053084 | Ga0495595_0114179 | Ga0495595_0114179_406_1059 | 204 |
| 255 | 3300053085 | Ga0495619_0008993 | Ga0495619_0008993_1641_2291 | 204 |
| 256 | iso_pu_bacteria | 2510917021 | 2511127737 | 204 |
| 257 | iso_pu_bacteria | 2818991438 | 2819552563 | 204 |
| 258 | iso_pu_bacteria | 8054302542 | 8054304448 | 204 |
| 259 | 3300005548 | Ga0070665_100840700 | Ga0070665_1008407002 | 205 |
| 260 | 3300005563 | Ga0068855_100106749 | Ga0068855_1001067492 | 205 |
| 261 | 3300009093 | Ga0105240_10077028 | Ga0105240_100770286 | 205 |
| 262 | 3300021377 | Ga0213874_10021385 | Ga0213874_100213853 | 205 |
| 263 | 3300021388 | Ga0213875_10001918 | Ga0213875_1000191819 | 205 |
| 264 | 3300021388 | Ga0213875_10039023 | Ga0213875_100390234 | 205 |
| 265 | 3300021388 | Ga0213875_10070517 | Ga0213875_100705173 | 205 |
| 266 | 3300025913 | Ga0207695_10055829 | Ga0207695_100558296 | 205 |
| 267 | 3300028379 | Ga0268266_10843184 | Ga0268266_108431842 | 205 |
| 268 | 3300037853 | Ga0436364_0026312 | Ga0436364_0026312_4653_5330 | 205 |
| 269 | 3300037853 | Ga0436364_0052675 | Ga0436364_0052675_608_1237 | 205 |
| 270 | 3300037853 | Ga0436364_0242204 | Ga0436364_0242204_350_979 | 205 |
| 271 | 3300037853 | Ga0436364_0389284 | Ga0436364_0389284_1390_2058 | 205 |
| 272 | 3300037853 | Ga0436364_0727247 | Ga0436364_0727247_248_973 | 205 |
| 273 | 3300039437 | Ga0436365_0599891 | Ga0436365_0599891_1087_1743 | 205 |
| 274 | 3300039437 | Ga0436365_0636449 | Ga0436365_0636449_1418_2047 | 205 |
| 275 | 3300039438 | Ga0436360_0333232 | Ga0436360_0333232_2593_3261 | 205 |
| 276 | 3300039450 | Ga0436363_0409499 | Ga0436363_0409499_794_1447 | 205 |
| 277 | 3300039453 | Ga0436362_0446646 | Ga0436362_0446646_376_1032 | 205 |
| 278 | 3300045051 | Ga0451576_0273618 | Ga0451576_0273618_358_978 | 205 |
| 279 | 3300049574 | Ga0501038_0153974 | Ga0501038_0153974_1228_1848 | 205 |
| 280 | 3300049577 | Ga0501041_0079160 | Ga0501041_0079160_543_1163 | 205 |
| 281 | 3300049587 | Ga0501071_0068245 | Ga0501071_0068245_389_1009 | 205 |
| 282 | 3300049592 | Ga0501076_0023871 | Ga0501076_0023871_318_938 | 205 |
| 283 | 3300049593 | Ga0501077_0030811 | Ga0501077_0030811_2319_2939 | 205 |
| 284 | 3300049741 | Ga0501079_0471340 | Ga0501079_0471340_311_931 | 205 |
| 285 | 3300049742 | Ga0501080_0600744 | Ga0501080_0600744_261_887 | 205 |
| 286 | 3300005444 | Ga0070694_100101335 | Ga0070694_1001013354 | 206 |
| 287 | 3300005539 | Ga0068853_100001213 | Ga0068853_10000121315 | 206 |
| 288 | 3300005546 | Ga0070696_100114044 | Ga0070696_1001140442 | 206 |
| 289 | 3300005549 | Ga0070704_100320926 | Ga0070704_1003209262 | 206 |
| 290 | 3300005617 | Ga0068859_100001416 | Ga0068859_1000014166 | 206 |
| 291 | 3300005719 | Ga0068861_100000040 | Ga0068861_10000004020 | 206 |
| 292 | 3300006051 | Ga0075364_10263989 | Ga0075364_102639892 | 206 |
| 293 | 3300006880 | Ga0075429_100368822 | Ga0075429_1003688222 | 206 |
| 294 | 3300006931 | Ga0097620_100001416 | Ga0097620_10000141636 | 206 |
| 295 | 3300025931 | Ga0207644_10523860 | Ga0207644_105238602 | 206 |
| 296 | 3300025941 | Ga0207711_10023215 | Ga0207711_100232153 | 206 |
| 297 | 3300026118 | Ga0207675_100000157 | Ga0207675_10000015749 | 206 |
| 298 | 3300031456 | Ga0307513_10048601 | Ga0307513_100486016 | 206 |
| 299 | 3300034817 | Ga0373948_0046414 | Ga0373948_0046414_125_808 | 206 |
| 300 | 3300042876 | Ga0451577_0018151 | Ga0451577_0018151_5494_6177 | 206 |
| 301 | 3300046452 | Ga0495617_028132 | Ga0495617_028132_585_1208 | 206 |
| 302 | 3300046460 | Ga0495638_0000012 | Ga0495638_0000012_35873_36496 | 206 |
| 303 | 3300046506 | Ga0495583_0006701 | Ga0495583_0006701_2151_2774 | 206 |
| 304 | 3300046513 | Ga0495616_0000390 | Ga0495616_0000390_30344_30967 | 206 |
| 305 | 3300046519 | Ga0495632_0004429 | Ga0495632_0004429_3662_4285 | 206 |
| 306 | 3300046524 | Ga0495648_0000038 | Ga0495648_0000038_155117_155740 | 206 |
| 307 | 3300046558 | Ga0495633_0015715 | Ga0495633_0015715_2127_2750 | 206 |
| 308 | 3300046692 | Ga0495671_0000034 | Ga0495671_0000034_142615_143238 | 206 |
| 309 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_215316_215939 | 206 |
| 310 | 3300050491 | nmdc:mga00v17_195100_c1 | nmdc:mga00v17_195100_c1_15_662 | 206 |
| 311 | 3300053158 | Ga0500627_0072415 | Ga0500627_0072415_272_895 | 206 |
| 312 | 3300005289 | Ga0065704_10005096 | Ga0065704_100050967 | 207 |
| 313 | 3300005289 | Ga0065704_10133643 | Ga0065704_101336433 | 207 |
| 314 | 3300005327 | Ga0070658_10000808 | Ga0070658_100008083 | 207 |
| 315 | 3300005327 | Ga0070658_10311392 | Ga0070658_103113922 | 207 |
| 316 | 3300005330 | Ga0070690_100035558 | Ga0070690_1000355583 | 207 |
| 317 | 3300005335 | Ga0070666_10077888 | Ga0070666_100778882 | 207 |
| 318 | 3300005340 | Ga0070689_100539526 | Ga0070689_1005395261 | 207 |
| 319 | 3300005347 | Ga0070668_100201095 | Ga0070668_1002010953 | 207 |
| 320 | 3300005353 | Ga0070669_100004937 | Ga0070669_10000493710 | 207 |
| 321 | 3300005355 | Ga0070671_100031516 | Ga0070671_1000315163 | 207 |
| 322 | 3300005355 | Ga0070671_100201010 | Ga0070671_1002010103 | 207 |
| 323 | 3300005440 | Ga0070705_100127772 | Ga0070705_1001277723 | 207 |
| 324 | 3300005455 | Ga0070663_100224453 | Ga0070663_1002244532 | 207 |
| 325 | 3300005530 | Ga0070679_100277979 | Ga0070679_1002779792 | 207 |
| 326 | 3300005539 | Ga0068853_100404879 | Ga0068853_1004048792 | 207 |
| 327 | 3300005544 | Ga0070686_100238127 | Ga0070686_1002381272 | 207 |
| 328 | 3300005548 | Ga0070665_100080805 | Ga0070665_1000808052 | 207 |
| 329 | 3300005563 | Ga0068855_100598311 | Ga0068855_1005983112 | 207 |
| 330 | 3300005577 | Ga0068857_100262080 | Ga0068857_1002620802 | 207 |
| 331 | 3300005577 | Ga0068857_100650980 | Ga0068857_1006509802 | 207 |
| 332 | 3300005578 | Ga0068854_100048934 | Ga0068854_1000489342 | 207 |
| 333 | 3300005614 | Ga0068856_100436011 | Ga0068856_1004360112 | 207 |
| 334 | 3300005616 | Ga0068852_100200291 | Ga0068852_1002002911 | 207 |
| 335 | 3300005616 | Ga0068852_100602980 | Ga0068852_1006029801 | 207 |
| 336 | 3300005617 | Ga0068859_100042049 | Ga0068859_1000420494 | 207 |
| 337 | 3300005617 | Ga0068859_100138380 | Ga0068859_1001383804 | 207 |
| 338 | 3300005618 | Ga0068864_100209740 | Ga0068864_1002097402 | 207 |
| 339 | 3300005842 | Ga0068858_100097011 | Ga0068858_1000970113 | 207 |
| 340 | 3300005842 | Ga0068858_100219257 | Ga0068858_1002192573 | 207 |
| 341 | 3300006931 | Ga0097620_100042049 | Ga0097620_1000420495 | 207 |
| 342 | 3300006931 | Ga0097620_100138381 | Ga0097620_1001383814 | 207 |
| 343 | 3300009093 | Ga0105240_10327247 | Ga0105240_103272473 | 207 |
| 344 | 3300009101 | Ga0105247_10060490 | Ga0105247_100604902 | 207 |
| 345 | 3300009177 | Ga0105248_10043335 | Ga0105248_100433355 | 207 |
| 346 | 3300009545 | Ga0105237_10362718 | Ga0105237_103627182 | 207 |
| 347 | 3300009553 | Ga0105249_11049980 | Ga0105249_110499802 | 207 |
| 348 | 3300013102 | Ga0157371_10094239 | Ga0157371_100942392 | 207 |
| 349 | 3300013104 | Ga0157370_10677811 | Ga0157370_106778111 | 207 |
| 350 | 3300025315 | Ga0207697_10060257 | Ga0207697_100602572 | 207 |
| 351 | 3300025903 | Ga0207680_10040390 | Ga0207680_100403906 | 207 |
| 352 | 3300025904 | Ga0207647_10009694 | Ga0207647_100096944 | 207 |
| 353 | 3300025904 | Ga0207647_10215776 | Ga0207647_102157762 | 207 |
| 354 | 3300025909 | Ga0207705_10000009 | Ga0207705_10000009355 | 207 |
| 355 | 3300025909 | Ga0207705_10025305 | Ga0207705_100253054 | 207 |
| 356 | 3300025909 | Ga0207705_10811037 | Ga0207705_108110371 | 207 |
| 357 | 3300025913 | Ga0207695_10179522 | Ga0207695_101795223 | 207 |
| 358 | 3300025913 | Ga0207695_10254886 | Ga0207695_102548863 | 207 |
| 359 | 3300025914 | Ga0207671_10358676 | Ga0207671_103586762 | 207 |
| 360 | 3300025919 | Ga0207657_10061755 | Ga0207657_100617553 | 207 |
| 361 | 3300025923 | Ga0207681_10024084 | Ga0207681_100240843 | 207 |
| 362 | 3300025924 | Ga0207694_10017336 | Ga0207694_100173363 | 207 |
| 363 | 3300025931 | Ga0207644_10000005 | Ga0207644_10000005322 | 207 |
| 364 | 3300025931 | Ga0207644_10291104 | Ga0207644_102911043 | 207 |
| 365 | 3300025935 | Ga0207709_10176594 | Ga0207709_101765942 | 207 |
| 366 | 3300025941 | Ga0207711_10007295 | Ga0207711_100072954 | 207 |
| 367 | 3300025949 | Ga0207667_10021256 | Ga0207667_100212564 | 207 |
| 368 | 3300025949 | Ga0207667_10113219 | Ga0207667_101132192 | 207 |
| 369 | 3300025949 | Ga0207667_10467319 | Ga0207667_104673192 | 207 |
| 370 | 3300025961 | Ga0207712_10077730 | Ga0207712_100777303 | 207 |
| 371 | 3300025972 | Ga0207668_10032423 | Ga0207668_100324234 | 207 |
| 372 | 3300025972 | Ga0207668_10338982 | Ga0207668_103389822 | 207 |
| 373 | 3300025981 | Ga0207640_10014726 | Ga0207640_100147265 | 207 |
| 374 | 3300026035 | Ga0207703_10041284 | Ga0207703_100412843 | 207 |
| 375 | 3300026035 | Ga0207703_10376093 | Ga0207703_103760933 | 207 |
| 376 | 3300026067 | Ga0207678_10091778 | Ga0207678_100917783 | 207 |
| 377 | 3300026078 | Ga0207702_10058181 | Ga0207702_100581811 | 207 |
| 378 | 3300026078 | Ga0207702_10182476 | Ga0207702_101824763 | 207 |
| 379 | 3300026116 | Ga0207674_10164362 | Ga0207674_101643623 | 207 |
| 380 | 3300026142 | Ga0207698_10000537 | Ga0207698_100005371 | 207 |
| 381 | 3300026142 | Ga0207698_10061955 | Ga0207698_100619553 | 207 |
| 382 | 3300026142 | Ga0207698_11446527 | Ga0207698_114465271 | 207 |
| 383 | 3300028379 | Ga0268266_10023261 | Ga0268266_100232615 | 207 |
| 384 | 3300028381 | Ga0268264_10103721 | Ga0268264_101037213 | 207 |
| 385 | 3300031911 | Ga0307412_10487847 | Ga0307412_104878472 | 207 |
| 386 | 3300041498 | Ga0451841_1147862 | Ga0451841_1147862_292_918 | 207 |
| 387 | 3300046557 | Ga0495622_0039363 | Ga0495622_0039363_1259_1885 | 207 |
| 388 | 3300046692 | Ga0495671_0008086 | Ga0495671_0008086_3306_3932 | 207 |
| 389 | 3300048903 | Ga0496100_0031287 | Ga0496100_0031287_240_863 | 207 |
| 390 | 3300048905 | Ga0496102_0038393 | Ga0496102_0038393_3271_3894 | 207 |
| 391 | 3300048906 | Ga0496103_0036159 | Ga0496103_0036159_117_740 | 207 |
| 392 | 3300048907 | Ga0496104_0037438 | Ga0496104_0037438_3190_3813 | 207 |
| 393 | 3300048909 | Ga0496106_0004127 | Ga0496106_0004127_7348_7971 | 207 |
| 394 | 3300048910 | Ga0496107_0005217 | Ga0496107_0005217_1054_1677 | 207 |
| 395 | 3300048911 | Ga0496108_0017449 | Ga0496108_0017449_2083_2706 | 207 |
| 396 | 3300048911 | Ga0496108_0289760 | Ga0496108_0289760_445_1068 | 207 |
| 397 | 3300048912 | Ga0496109_0151602 | Ga0496109_0151602_386_1009 | 207 |
| 398 | 3300048912 | Ga0496109_0546009 | Ga0496109_0546009_26_649 | 207 |
| 399 | 3300048913 | Ga0496110_0032770 | Ga0496110_0032770_2143_2766 | 207 |
| 400 | 3300048913 | Ga0496110_0059519 | Ga0496110_0059519_462_1085 | 207 |
| 401 | 3300048914 | Ga0496111_0056586 | Ga0496111_0056586_96_719 | 207 |
| 402 | 3300048914 | Ga0496111_0099018 | Ga0496111_0099018_1070_1693 | 207 |
| 403 | 3300048915 | Ga0496112_0324546 | Ga0496112_0324546_281_904 | 207 |
| 404 | 3300048916 | Ga0496113_0011540 | Ga0496113_0011540_343_966 | 207 |
| 405 | 3300048917 | Ga0496114_0020434 | Ga0496114_0020434_3388_4011 | 207 |
| 406 | 3300048918 | Ga0496115_0703053 | Ga0496115_0703053_64_687 | 207 |
| 407 | 3300048929 | Ga0496126_0058301 | Ga0496126_0058301_436_1059 | 207 |
| 408 | 3300048929 | Ga0496126_0124609 | Ga0496126_0124609_228_851 | 207 |
| 409 | 3300049575 | Ga0501039_0110912 | Ga0501039_0110912_72_695 | 207 |
| 410 | 3300049822 | Ga0501035_0817170 | Ga0501035_0817170_44_667 | 207 |
| 411 | 3300050489 | nmdc:mga03683_129576_c1 | nmdc:mga03683_129576_c1_327_950 | 207 |
| 412 | 3300050493 | nmdc:mga0k408_52034_c1 | nmdc:mga0k408_52034_c1_1723_2349 | 207 |
| 413 | 3300050516 | nmdc:mga0sz30_132684_c1 | nmdc:mga0sz30_132684_c1_214_837 | 207 |
| 414 | 3300053108 | Ga0500562_045321 | Ga0500562_045321_118_744 | 207 |
| 415 | 3300053118 | Ga0500594_0005507 | Ga0500594_0005507_667_1293 | 207 |
| 416 | 3300053151 | Ga0500604_0076435 | Ga0500604_0076435_39_665 | 207 |
| 417 | 3300059491 | Ga0587070_001986 | Ga0587070_001986_514_1137 | 207 |
| 418 | 3300059493 | Ga0587077_000001 | Ga0587077_000001_6286_6909 | 207 |
| 419 | 3300059504 | Ga0587082_000512 | Ga0587082_000512_964_1587 | 207 |
| 420 | 3300059506 | Ga0587085_003253 | Ga0587085_003253_519_1142 | 207 |
| 421 | 3300059507 | Ga0587086_003087 | Ga0587086_003087_512_1135 | 207 |
| 422 | 3300059510 | Ga0587090_000037 | Ga0587090_000037_753_1376 | 207 |
| 423 | 3300059643 | Ga0587072_003713 | Ga0587072_003713_983_1606 | 207 |
| 424 | 3300059645 | Ga0587076_002352 | Ga0587076_002352_967_1590 | 207 |
| 425 | 3300060346 | Ga0587111_0028178 | Ga0587111_0028178_379_1002 | 207 |
| 426 | 2162886007 | SwRhRL2b_contig_1707570 | SwRhRL2b_0876.00001880 | 208 |
| 427 | 3300000041 | ARcpr5oldR_c000791 | ARcpr5oldR_0007913 | 208 |
| 428 | 3300002459 | JGI24751J29686_10043971 | JGI24751J29686_100439712 | 208 |
| 429 | 3300005289 | Ga0065704_10009321 | Ga0065704_100093216 | 208 |
| 430 | 3300005289 | Ga0065704_10070214 | Ga0065704_1007021439 | 208 |
| 431 | 3300005331 | Ga0070670_100077325 | Ga0070670_1000773253 | 208 |
| 432 | 3300005335 | Ga0070666_10141818 | Ga0070666_101418181 | 208 |
| 433 | 3300005347 | Ga0070668_100046306 | Ga0070668_1000463063 | 208 |
| 434 | 3300005353 | Ga0070669_100002856 | Ga0070669_1000028562 | 208 |
| 435 | 3300005355 | Ga0070671_100002671 | Ga0070671_10000267111 | 208 |
| 436 | 3300005367 | Ga0070667_100052979 | Ga0070667_1000529791 | 208 |
| 437 | 3300005367 | Ga0070667_100092578 | Ga0070667_1000925782 | 208 |
| 438 | 3300005548 | Ga0070665_100001143 | Ga0070665_1000011437 | 208 |
| 439 | 3300005548 | Ga0070665_100015146 | Ga0070665_1000151466 | 208 |
| 440 | 3300005577 | Ga0068857_100358901 | Ga0068857_1003589012 | 208 |
| 441 | 3300005616 | Ga0068852_100360610 | Ga0068852_1003606103 | 208 |
| 442 | 3300005841 | Ga0068863_100000072 | Ga0068863_1000000724 | 208 |
| 443 | 3300005841 | Ga0068863_100084537 | Ga0068863_1000845372 | 208 |
| 444 | 3300005841 | Ga0068863_100109631 | Ga0068863_1001096313 | 208 |
| 445 | 3300005842 | Ga0068858_100054285 | Ga0068858_1000542856 | 208 |
| 446 | 3300005843 | Ga0068860_100000247 | Ga0068860_10000024793 | 208 |
| 447 | 3300005843 | Ga0068860_100028664 | Ga0068860_1000286646 | 208 |
| 448 | 3300005843 | Ga0068860_100159782 | Ga0068860_1001597823 | 208 |
| 449 | 3300005844 | Ga0068862_100037303 | Ga0068862_1000373036 | 208 |
| 450 | 3300005844 | Ga0068862_100227549 | Ga0068862_1002275492 | 208 |
| 451 | 3300006038 | Ga0075365_10003441 | Ga0075365_100034415 | 208 |
| 452 | 3300006042 | Ga0075368_10000063 | Ga0075368_1000006321 | 208 |
| 453 | 3300006048 | Ga0075363_100000434 | Ga0075363_1000004348 | 208 |
| 454 | 3300006048 | Ga0075363_100000592 | Ga0075363_10000059210 | 208 |
| 455 | 3300006051 | Ga0075364_10039797 | Ga0075364_100397975 | 208 |
| 456 | 3300006051 | Ga0075364_10105823 | Ga0075364_101058233 | 208 |
| 457 | 3300006058 | Ga0075432_10000042 | Ga0075432_1000004231 | 208 |
| 458 | 3300006177 | Ga0075362_10000383 | Ga0075362_1000038320 | 208 |
| 459 | 3300006177 | Ga0075362_10001156 | Ga0075362_1000115614 | 208 |
| 460 | 3300006186 | Ga0075369_10007430 | Ga0075369_100074305 | 208 |
| 461 | 3300006186 | Ga0075369_10024906 | Ga0075369_100249063 | 208 |
| 462 | 3300006195 | Ga0075366_10015361 | Ga0075366_100153614 | 208 |
| 463 | 3300006353 | Ga0075370_10000004 | Ga0075370_10000004101 | 208 |
| 464 | 3300006353 | Ga0075370_10017297 | Ga0075370_100172976 | 208 |
| 465 | 3300006353 | Ga0075370_10066123 | Ga0075370_100661232 | 208 |
| 466 | 3300006946 | Ga0079104_1044117 | Ga0079104_10441172 | 208 |
| 467 | 3300009011 | Ga0105251_10117856 | Ga0105251_101178562 | 208 |
| 468 | 3300009101 | Ga0105247_10233359 | Ga0105247_102333592 | 208 |
| 469 | 3300009177 | Ga0105248_10293477 | Ga0105248_102934772 | 208 |
| 470 | 3300009177 | Ga0105248_10610630 | Ga0105248_106106302 | 208 |
| 471 | 3300009177 | Ga0105248_10959828 | Ga0105248_109598282 | 208 |
| 472 | 3300013102 | Ga0157371_10022628 | Ga0157371_100226284 | 208 |
| 473 | 3300014326 | Ga0157380_10184182 | Ga0157380_101841823 | 208 |
| 474 | 3300017792 | Ga0163161_10062553 | Ga0163161_100625535 | 208 |
| 475 | 3300025298 | Ga0209050_1001064 | Ga0209050_100106410 | 208 |
| 476 | 3300025735 | Ga0207713_1023315 | Ga0207713_10233156 | 208 |
| 477 | 3300025900 | Ga0207710_10125321 | Ga0207710_101253212 | 208 |
| 478 | 3300025900 | Ga0207710_10225364 | Ga0207710_102253641 | 208 |
| 479 | 3300025923 | Ga0207681_10024920 | Ga0207681_100249206 | 208 |
| 480 | 3300025923 | Ga0207681_10342072 | Ga0207681_103420722 | 208 |
| 481 | 3300025931 | Ga0207644_10002200 | Ga0207644_100022005 | 208 |
| 482 | 3300025941 | Ga0207711_10042359 | Ga0207711_100423593 | 208 |
| 483 | 3300025941 | Ga0207711_10196000 | Ga0207711_101960003 | 208 |
| 484 | 3300025941 | Ga0207711_10922948 | Ga0207711_109229481 | 208 |
| 485 | 3300025972 | Ga0207668_10038990 | Ga0207668_100389903 | 208 |
| 486 | 3300025981 | Ga0207640_10055933 | Ga0207640_100559332 | 208 |
| 487 | 3300025986 | Ga0207658_10002550 | Ga0207658_1000255017 | 208 |
| 488 | 3300025986 | Ga0207658_10022322 | Ga0207658_100223225 | 208 |
| 489 | 3300025986 | Ga0207658_10086347 | Ga0207658_100863472 | 208 |
| 490 | 3300026035 | Ga0207703_10109804 | Ga0207703_101098043 | 208 |
| 491 | 3300026035 | Ga0207703_10287246 | Ga0207703_102872462 | 208 |
| 492 | 3300026088 | Ga0207641_10000084 | Ga0207641_100000845 | 208 |
| 493 | 3300026088 | Ga0207641_10026844 | Ga0207641_100268442 | 208 |
| 494 | 3300026088 | Ga0207641_10047020 | Ga0207641_100470207 | 208 |
| 495 | 3300026095 | Ga0207676_10045268 | Ga0207676_100452682 | 208 |
| 496 | 3300026116 | Ga0207674_10349915 | Ga0207674_103499152 | 208 |
| 497 | 3300027866 | Ga0209813_10000047 | Ga0209813_1000004742 | 208 |
| 498 | 3300027907 | Ga0207428_10020170 | Ga0207428_100201709 | 208 |
| 499 | 3300028379 | Ga0268266_10000879 | Ga0268266_1000087937 | 208 |
| 500 | 3300028380 | Ga0268265_10051345 | Ga0268265_100513453 | 208 |
| 501 | 3300028380 | Ga0268265_10076395 | Ga0268265_100763953 | 208 |
| 502 | 3300028381 | Ga0268264_10000253 | Ga0268264_10000253107 | 208 |
| 503 | 3300028381 | Ga0268264_10062575 | Ga0268264_100625756 | 208 |
| 504 | 3300028381 | Ga0268264_10133809 | Ga0268264_101338092 | 208 |
| 505 | 3300030500 | Ga0268256_1061693 | Ga0268256_10616932 | 208 |
| 506 | 3300031731 | Ga0307405_10431158 | Ga0307405_104311582 | 208 |
| 507 | 3300031824 | Ga0307413_10073593 | Ga0307413_100735932 | 208 |
| 508 | 3300031824 | Ga0307413_10183538 | Ga0307413_101835382 | 208 |
| 509 | 3300031852 | Ga0307410_10139679 | Ga0307410_101396791 | 208 |
| 510 | 3300031901 | Ga0307406_10692540 | Ga0307406_106925402 | 208 |
| 511 | 3300031911 | Ga0307412_10269370 | Ga0307412_102693702 | 208 |
| 512 | 3300031995 | Ga0307409_100065664 | Ga0307409_1000656643 | 208 |
| 513 | 3300032002 | Ga0307416_100112421 | Ga0307416_1001124213 | 208 |
| 514 | 3300032002 | Ga0307416_100740185 | Ga0307416_1007401853 | 208 |
| 515 | 3300032004 | Ga0307414_10094751 | Ga0307414_100947512 | 208 |
| 516 | 3300032005 | Ga0307411_10151988 | Ga0307411_101519882 | 208 |
| 517 | 3300032005 | Ga0307411_10651396 | Ga0307411_106513962 | 208 |
| 518 | 3300034817 | Ga0373948_0079258 | Ga0373948_0079258_37_678 | 208 |
| 519 | 3300035691 | Ga0373931_0033785 | Ga0373931_0033785_832_1473 | 208 |
| 520 | 3300041512 | Ga0451853_3234207 | Ga0451853_3234207_678_1304 | 208 |
| 521 | 3300044712 | Ga0453684_0811091 | Ga0453684_0811091_365_991 | 208 |
| 522 | 3300046453 | Ga0495627_001182 | Ga0495627_001182_14516_15142 | 208 |
| 523 | 3300046460 | Ga0495638_0001566 | Ga0495638_0001566_15435_16064 | 208 |
| 524 | 3300046460 | Ga0495638_0163241 | Ga0495638_0163241_471_1097 | 208 |
| 525 | 3300046460 | Ga0495638_0174766 | Ga0495638_0174766_446_1072 | 208 |
| 526 | 3300046471 | Ga0495650_0018352 | Ga0495650_0018352_1666_2292 | 208 |
| 527 | 3300046500 | Ga0495596_0000054 | Ga0495596_0000054_462_1088 | 208 |
| 528 | 3300046500 | Ga0495596_0007788 | Ga0495596_0007788_3413_4039 | 208 |
| 529 | 3300046506 | Ga0495583_0191574 | Ga0495583_0191574_42_668 | 208 |
| 530 | 3300046507 | Ga0495606_0131411 | Ga0495606_0131411_454_1080 | 208 |
| 531 | 3300046512 | Ga0495610_0000033 | Ga0495610_0000033_273_899 | 208 |
| 532 | 3300046512 | Ga0495610_0002336 | Ga0495610_0002336_452_1078 | 208 |
| 533 | 3300046512 | Ga0495610_0023572 | Ga0495610_0023572_2443_3069 | 208 |
| 534 | 3300046515 | Ga0495620_0016521 | Ga0495620_0016521_2225_2851 | 208 |
| 535 | 3300046518 | Ga0495631_0218280 | Ga0495631_0218280_120_746 | 208 |
| 536 | 3300046519 | Ga0495632_0111602 | Ga0495632_0111602_174_800 | 208 |
| 537 | 3300046519 | Ga0495632_0290779 | Ga0495632_0290779_90_716 | 208 |
| 538 | 3300046522 | Ga0495643_0018247 | Ga0495643_0018247_780_1406 | 208 |
| 539 | 3300046538 | Ga0495609_0078741 | Ga0495609_0078741_195_821 | 208 |
| 540 | 3300046558 | Ga0495633_0221524 | Ga0495633_0221524_206_832 | 208 |
| 541 | 3300046616 | Ga0495668_0080044 | Ga0495668_0080044_744_1370 | 208 |
| 542 | 3300046660 | Ga0495625_0068887 | Ga0495625_0068887_579_1205 | 208 |
| 543 | 3300046692 | Ga0495671_0356557 | Ga0495671_0356557_38_664 | 208 |
| 544 | 3300047470 | Ga0495681_0000360 | Ga0495681_0000360_5258_5884 | 208 |
| 545 | 3300048090 | Ga0495615_0000152 | Ga0495615_0000152_2210_2836 | 208 |
| 546 | 3300048091 | Ga0495626_0000356 | Ga0495626_0000356_21280_21906 | 208 |
| 547 | 3300048904 | Ga0496101_0153248 | Ga0496101_0153248_992_1618 | 208 |
| 548 | 3300048906 | Ga0496103_0018485 | Ga0496103_0018485_1276_1917 | 208 |
| 549 | 3300048906 | Ga0496103_0291843 | Ga0496103_0291843_221_847 | 208 |
| 550 | 3300048907 | Ga0496104_0145578 | Ga0496104_0145578_581_1207 | 208 |
| 551 | 3300048908 | Ga0496105_0040695 | Ga0496105_0040695_2816_3442 | 208 |
| 552 | 3300048916 | Ga0496113_0693574 | Ga0496113_0693574_25_651 | 208 |
| 553 | 3300048919 | Ga0496116_0000035 | Ga0496116_0000035_162584_163210 | 208 |
| 554 | 3300048920 | Ga0496117_0002537 | Ga0496117_0002537_70_711 | 208 |
| 555 | 3300048921 | Ga0496118_0051401 | Ga0496118_0051401_381_1007 | 208 |
| 556 | 3300048921 | Ga0496118_0052343 | Ga0496118_0052343_2406_3032 | 208 |
| 557 | 3300048921 | Ga0496118_0056128 | Ga0496118_0056128_298_939 | 208 |
| 558 | 3300048922 | Ga0496119_0041645 | Ga0496119_0041645_1282_1923 | 208 |
| 559 | 3300048923 | Ga0496120_0022737 | Ga0496120_0022737_1919_2560 | 208 |
| 560 | 3300048923 | Ga0496120_0141626 | Ga0496120_0141626_121_747 | 208 |
| 561 | 3300048924 | Ga0496121_0000031 | Ga0496121_0000031_186958_187584 | 208 |
| 562 | 3300048924 | Ga0496121_0000136 | Ga0496121_0000136_30558_31184 | 208 |
| 563 | 3300048924 | Ga0496121_0005190 | Ga0496121_0005190_13311_13952 | 208 |
| 564 | 3300048924 | Ga0496121_0040965 | Ga0496121_0040965_2929_3555 | 208 |
| 565 | 3300048925 | Ga0496122_0008028 | Ga0496122_0008028_10561_11187 | 208 |
| 566 | 3300048925 | Ga0496122_0009631 | Ga0496122_0009631_3596_4222 | 208 |
| 567 | 3300048926 | Ga0496123_0003623 | Ga0496123_0003623_7046_7672 | 208 |
| 568 | 3300048926 | Ga0496123_0085572 | Ga0496123_0085572_1077_1718 | 208 |
| 569 | 3300048926 | Ga0496123_0128746 | Ga0496123_0128746_444_1070 | 208 |
| 570 | 3300048927 | Ga0496124_0005247 | Ga0496124_0005247_11166_11792 | 208 |
| 571 | 3300048927 | Ga0496124_0068836 | Ga0496124_0068836_749_1390 | 208 |
| 572 | 3300048928 | Ga0496125_0024671 | Ga0496125_0024671_913_1554 | 208 |
| 573 | 3300048929 | Ga0496126_0000084 | Ga0496126_0000084_70847_71473 | 208 |
| 574 | 3300048929 | Ga0496126_0148093 | Ga0496126_0148093_838_1479 | 208 |
| 575 | 3300049683 | Ga0501253_010293 | Ga0501253_010293_106_744 | 208 |
| 576 | 3300049822 | Ga0501035_0701899 | Ga0501035_0701899_98_724 | 208 |
| 577 | 3300049823 | Ga0501044_0021221 | Ga0501044_0021221_384_1010 | 208 |
| 578 | 3300049823 | Ga0501044_0614444 | Ga0501044_0614444_185_811 | 208 |
| 579 | 3300050489 | nmdc:mga03683_31_c1 | nmdc:mga03683_31_c1_21170_21811 | 208 |
| 580 | 3300050490 | nmdc:mga03n38_4566_c1 | nmdc:mga03n38_4566_c1_2001_2642 | 208 |
| 581 | 3300050490 | nmdc:mga03n38_78102_c1 | nmdc:mga03n38_78102_c1_669_1295 | 208 |
| 582 | 3300050491 | nmdc:mga00v17_131476_c1 | nmdc:mga00v17_131476_c1_888_1529 | 208 |
| 583 | 3300050491 | nmdc:mga00v17_3048_c1 | nmdc:mga00v17_3048_c1_2149_2775 | 208 |
| 584 | 3300050492 | nmdc:mga0yw44_172505_c1 | nmdc:mga0yw44_172505_c1_541_1167 | 208 |
| 585 | 3300050493 | nmdc:mga0k408_18_c1 | nmdc:mga0k408_18_c1_111216_111857 | 208 |
| 586 | 3300050493 | nmdc:mga0k408_77479_c1 | nmdc:mga0k408_77479_c1_418_1044 | 208 |
| 587 | 3300050494 | nmdc:mga06z11_517_c1 | nmdc:mga06z11_517_c1_541_1167 | 208 |
| 588 | 3300050495 | nmdc:mga04h51_91_c1 | nmdc:mga04h51_91_c1_15324_15950 | 208 |
| 589 | 3300050496 | nmdc:mga07m45_12983_c1 | nmdc:mga07m45_12983_c1_3397_4023 | 208 |
| 590 | 3300050496 | nmdc:mga07m45_164_c1 | nmdc:mga07m45_164_c1_11759_12385 | 208 |
| 591 | 3300050496 | nmdc:mga07m45_19_c1 | nmdc:mga07m45_19_c1_21264_21905 | 208 |
| 592 | 3300050516 | nmdc:mga0sz30_163581_c1 | nmdc:mga0sz30_163581_c1_177_803 | 208 |
| 593 | 3300050516 | nmdc:mga0sz30_167_c1 | nmdc:mga0sz30_167_c1_13449_14075 | 208 |
| 594 | 3300050516 | nmdc:mga0sz30_6381_c2 | nmdc:mga0sz30_6381_c2_1059_1700 | 208 |
| 595 | 3300053087 | Ga0500643_030855 | Ga0500643_030855_648_1274 | 208 |
| 596 | 3300053119 | Ga0500595_068569 | Ga0500595_068569_253_879 | 208 |
| 597 | 3300053121 | Ga0500607_010159 | Ga0500607_010159_2081_2707 | 208 |
| 598 | 3300053139 | Ga0500568_0092028 | Ga0500568_0092028_137_763 | 208 |
| 599 | 3300053156 | Ga0500622_0002768 | Ga0500622_0002768_3468_4094 | 208 |
| 600 | 3300053730 | Ga0500645_008472 | Ga0500645_008472_843_1481 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.899 | 13 | 205 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8922 | 3 | 204 |
| 7ode-assembly1.cif.gz_M | e. coli 50s ribosome licl core particle | 0.8775 | 3 | 205 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8729 | 3 | 204 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8697 | 3 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.8036 | 1 | 208 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.8003 | 1 | 205 | 3.40.1370.10 |
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7964 | 1 | 208 | 3.40.1370.10 |
| af_P60723_1_201_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7934 | 1 | 205 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7929 | 1 | 205 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2I0W1L9-F1-model_v4 | Large ribosomal subunit protein uL4m | 0.9168 | 89 | 208 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2P2JVQ7-F1-model_v4 | Large ribosomal subunit protein uL4m | 0.916 | 89 | 208 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A3L6TNT1-F1-model_v4 | Large ribosomal subunit protein uL4m | 0.9023 | 1 | 205 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A118JYH2-F1-model_v4 | Large ribosomal subunit protein uL4m | 0.8954 | 1 | 208 |
GO:0003729
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A3D2HGN9-F1-model_v4 | deleted | 0.8903 | 95 | 208 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar