F467599

General Info

Members Datasets Scaffolds Average Seq Length
596 304 1192 167

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0364367|Ga0501037_0364367_235_741
Length 168
Sequence MGDRPDKHSLIDGAERARLDGERERIRQRYLVPRDTRAPSSARGVHHVALVSSDVERTVRFHQELLGFPLTTMFENRDLAGSTHFFFDIGHGNSLAYFDLPGVDPTAYAEVLGGLHHLAISMEPEQWEAAGVETAHVDGTSLYFRGPDGERLELIADPLQWMYGERTD

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
167 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
172 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
173 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
301 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
302 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
303 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
304 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.13
Metatranscriptomes 5.2
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.86
Nodule 0.17
Rhizoplane 7.38
Rhizosphere 85.07
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0364367 3300049573 Bacteria 995
2 LJQas_1029482 3300000549 Bacteria 641
3 LJQas_1035759 3300000549 Bacteria 584
4 JGI24738J21930_10117805 3300002075 Bacteria 575
5 Ga0006778J45830_1014448 3300003162 Bacteria 1020
6 Ga0006759J45824_1022378 3300003163 Bacteria 2096
7 Ga0006759J45824_1023080 3300003163 Bacteria 575
8 Ga0006777J48905_1058772 3300003308 Bacteria 1073
9 Ga0007410J51695_1019616 3300003574 Bacteria 1598
10 Ga0007409J51694_1018899 3300003575 Bacteria 1716
11 Ga0007409J51694_1023805 3300003575 Bacteria 783
12 Ga0007416J51690_1019577 3300003577 Bacteria 836
13 Ga0007429J51699_1018739 3300003579 Bacteria 1906
14 Ga0032354_1002161 3300003693 Bacteria 1757
15 Ga0032354_1023951 3300003693 Bacteria 658
16 Ga0058861_10061018 3300004800 Bacteria 926
17 Ga0058861_11819606 3300004800 Bacteria 861
18 Ga0070683_100291283 3300005329 Bacteria 1553
19 Ga0070683_100838323 3300005329 Bacteria 882
20 Ga0070683_101191406 3300005329 Bacteria 732
21 Ga0070683_101394028 3300005329 Bacteria 674
22 Ga0070690_100774956 3300005330 Bacteria 742
23 Ga0070677_10213795 3300005333 Bacteria 938
24 Ga0068869_100073711 3300005334 Bacteria 2532
25 Ga0070680_100278226 3300005336 Bacteria 1418
26 Ga0068868_100094140 3300005338 Bacteria 2416
27 Ga0068868_100372208 3300005338 Bacteria 1228
28 Ga0068868_100882322 3300005338 Bacteria 812
29 Ga0070660_100173667 3300005339 Bacteria 1742
30 Ga0070660_100456337 3300005339 Bacteria 1061
31 Ga0070689_100314167 3300005340 Bacteria 1307
32 Ga0070692_10201179 3300005345 Bacteria 1167
33 Ga0070671_100331331 3300005355 Bacteria 1298
34 Ga0070674_100112033 3300005356 Bacteria 2005
35 Ga0070659_100737368 3300005366 Bacteria 854
36 Ga0070709_10040393 3300005434 Bacteria 2868
37 Ga0070709_10135357 3300005434 Bacteria 1687
38 Ga0070713_100182319 3300005436 Bacteria 1887
39 Ga0070710_10924621 3300005437 Bacteria 631
40 Ga0070701_10291423 3300005438 Bacteria 1000
41 Ga0070711_100116574 3300005439 Bacteria 1968
42 Ga0070711_100329678 3300005439 Bacteria 1222
43 Ga0070700_100224911 3300005441 Bacteria 1332
44 Ga0070700_100233000 3300005441 Bacteria 1311
45 Ga0070708_100006594 3300005445 Bacteria 9240
46 Ga0070708_100008011 3300005445 Bacteria 8465
47 Ga0070663_100302435 3300005455 Bacteria 1281
48 Ga0070678_101164957 3300005456 Bacteria 714
49 Ga0070662_100187369 3300005457 Bacteria 1634
50 Ga0070681_10692343 3300005458 Bacteria 935
51 Ga0068867_101061034 3300005459 Bacteria 738
52 Ga0070685_10113538 3300005466 Bacteria 1673
53 Ga0070706_100006498 3300005467 Bacteria 11035
54 Ga0070706_101413152 3300005467 Bacteria 637
55 Ga0070707_101107153 3300005468 Bacteria 758
56 Ga0070698_100004118 3300005471 Bacteria 15985
57 Ga0070684_100127338 3300005535 Bacteria 2295
58 Ga0070697_100791875 3300005536 Bacteria 839
59 Ga0070696_100770134 3300005546 Bacteria 790
60 Ga0070696_101029607 3300005546 Bacteria 689
61 Ga0070665_100000454 3300005548 Bacteria 59667
62 Ga0070665_100467947 3300005548 Bacteria 1271
63 Ga0068857_100419229 3300005577 Bacteria 1248
64 Ga0068854_100118643 3300005578 Bacteria 2005
65 Ga0068859_101478031 3300005617 Bacteria 750
66 Ga0068866_10312048 3300005718 Bacteria 986
67 Ga0068861_100135471 3300005719 Bacteria 2003
68 Ga0068870_10285434 3300005840 Bacteria 1036
69 Ga0068863_101134887 3300005841 Bacteria 787
70 Ga0068858_100194565 3300005842 Bacteria 1916
71 Ga0068858_100281302 3300005842 Bacteria 1584
72 Ga0081455_10002449 3300005937 Bacteria 22098
73 Ga0081455_10110766 3300005937 Bacteria 2182
74 Ga0081455_10248877 3300005937 Bacteria 1301
75 Ga0081455_10407971 3300005937 Bacteria 941
76 Ga0081540_1005584 3300005983 Bacteria 9367
77 Ga0081540_1062113 3300005983 Bacteria 1777
78 Ga0081539_10040406 3300005985 Bacteria 2738
79 Ga0081539_10274483 3300005985 Bacteria 737
80 Ga0070717_10075374 3300006028 Bacteria 2822
81 Ga0070717_11144193 3300006028 Bacteria 708
82 Ga0075365_10364173 3300006038 Bacteria 1019
83 Ga0075365_10412019 3300006038 Bacteria 954
84 Ga0075368_10032204 3300006042 Bacteria 2035
85 Ga0075363_100023407 3300006048 Bacteria 3130
86 Ga0075363_100164570 3300006048 Bacteria 1257
87 Ga0075363_100297551 3300006048 Bacteria 936
88 Ga0075364_10012267 3300006051 Bacteria 5240
89 Ga0075432_10142613 3300006058 Bacteria 915
90 Ga0070715_10145869 3300006163 Bacteria 1155
91 Ga0070716_100029722 3300006173 Bacteria 2957
92 Ga0070716_100069266 3300006173 Bacteria 2067
93 Ga0075367_10025475 3300006178 Bacteria 3346
94 Ga0075428_100007986 3300006844 Bacteria 11738
95 Ga0075428_100141493 3300006844 Bacteria 2616
96 Ga0075428_100414393 3300006844 Bacteria 1443
97 Ga0075428_100454786 3300006844 Bacteria 1371
98 Ga0075430_100002503 3300006846 Bacteria 15324
99 Ga0075430_100007456 3300006846 Bacteria 9235
100 Ga0075430_100300178 3300006846 Bacteria 1328
101 Ga0075431_100232372 3300006847 Bacteria 1878
102 Ga0075431_100506933 3300006847 Unclassified 1197
103 Ga0075431_100812768 3300006847 Bacteria 907
104 Ga0075433_10411340 3300006852 Bacteria 1193
105 Ga0075429_100068914 3300006880 Bacteria 3079
106 Ga0075429_100154032 3300006880 Bacteria 2013
107 Ga0075429_100236951 3300006880 Bacteria 1598
108 Ga0075429_100267583 3300006880 Bacteria 1497
109 Ga0075429_100562732 3300006880 Bacteria 999
110 Ga0068865_100146286 3300006881 Bacteria 1787
111 Ga0068865_100813055 3300006881 Bacteria 807
112 Ga0097620_101477975 3300006931 Bacteria 750
113 Ga0075435_101091054 3300007076 Bacteria 698
114 Ga0075435_101162199 3300007076 Bacteria 675
115 Ga0099795_10255755 3300007788 Bacteria 757
116 Ga0111539_10324929 3300009094 Bacteria 1791
117 Ga0111539_10360529 3300009094 Bacteria 1692
118 Ga0111539_10599458 3300009094 Bacteria 1283
119 Ga0111539_10613101 3300009094 Bacteria 1267
120 Ga0111539_12005707 3300009094 Bacteria 671
121 Ga0105245_10233780 3300009098 Bacteria 1779
122 Ga0105245_10746450 3300009098 Bacteria 1014
123 Ga0105247_10586226 3300009101 Bacteria 825
124 Ga0114129_10020786 3300009147 Bacteria 9328
125 Ga0114129_10061210 3300009147 Bacteria 5261
126 Ga0114129_10129852 3300009147 Bacteria 3462
127 Ga0114129_10175588 3300009147 Bacteria 2918
128 Ga0105243_10217123 3300009148 Bacteria 1688
129 Ga0105243_11143430 3300009148 Bacteria 789
130 Ga0105238_11180708 3300009551 Bacteria 789
131 Ga0105249_10536861 3300009553 Bacteria 1219
132 Ga0105239_10102632 3300010375 Bacteria 3165
133 Ga0105239_10244735 3300010375 Bacteria 2013
134 Ga0157373_10168222 3300013100 Bacteria 1543
135 Ga0157370_10756025 3300013104 Bacteria 885
136 Ga0157374_11015153 3300013296 Bacteria 849
137 Ga0163162_10870335 3300013306 Bacteria 1015
138 Ga0163162_12120625 3300013306 Bacteria 645
139 Ga0157372_10266657 3300013307 Bacteria 1989
140 Ga0157372_11000310 3300013307 Bacteria 968
141 Ga0157372_12935733 3300013307 Bacteria 546
142 Ga0157375_10054806 3300013308 Bacteria 3929
143 Ga0157375_10337547 3300013308 Bacteria 1672
144 Ga0157375_10461671 3300013308 Bacteria 1435
145 Ga0157375_11153820 3300013308 Bacteria 908
146 Ga0163163_10176541 3300014325 Bacteria 2183
147 Ga0163163_10301269 3300014325 Bacteria 1655
148 Ga0157379_10919854 3300014968 Bacteria 830
149 Ga0163161_10346617 3300017792 Bacteria 1179
150 Ga0206356_11705868 3300020070 Bacteria 1575
151 Ga0206355_1341727 3300020076 Bacteria 1514
152 Ga0206352_10356421 3300020078 Bacteria 1497
153 Ga0206350_11219577 3300020080 Bacteria 1449
154 Ga0206353_10013481 3300020082 Bacteria 1410
155 Ga0206353_10805885 3300020082 Bacteria 1083
156 Ga0206353_11632957 3300020082 Bacteria 1562
157 Ga0213876_10012555 3300021384 Bacteria 4507
158 Ga0213875_10001619 3300021388 Bacteria 14224
159 Ga0213875_10006132 3300021388 Bacteria 6351
160 Ga0224712_10043293 3300022467 Bacteria 1710
161 Ga0224712_10050926 3300022467 Bacteria 1610
162 Ga0224712_10238441 3300022467 Bacteria 837
163 Ga0207642_10802518 3300025899 Bacteria 599
164 Ga0207647_10209143 3300025904 Bacteria 1127
165 Ga0207699_10003587 3300025906 Bacteria 7419
166 Ga0207699_10052568 3300025906 Bacteria 2412
167 Ga0207684_10158744 3300025910 Bacteria 1947
168 Ga0207684_10629198 3300025910 Bacteria 915
169 Ga0207707_10314027 3300025912 Bacteria 1354
170 Ga0207663_10786410 3300025916 Bacteria 757
171 Ga0207660_11000999 3300025917 Bacteria 682
172 Ga0207657_10199385 3300025919 Bacteria 1611
173 Ga0207657_10304283 3300025919 Bacteria 1263
174 Ga0207657_10469516 3300025919 Bacteria 987
175 Ga0207652_10397497 3300025921 Bacteria 1243
176 Ga0207652_10923761 3300025921 Bacteria 770
177 Ga0207646_10217335 3300025922 Bacteria 1727
178 Ga0207646_10484810 3300025922 Bacteria 1115
179 Ga0207681_10397165 3300025923 Bacteria 1113
180 Ga0207694_11525040 3300025924 Bacteria 564
181 Ga0207650_10129166 3300025925 Bacteria 1975
182 Ga0207659_10588905 3300025926 Bacteria 947
183 Ga0207687_10142019 3300025927 Bacteria 1822
184 Ga0207687_10356804 3300025927 Bacteria 1192
185 Ga0207687_10851652 3300025927 Bacteria 779
186 Ga0207700_10315138 3300025928 Bacteria 1354
187 Ga0207664_10427982 3300025929 Bacteria 1180
188 Ga0207644_10141860 3300025931 Bacteria 1851
189 Ga0207644_10205606 3300025931 Bacteria 1555
190 Ga0207690_10867793 3300025932 Bacteria 748
191 Ga0207709_10391480 3300025935 Bacteria 1060
192 Ga0207709_11065344 3300025935 Bacteria 663
193 Ga0207670_10315450 3300025936 Bacteria 1229
194 Ga0207670_10886531 3300025936 Bacteria 747
195 Ga0207669_10011216 3300025937 Bacteria 4353
196 Ga0207704_10135505 3300025938 Bacteria 1713
197 Ga0207665_10077686 3300025939 Bacteria 2279
198 Ga0207665_10260159 3300025939 Bacteria 1285
199 Ga0207661_10146517 3300025944 Bacteria 2038
200 Ga0207661_10206513 3300025944 Bacteria 1729
201 Ga0207661_10322161 3300025944 Bacteria 1390
202 Ga0207661_10399662 3300025944 Bacteria 1246
203 Ga0207661_10831656 3300025944 Bacteria 850
204 Ga0207668_10556110 3300025972 Bacteria 995
205 Ga0207640_10648404 3300025981 Bacteria 899
206 Ga0207677_10178905 3300026023 Bacteria 1666
207 Ga0207703_10299817 3300026035 Bacteria 1465
208 Ga0207639_11688805 3300026041 Bacteria 593
209 Ga0207708_10112351 3300026075 Bacteria 2116
210 Ga0207708_10508730 3300026075 Bacteria 1010
211 Ga0207648_11474725 3300026089 Bacteria 639
212 Ga0207676_10951129 3300026095 Bacteria 845
213 Ga0207674_10417773 3300026116 Bacteria 1296
214 Ga0207674_10976209 3300026116 Bacteria 816
215 Ga0207675_100810487 3300026118 Bacteria 950
216 Ga0207675_101004531 3300026118 Bacteria 853
217 Ga0207675_101984477 3300026118 Bacteria 600
218 Ga0207698_10407760 3300026142 Bacteria 1301
219 Ga0209813_10000958 3300027866 Bacteria 6497
220 Ga0207428_10131306 3300027907 Bacteria 1916
221 Ga0268266_10001196 3300028379 Bacteria 32052
222 Ga0268266_10629028 3300028379 Bacteria 1032
223 Ga0268264_10340514 3300028381 Bacteria 1424
224 Ga0268264_10355718 3300028381 Bacteria 1395
225 Ga0307408_100156555 3300031548 Bacteria 1805
226 Ga0307408_101600191 3300031548 Bacteria 619
227 Ga0307405_10149530 3300031731 Bacteria 1640
228 Ga0307405_10156407 3300031731 Bacteria 1609
229 Ga0307405_10232111 3300031731 Bacteria 1361
230 Ga0307413_10068863 3300031824 Bacteria 2218
231 Ga0307413_11236141 3300031824 Bacteria 651
232 Ga0307518_10187305 3300031838 Bacteria 1391
233 Ga0307410_10010091 3300031852 Bacteria 5333
234 Ga0307410_10499557 3300031852 Bacteria 1001
235 Ga0307410_11019972 3300031852 Bacteria 714
236 Ga0307406_10022836 3300031901 Bacteria 3715
237 Ga0307406_11899070 3300031901 Bacteria 531
238 Ga0307407_10200654 3300031903 Bacteria 1336
239 Ga0307407_10272904 3300031903 Bacteria 1168
240 Ga0307407_10403516 3300031903 Bacteria 981
241 Ga0307412_10096028 3300031911 Bacteria 2085
242 Ga0307412_10185573 3300031911 Bacteria 1568
243 Ga0307409_100029193 3300031995 Bacteria 3943
244 Ga0307409_100144596 3300031995 Bacteria 2054
245 Ga0307409_100246064 3300031995 Bacteria 1631
246 Ga0307409_100254947 3300031995 Bacteria 1606
247 Ga0307409_100360308 3300031995 Bacteria 1375
248 Ga0307409_100446498 3300031995 Bacteria 1247
249 Ga0307409_100577221 3300031995 Bacteria 1108
250 Ga0307409_100895094 3300031995 Bacteria 901
251 Ga0307409_101563520 3300031995 Bacteria 687
252 Ga0307409_102508144 3300031995 Bacteria 544
253 Ga0307416_100001007 3300032002 Bacteria 14935
254 Ga0307416_100109154 3300032002 Bacteria 2433
255 Ga0307416_100133079 3300032002 Bacteria 2243
256 Ga0307416_101109399 3300032002 Bacteria 896
257 Ga0307416_101181309 3300032002 Bacteria 870
258 Ga0307416_101205787 3300032002 Bacteria 862
259 Ga0307416_101804179 3300032002 Bacteria 716
260 Ga0307414_10144138 3300032004 Bacteria 1869
261 Ga0307414_10187953 3300032004 Bacteria 1668
262 Ga0307414_10515827 3300032004 Bacteria 1060
263 Ga0307414_10944358 3300032004 Bacteria 792
264 Ga0307414_11336200 3300032004 Bacteria 665
265 Ga0307411_10059705 3300032005 Bacteria 2529
266 Ga0307411_10371234 3300032005 Bacteria 1173
267 Ga0307415_100000052 3300032126 Bacteria 50285
268 Ga0307415_100105189 3300032126 Bacteria 2081
269 Ga0307415_100194510 3300032126 Bacteria 1603
270 Ga0307415_100200657 3300032126 Bacteria 1582
271 Ga0307415_100624739 3300032126 Bacteria 962
272 Ga0307415_100762470 3300032126 Bacteria 879
273 Ga0307415_100879248 3300032126 Bacteria 824
274 Ga0307415_101262907 3300032126 Bacteria 698
275 Ga0307507_10251779 3300033179 Bacteria 1140
276 Ga0373945_0220232 3300035116 Bacteria 794
277 Ga0373943_0067404 3300035170 Bacteria 1805
278 Ga0373962_0203797 3300035242 Bacteria 671
279 Ga0373924_0119357 3300035410 Bacteria 1143
280 Ga0373931_0005789 3300035691 Bacteria 5745
281 Ga0373947_0005352 3300035725 Bacteria 7493
282 Ga0373937_0204935 3300036401 Bacteria 1855
283 Ga0373937_0549045 3300036401 Bacteria 1097
284 Ga0373925_0043894 3300037068 Bacteria 3319
285 Ga0395899_0075656 3300037312 Bacteria 2458
286 Ga0395899_0086240 3300037312 Bacteria 2281
287 Ga0395899_0508127 3300037312 Bacteria 781
288 Ga0395900_0027903 3300037418 Bacteria 5782
289 Ga0395900_0059299 3300037418 Bacteria 3940
290 Ga0395900_0068059 3300037418 Bacteria 3659
291 Ga0395898_0025462 3300037466 Bacteria 5961
292 Ga0395898_0719044 3300037466 Bacteria 940
293 Ga0436364_0391372 3300037853 Bacteria 64989
294 Ga0436364_0892930 3300037853 Bacteria 11026
295 Ga0395901_0010026 3300038443 Bacteria 9605
296 Ga0395901_0099615 3300038443 Bacteria 3047
297 Ga0400485_19208 3300038735 Bacteria 10703
298 Ga0400483_178860 3300039062 Bacteria 15489
299 Ga0400483_198026 3300039062 Bacteria 23752
300 Ga0436365_0363458 3300039437 Bacteria 691
301 Ga0436365_0498425 3300039437 Bacteria 741
302 Ga0436365_1371830 3300039437 Bacteria 6255
303 Ga0436365_1592663 3300039437 Bacteria 3388
304 Ga0436360_0972995 3300039438 Bacteria 1144
305 Ga0436362_0135106 3300039453 Bacteria 1520
306 Ga0439447_113128 3300041407 Bacteria 623
307 Ga0451849_1132018 3300041505 Bacteria 619
308 Ga0451843_0108042 3300041509 Bacteria 595
309 Ga0451853_0680839 3300041512 Bacteria 1694
310 Ga0439443_066478 3300042003 Bacteria 652
311 Ga0439448_0059858 3300042005 Bacteria 1258
312 Ga0439452_032050 3300042010 Bacteria 1286
313 Ga0439462_0100491 3300042015 Bacteria 797
314 Ga0450923_136635 3300042125 Bacteria 587
315 Ga0466969_0027901 3300044656 Bacteria 2889
316 Ga0466969_0281703 3300044656 Bacteria 753
317 Ga0466965_0194059 3300044683 Bacteria 1075
318 Ga0466966_0045643 3300044684 Bacteria 2800
319 Ga0466966_0071973 3300044684 Bacteria 2165
320 Ga0466966_0551661 3300044684 Bacteria 693
321 Ga0466961_0035584 3300044693 Bacteria 3198
322 Ga0466961_0053949 3300044693 Bacteria 2564
323 Ga0466961_0087027 3300044693 Bacteria 1974
324 Ga0466961_0236639 3300044693 Bacteria 1123
325 Ga0466961_0249886 3300044693 Bacteria 1089
326 Ga0466963_0010583 3300044694 Bacteria 5590
327 Ga0466963_0020992 3300044694 Bacteria 4115
328 Ga0466963_0035131 3300044694 Bacteria 3264
329 Ga0466963_0151763 3300044694 Bacteria 1609
330 Ga0466963_0324604 3300044694 Bacteria 1083
331 Ga0466963_0349033 3300044694 Bacteria 1042
332 Ga0466963_0392749 3300044694 Bacteria 978
333 Ga0466963_0759983 3300044694 Bacteria 684
334 Ga0466971_0008032 3300044719 Bacteria 4601
335 Ga0466971_0017729 3300044719 Bacteria 3153
336 Ga0466971_0142002 3300044719 Bacteria 1118
337 Ga0466971_0195273 3300044719 Bacteria 954
338 Ga0466970_0046517 3300044765 Bacteria 2311
339 Ga0466970_0289459 3300044765 Bacteria 922
340 Ga0466957_0112425 3300044842 Bacteria 1728
341 Ga0466957_0156309 3300044842 Bacteria 1478
342 Ga0466957_0203467 3300044842 Bacteria 1301
343 Ga0466957_0239511 3300044842 Bacteria 1203
344 Ga0466957_0243436 3300044842 Bacteria 1194
345 Ga0466957_0332807 3300044842 Bacteria 1027
346 Ga0466957_0542465 3300044842 Bacteria 810
347 Ga0466960_0000987 3300044901 Bacteria 10131
348 Ga0466960_0060742 3300044901 Bacteria 1853
349 Ga0466960_0111659 3300044901 Bacteria 1421
350 Ga0466960_0126506 3300044901 Bacteria 1344
351 Ga0466959_0015615 3300045049 Bacteria 5536
352 Ga0466959_0045687 3300045049 Bacteria 3225
353 Ga0466959_0085365 3300045049 Bacteria 2272
354 Ga0466959_0210297 3300045049 Bacteria 1352
355 Ga0466958_0025685 3300045836 Bacteria 3475
356 Ga0466958_0246411 3300045836 Bacteria 1142
357 Ga0466958_0437845 3300045836 Bacteria 846
358 Ga0466967_0003763 3300045976 Bacteria 10009
359 Ga0466967_0005955 3300045976 Bacteria 8558
360 Ga0466967_0018828 3300045976 Bacteria 5533
361 Ga0466967_0029563 3300045976 Bacteria 4588
362 Ga0466967_0038615 3300045976 Bacteria 4096
363 Ga0466967_0049671 3300045976 Bacteria 3669
364 Ga0466967_0277307 3300045976 Bacteria 1608
365 Ga0466967_0413197 3300045976 Bacteria 1314
366 Ga0466967_1630390 3300045976 Bacteria 642
367 Ga0495592_0055040 3300046454 Bacteria 2945
368 Ga0495603_0005138 3300046455 Bacteria 7816
369 Ga0495629_0005227 3300046459 Bacteria 9711
370 Ga0495641_0054662 3300046461 Bacteria 1814
371 Ga0495641_0361986 3300046461 Bacteria 656
372 Ga0495651_0108273 3300046462 Bacteria 2058
373 Ga0495651_0203334 3300046462 Bacteria 1384
374 Ga0495653_0013747 3300046463 Bacteria 6597
375 Ga0495653_0056483 3300046463 Bacteria 2992
376 Ga0495653_0241461 3300046463 Bacteria 1204
377 Ga0495582_0000075 3300046473 Bacteria 49940
378 Ga0495582_0078602 3300046473 Bacteria 1830
379 Ga0495582_0409945 3300046473 Bacteria 782
380 Ga0495639_0002298 3300046475 Bacteria 8380
381 Ga0495639_0026669 3300046475 Bacteria 2555
382 Ga0495664_0051854 3300046477 Bacteria 2436
383 Ga0495596_0131851 3300046500 Bacteria 970
384 Ga0495618_0010054 3300046514 Bacteria 5722
385 Ga0495618_0204413 3300046514 Bacteria 1249
386 Ga0495628_0026440 3300046516 Bacteria 4731
387 Ga0495628_0312950 3300046516 Bacteria 1160
388 Ga0495630_0048035 3300046517 Bacteria 3194
389 Ga0495630_0076099 3300046517 Bacteria 2528
390 Ga0495630_0176859 3300046517 Bacteria 1627
391 Ga0495630_0274196 3300046517 Bacteria 1289
392 Ga0495644_0174093 3300046523 Bacteria 827
393 Ga0495666_0031300 3300046526 Bacteria 2607
394 Ga0495666_0064110 3300046526 Bacteria 1754
395 Ga0495665_0108488 3300046531 Bacteria 1456
396 Ga0495640_0050555 3300046533 Bacteria 2863
397 Ga0495640_0643722 3300046533 Bacteria 638
398 Ga0495587_0216063 3300046536 Bacteria 1082
399 Ga0495598_0138323 3300046537 Bacteria 841
400 Ga0495598_0376595 3300046537 Bacteria 551
401 Ga0495667_0061103 3300046559 Bacteria 2471
402 Ga0495667_0201342 3300046559 Bacteria 1274
403 Ga0495667_0231043 3300046559 Bacteria 1179
404 Ga0495634_0116473 3300046642 Bacteria 1714
405 Ga0495657_0014536 3300046675 Bacteria 5775
406 Ga0495657_0017885 3300046675 Bacteria 5142
407 Ga0495657_0172181 3300046675 Bacteria 1333
408 Ga0495646_0469007 3300046680 Bacteria 649
409 Ga0495658_0008951 3300046683 Bacteria 4978
410 Ga0495658_0015036 3300046683 Bacteria 3965
411 Ga0495613_0001013 3300046689 Bacteria 21355
412 Ga0495613_0575386 3300046689 Bacteria 752
413 Ga0495624_0484128 3300046690 Bacteria 741
414 Ga0495581_0005979 3300047315 Bacteria 7049
415 Ga0495674_0038572 3300047319 Bacteria 4287
416 Ga0495674_0553522 3300047319 Bacteria 915
417 Ga0495672_0209611 3300047320 Bacteria 969
418 Ga0495680_0139741 3300047322 Bacteria 1773
419 Ga0495680_0275656 3300047322 Bacteria 1186
420 Ga0495675_0078945 3300047444 Bacteria 2073
421 Ga0495677_0169400 3300047445 Bacteria 845
422 Ga0495684_0006238 3300047471 Bacteria 9265
423 Ga0495593_0060384 3300047673 Bacteria 1985
424 Ga0495602_0095019 3300048088 Bacteria 2462
425 Ga0495602_0115793 3300048088 Bacteria 2167
426 Ga0496100_0050543 3300048903 Bacteria 2694
427 Ga0496100_0626265 3300048903 Bacteria 837
428 Ga0496101_0011487 3300048904 Bacteria 5878
429 Ga0496101_0063467 3300048904 Bacteria 2689
430 Ga0496101_1302183 3300048904 Bacteria 568
431 Ga0496101_1360197 3300048904 Bacteria 554
432 Ga0496102_0018211 3300048905 Bacteria 6165
433 Ga0496102_0124204 3300048905 Bacteria 2412
434 Ga0496102_0182811 3300048905 Bacteria 1975
435 Ga0496102_0729006 3300048905 Bacteria 914
436 Ga0496102_0812875 3300048905 Bacteria 857
437 Ga0496102_0822336 3300048905 Bacteria 851
438 Ga0496103_0030530 3300048906 Bacteria 3280
439 Ga0496103_0074926 3300048906 Bacteria 2122
440 Ga0496103_0576858 3300048906 Bacteria 717
441 Ga0496104_0089578 3300048907 Bacteria 2939
442 Ga0496104_0525627 3300048907 Bacteria 1094
443 Ga0496105_0027585 3300048908 Bacteria 4641
444 Ga0496105_0061917 3300048908 Bacteria 3088
445 Ga0496105_0092686 3300048908 Bacteria 2494
446 Ga0496105_0214820 3300048908 Bacteria 1567
447 Ga0496105_0408959 3300048908 Bacteria 1076
448 Ga0496107_0154740 3300048910 Bacteria 1697
449 Ga0496107_0253047 3300048910 Bacteria 1311
450 Ga0496107_0315902 3300048910 Bacteria 1163
451 Ga0496108_0016493 3300048911 Bacteria 6029
452 Ga0496108_0179221 3300048911 Bacteria 1834
453 Ga0496108_0206443 3300048911 Bacteria 1705
454 Ga0496109_0056932 3300048912 Bacteria 3567
455 Ga0496109_0169324 3300048912 Bacteria 2049
456 Ga0496109_0314012 3300048912 Bacteria 1479
457 Ga0496112_0001808 3300048915 Bacteria 16835
458 Ga0496113_0175999 3300048916 Bacteria 1695
459 Ga0496113_0366860 3300048916 Bacteria 1155
460 Ga0496113_1095521 3300048916 Bacteria 625
461 Ga0496114_0008221 3300048917 Bacteria 8267
462 Ga0496114_0027612 3300048917 Bacteria 4651
463 Ga0496114_0030465 3300048917 Bacteria 4440
464 Ga0496114_0056824 3300048917 Bacteria 3266
465 Ga0496114_0677749 3300048917 Bacteria 905
466 Ga0496115_0002644 3300048918 Bacteria 12862
467 Ga0496115_0034356 3300048918 Bacteria 4007
468 Ga0496115_0048890 3300048918 Bacteria 3384
469 Ga0496115_0521265 3300048918 Bacteria 953
470 Ga0496125_0084712 3300048928 Bacteria 2406
471 Ga0496126_0000055 3300048929 Bacteria 297958
472 Ga0501309_016777 3300049129 Bacteria 1001
473 Ga0501309_060490 3300049129 Bacteria 609
474 Ga0501317_064546 3300049533 Bacteria 607
475 Ga0501318_001955 3300049534 Bacteria 1716
476 Ga0501318_002983 3300049534 Bacteria 1516
477 Ga0501318_008711 3300049534 Bacteria 1091
478 Ga0501318_044374 3300049534 Bacteria 645
479 Ga0501321_012067 3300049537 Bacteria 973
480 Ga0501031_0002491 3300049568 Bacteria 11747
481 Ga0501031_0147051 3300049568 Bacteria 1540
482 Ga0501031_0632214 3300049568 Bacteria 688
483 Ga0501032_0500394 3300049569 Bacteria 777
484 Ga0501034_0002482 3300049571 Bacteria 22160
485 Ga0501034_0587878 3300049571 Bacteria 1020
486 Ga0501034_0642018 3300049571 Bacteria 964
487 Ga0501036_0001496 3300049572 Bacteria 18016
488 Ga0501036_0154649 3300049572 Bacteria 1934
489 Ga0501037_0058570 3300049573 Bacteria 2810
490 Ga0501038_0002265 3300049574 Bacteria 17903
491 Ga0501039_0009195 3300049575 Bacteria 7531
492 Ga0501039_0031305 3300049575 Bacteria 4101
493 Ga0501039_0588135 3300049575 Bacteria 873
494 Ga0501040_0024662 3300049576 Bacteria 4037
495 Ga0501041_0030083 3300049577 Bacteria 3278
496 Ga0501042_0013030 3300049578 Bacteria 5650
497 Ga0501042_0117799 3300049578 Bacteria 1912
498 Ga0501043_0003597 3300049579 Bacteria 12728
499 Ga0501043_0069772 3300049579 Bacteria 2761
500 Ga0501043_0210546 3300049579 Bacteria 1507
501 Ga0501043_0980993 3300049579 Bacteria 602
502 Ga0501046_0431371 3300049580 Bacteria 949
503 Ga0501047_0007321 3300049581 Bacteria 10381
504 Ga0501048_0001877 3300049582 Bacteria 15950
505 Ga0501048_0127641 3300049582 Bacteria 1799
506 Ga0501067_0029164 3300049583 Bacteria 3058
507 Ga0501067_0121435 3300049583 Bacteria 1454
508 Ga0501068_0006663 3300049584 Bacteria 6378
509 Ga0501068_0419468 3300049584 Bacteria 864
510 Ga0501069_0025634 3300049585 Bacteria 3224
511 Ga0501069_0736306 3300049585 Bacteria 596
512 Ga0501070_0090507 3300049586 Bacteria 2532
513 Ga0501070_0105508 3300049586 Bacteria 2329
514 Ga0501070_0497269 3300049586 Bacteria 980
515 Ga0501071_0031205 3300049587 Bacteria 3775
516 Ga0501071_0128035 3300049587 Bacteria 1885
517 Ga0501072_0014914 3300049588 Bacteria 5956
518 Ga0501072_0035775 3300049588 Bacteria 3891
519 Ga0501072_0112473 3300049588 Bacteria 2168
520 Ga0501073_0005568 3300049589 Bacteria 9422
521 Ga0501073_0029283 3300049589 Bacteria 3935
522 Ga0501074_0001601 3300049590 Bacteria 15352
523 Ga0501074_0021979 3300049590 Bacteria 4633
524 Ga0501074_0196516 3300049590 Bacteria 1438
525 Ga0501075_0022583 3300049591 Bacteria 4597
526 Ga0501076_0013492 3300049592 Bacteria 6128
527 Ga0501076_0164957 3300049592 Bacteria 1805
528 Ga0501076_0510394 3300049592 Bacteria 991
529 Ga0501077_0012346 3300049593 Bacteria 5351
530 Ga0501077_0120096 3300049593 Bacteria 1665
531 Ga0501077_0131992 3300049593 Bacteria 1584
532 Ga0501253_060486 3300049683 Bacteria 815
533 Ga0501079_0015229 3300049741 Bacteria 5866
534 Ga0501079_0099133 3300049741 Bacteria 2258
535 Ga0501079_0434211 3300049741 Bacteria 1031
536 Ga0501079_0867315 3300049741 Bacteria 711
537 Ga0501080_0118924 3300049742 Bacteria 2449
538 Ga0501080_0347762 3300049742 Bacteria 1339
539 Ga0501081_0036702 3300049743 Bacteria 3342
540 Ga0501081_0040719 3300049743 Bacteria 3181
541 Ga0501083_0017760 3300049744 Bacteria 4961
542 Ga0501035_0110257 3300049822 Bacteria 2412
543 Ga0501035_0322094 3300049822 Bacteria 1299
544 Ga0501045_0048578 3300049824 Bacteria 3093
545 Ga0501045_0061389 3300049824 Bacteria 2757
546 Ga0501045_0692688 3300049824 Bacteria 752
547 nmdc:mga03683_106167_c1 3300050489 Bacteria 1238
548 nmdc:mga03n38_26432_c1 3300050490 Bacteria 2397
549 nmdc:mga03n38_335540_c1 3300050490 Bacteria 819
550 nmdc:mga00v17_56565_c1 3300050491 Bacteria 2399
551 nmdc:mga0yw44_617595_c1 3300050492 Bacteria 737
552 nmdc:mga06z11_307475_c1 3300050494 Bacteria 944
553 nmdc:mga06z11_327272_c1 3300050494 Bacteria 915
554 nmdc:mga04h51_3172_c1 3300050495 Bacteria 3969
555 nmdc:mga07m45_280025_c1 3300050496 Bacteria 970
556 nmdc:mga07m45_31534_c1 3300050496 Bacteria 2938
557 nmdc:mga05p37_118154_c1 3300050507 Bacteria 3258
558 nmdc:mga05p37_1390880_c1 3300050507 Bacteria 708
559 nmdc:mga05p37_1489366_c1 3300050507 Bacteria 675
560 nmdc:mga05p37_434023_c1 3300050507 Bacteria 1525
561 nmdc:mga05p37_49456_c1 3300050507 Bacteria 5171
562 nmdc:mga09592_11509_c1 3300050508 Bacteria 7199
563 nmdc:mga09592_582585_c1 3300050508 Bacteria 960
564 nmdc:mga0qj67_40227_c1 3300050509 Bacteria 3675
565 nmdc:mga0qj67_5524_c1 3300050509 Bacteria 9242
566 nmdc:mga0qj67_948609_c1 3300050509 Bacteria 676
567 nmdc:mga0qj67_97150_c1 3300050509 Bacteria 2372
568 nmdc:mga06r32_1175809_c1 3300050510 Bacteria 714
569 nmdc:mga06r32_316681_c1 3300050510 Bacteria 1546
570 nmdc:mga06r32_382630_c1 3300050510 Bacteria 1390
571 nmdc:mga06r32_43876_c1 3300050510 Bacteria 4256
572 nmdc:mga0rr50_846284_c1 3300050513 Bacteria 780
573 Ga0495601_0007082 3300053077 Bacteria 6570
574 Ga0495601_0038282 3300053077 Bacteria 2999
575 Ga0495595_0017788 3300053084 Bacteria 3062
576 Ga0495619_0022672 3300053085 Bacteria 4021
577 Ga0495619_0041593 3300053085 Bacteria 3007
578 Ga0500644_0000054 3300053088 Bacteria 69110
579 Ga0500646_0095829 3300053090 Bacteria 925
580 Ga0500556_0000251 3300053104 Bacteria 43573
581 Ga0500616_0001293 3300053153 Bacteria 24874
582 Ga0501084_0006796 3300054114 Bacteria 9408
583 Ga0590075_007115 3300059424 Bacteria 2654
584 Ga0501082_0070264 3300060353 Bacteria 3015
585 Ga0501082_0115459 3300060353 Bacteria 2325
586 Ga0501082_0141948 3300060353 Bacteria 2084
587 Ga0501082_0445092 3300060353 Bacteria 1132
588 Ga0501082_1405638 3300060353 Bacteria 609
589 Ga0466962_0040773 3300061719 Bacteria 2222
590 Ga0466962_0080581 3300061719 Bacteria 1556
591 Ga0530510_0030216 3300061734 Bacteria 3891
592 Ga0530510_0258250 3300061734 Bacteria 1299
593 2623501641 2622736605 Bacteria 4992138
594 2808873970 2808606365 Bacteria 4301966
595 2870789045 2870782633 Bacteria 9624083
596 8002777380 8002775197 Bacteria 10728764
597 Ga0501037_0364367
598 LJQas_1029482
599 LJQas_1035759
600 JGI24738J21930_10117805
601 Ga0006778J45830_1014448
602 Ga0006759J45824_1022378
603 Ga0006759J45824_1023080
604 Ga0006777J48905_1058772
605 Ga0007410J51695_1019616
606 Ga0007409J51694_1018899
607 Ga0007409J51694_1023805
608 Ga0007416J51690_1019577
609 Ga0007429J51699_1018739
610 Ga0032354_1002161
611 Ga0032354_1023951
612 Ga0058861_10061018
613 Ga0058861_11819606
614 Ga0070683_100291283
615 Ga0070683_100838323
616 Ga0070683_101191406
617 Ga0070683_101394028
618 Ga0070690_100774956
619 Ga0070677_10213795
620 Ga0068869_100073711
621 Ga0070680_100278226
622 Ga0068868_100094140
623 Ga0068868_100372208
624 Ga0068868_100882322
625 Ga0070660_100173667
626 Ga0070660_100456337
627 Ga0070689_100314167
628 Ga0070692_10201179
629 Ga0070671_100331331
630 Ga0070674_100112033
631 Ga0070659_100737368
632 Ga0070709_10040393
633 Ga0070709_10135357
634 Ga0070713_100182319
635 Ga0070710_10924621
636 Ga0070701_10291423
637 Ga0070711_100116574
638 Ga0070711_100329678
639 Ga0070700_100224911
640 Ga0070700_100233000
641 Ga0070708_100006594
642 Ga0070708_100008011
643 Ga0070663_100302435
644 Ga0070678_101164957
645 Ga0070662_100187369
646 Ga0070681_10692343
647 Ga0068867_101061034
648 Ga0070685_10113538
649 Ga0070706_100006498
650 Ga0070706_101413152
651 Ga0070707_101107153
652 Ga0070698_100004118
653 Ga0070684_100127338
654 Ga0070697_100791875
655 Ga0070696_100770134
656 Ga0070696_101029607
657 Ga0070665_100000454
658 Ga0070665_100467947
659 Ga0068857_100419229
660 Ga0068854_100118643
661 Ga0068859_101478031
662 Ga0068866_10312048
663 Ga0068861_100135471
664 Ga0068870_10285434
665 Ga0068863_101134887
666 Ga0068858_100194565
667 Ga0068858_100281302
668 Ga0081455_10002449
669 Ga0081455_10110766
670 Ga0081455_10248877
671 Ga0081455_10407971
672 Ga0081540_1005584
673 Ga0081540_1062113
674 Ga0081539_10040406
675 Ga0081539_10274483
676 Ga0070717_10075374
677 Ga0070717_11144193
678 Ga0075365_10364173
679 Ga0075365_10412019
680 Ga0075368_10032204
681 Ga0075363_100023407
682 Ga0075363_100164570
683 Ga0075363_100297551
684 Ga0075364_10012267
685 Ga0075432_10142613
686 Ga0070715_10145869
687 Ga0070716_100029722
688 Ga0070716_100069266
689 Ga0075367_10025475
690 Ga0075428_100007986
691 Ga0075428_100141493
692 Ga0075428_100414393
693 Ga0075428_100454786
694 Ga0075430_100002503
695 Ga0075430_100007456
696 Ga0075430_100300178
697 Ga0075431_100232372
698 Ga0075431_100506933
699 Ga0075431_100812768
700 Ga0075433_10411340
701 Ga0075429_100068914
702 Ga0075429_100154032
703 Ga0075429_100236951
704 Ga0075429_100267583
705 Ga0075429_100562732
706 Ga0068865_100146286
707 Ga0068865_100813055
708 Ga0097620_101477975
709 Ga0075435_101091054
710 Ga0075435_101162199
711 Ga0099795_10255755
712 Ga0111539_10324929
713 Ga0111539_10360529
714 Ga0111539_10599458
715 Ga0111539_10613101
716 Ga0111539_12005707
717 Ga0105245_10233780
718 Ga0105245_10746450
719 Ga0105247_10586226
720 Ga0114129_10020786
721 Ga0114129_10061210
722 Ga0114129_10129852
723 Ga0114129_10175588
724 Ga0105243_10217123
725 Ga0105243_11143430
726 Ga0105238_11180708
727 Ga0105249_10536861
728 Ga0105239_10102632
729 Ga0105239_10244735
730 Ga0157373_10168222
731 Ga0157370_10756025
732 Ga0157374_11015153
733 Ga0163162_10870335
734 Ga0163162_12120625
735 Ga0157372_10266657
736 Ga0157372_11000310
737 Ga0157372_12935733
738 Ga0157375_10054806
739 Ga0157375_10337547
740 Ga0157375_10461671
741 Ga0157375_11153820
742 Ga0163163_10176541
743 Ga0163163_10301269
744 Ga0157379_10919854
745 Ga0163161_10346617
746 Ga0206356_11705868
747 Ga0206355_1341727
748 Ga0206352_10356421
749 Ga0206350_11219577
750 Ga0206353_10013481
751 Ga0206353_10805885
752 Ga0206353_11632957
753 Ga0213876_10012555
754 Ga0213875_10001619
755 Ga0213875_10006132
756 Ga0224712_10043293
757 Ga0224712_10050926
758 Ga0224712_10238441
759 Ga0207642_10802518
760 Ga0207647_10209143
761 Ga0207699_10003587
762 Ga0207699_10052568
763 Ga0207684_10158744
764 Ga0207684_10629198
765 Ga0207707_10314027
766 Ga0207663_10786410
767 Ga0207660_11000999
768 Ga0207657_10199385
769 Ga0207657_10304283
770 Ga0207657_10469516
771 Ga0207652_10397497
772 Ga0207652_10923761
773 Ga0207646_10217335
774 Ga0207646_10484810
775 Ga0207681_10397165
776 Ga0207694_11525040
777 Ga0207650_10129166
778 Ga0207659_10588905
779 Ga0207687_10142019
780 Ga0207687_10356804
781 Ga0207687_10851652
782 Ga0207700_10315138
783 Ga0207664_10427982
784 Ga0207644_10141860
785 Ga0207644_10205606
786 Ga0207690_10867793
787 Ga0207709_10391480
788 Ga0207709_11065344
789 Ga0207670_10315450
790 Ga0207670_10886531
791 Ga0207669_10011216
792 Ga0207704_10135505
793 Ga0207665_10077686
794 Ga0207665_10260159
795 Ga0207661_10146517
796 Ga0207661_10206513
797 Ga0207661_10322161
798 Ga0207661_10399662
799 Ga0207661_10831656
800 Ga0207668_10556110
801 Ga0207640_10648404
802 Ga0207677_10178905
803 Ga0207703_10299817
804 Ga0207639_11688805
805 Ga0207708_10112351
806 Ga0207708_10508730
807 Ga0207648_11474725
808 Ga0207676_10951129
809 Ga0207674_10417773
810 Ga0207674_10976209
811 Ga0207675_100810487
812 Ga0207675_101004531
813 Ga0207675_101984477
814 Ga0207698_10407760
815 Ga0209813_10000958
816 Ga0207428_10131306
817 Ga0268266_10001196
818 Ga0268266_10629028
819 Ga0268264_10340514
820 Ga0268264_10355718
821 Ga0307408_100156555
822 Ga0307408_101600191
823 Ga0307405_10149530
824 Ga0307405_10156407
825 Ga0307405_10232111
826 Ga0307413_10068863
827 Ga0307413_11236141
828 Ga0307518_10187305
829 Ga0307410_10010091
830 Ga0307410_10499557
831 Ga0307410_11019972
832 Ga0307406_10022836
833 Ga0307406_11899070
834 Ga0307407_10200654
835 Ga0307407_10272904
836 Ga0307407_10403516
837 Ga0307412_10096028
838 Ga0307412_10185573
839 Ga0307409_100029193
840 Ga0307409_100144596
841 Ga0307409_100246064
842 Ga0307409_100254947
843 Ga0307409_100360308
844 Ga0307409_100446498
845 Ga0307409_100577221
846 Ga0307409_100895094
847 Ga0307409_101563520
848 Ga0307409_102508144
849 Ga0307416_100001007
850 Ga0307416_100109154
851 Ga0307416_100133079
852 Ga0307416_101109399
853 Ga0307416_101181309
854 Ga0307416_101205787
855 Ga0307416_101804179
856 Ga0307414_10144138
857 Ga0307414_10187953
858 Ga0307414_10515827
859 Ga0307414_10944358
860 Ga0307414_11336200
861 Ga0307411_10059705
862 Ga0307411_10371234
863 Ga0307415_100000052
864 Ga0307415_100105189
865 Ga0307415_100194510
866 Ga0307415_100200657
867 Ga0307415_100624739
868 Ga0307415_100762470
869 Ga0307415_100879248
870 Ga0307415_101262907
871 Ga0307507_10251779
872 Ga0373945_0220232
873 Ga0373943_0067404
874 Ga0373962_0203797
875 Ga0373924_0119357
876 Ga0373931_0005789
877 Ga0373947_0005352
878 Ga0373937_0204935
879 Ga0373937_0549045
880 Ga0373925_0043894
881 Ga0395899_0075656
882 Ga0395899_0086240
883 Ga0395899_0508127
884 Ga0395900_0027903
885 Ga0395900_0059299
886 Ga0395900_0068059
887 Ga0395898_0025462
888 Ga0395898_0719044
889 Ga0436364_0391372
890 Ga0436364_0892930
891 Ga0395901_0010026
892 Ga0395901_0099615
893 Ga0400485_19208
894 Ga0400483_178860
895 Ga0400483_198026
896 Ga0436365_0363458
897 Ga0436365_0498425
898 Ga0436365_1371830
899 Ga0436365_1592663
900 Ga0436360_0972995
901 Ga0436362_0135106
902 Ga0439447_113128
903 Ga0451849_1132018
904 Ga0451843_0108042
905 Ga0451853_0680839
906 Ga0439443_066478
907 Ga0439448_0059858
908 Ga0439452_032050
909 Ga0439462_0100491
910 Ga0450923_136635
911 Ga0466969_0027901
912 Ga0466969_0281703
913 Ga0466965_0194059
914 Ga0466966_0045643
915 Ga0466966_0071973
916 Ga0466966_0551661
917 Ga0466961_0035584
918 Ga0466961_0053949
919 Ga0466961_0087027
920 Ga0466961_0236639
921 Ga0466961_0249886
922 Ga0466963_0010583
923 Ga0466963_0020992
924 Ga0466963_0035131
925 Ga0466963_0151763
926 Ga0466963_0324604
927 Ga0466963_0349033
928 Ga0466963_0392749
929 Ga0466963_0759983
930 Ga0466971_0008032
931 Ga0466971_0017729
932 Ga0466971_0142002
933 Ga0466971_0195273
934 Ga0466970_0046517
935 Ga0466970_0289459
936 Ga0466957_0112425
937 Ga0466957_0156309
938 Ga0466957_0203467
939 Ga0466957_0239511
940 Ga0466957_0243436
941 Ga0466957_0332807
942 Ga0466957_0542465
943 Ga0466960_0000987
944 Ga0466960_0060742
945 Ga0466960_0111659
946 Ga0466960_0126506
947 Ga0466959_0015615
948 Ga0466959_0045687
949 Ga0466959_0085365
950 Ga0466959_0210297
951 Ga0466958_0025685
952 Ga0466958_0246411
953 Ga0466958_0437845
954 Ga0466967_0003763
955 Ga0466967_0005955
956 Ga0466967_0018828
957 Ga0466967_0029563
958 Ga0466967_0038615
959 Ga0466967_0049671
960 Ga0466967_0277307
961 Ga0466967_0413197
962 Ga0466967_1630390
963 Ga0495592_0055040
964 Ga0495603_0005138
965 Ga0495629_0005227
966 Ga0495641_0054662
967 Ga0495641_0361986
968 Ga0495651_0108273
969 Ga0495651_0203334
970 Ga0495653_0013747
971 Ga0495653_0056483
972 Ga0495653_0241461
973 Ga0495582_0000075
974 Ga0495582_0078602
975 Ga0495582_0409945
976 Ga0495639_0002298
977 Ga0495639_0026669
978 Ga0495664_0051854
979 Ga0495596_0131851
980 Ga0495618_0010054
981 Ga0495618_0204413
982 Ga0495628_0026440
983 Ga0495628_0312950
984 Ga0495630_0048035
985 Ga0495630_0076099
986 Ga0495630_0176859
987 Ga0495630_0274196
988 Ga0495644_0174093
989 Ga0495666_0031300
990 Ga0495666_0064110
991 Ga0495665_0108488
992 Ga0495640_0050555
993 Ga0495640_0643722
994 Ga0495587_0216063
995 Ga0495598_0138323
996 Ga0495598_0376595
997 Ga0495667_0061103
998 Ga0495667_0201342
999 Ga0495667_0231043
1000 Ga0495634_0116473
1001 Ga0495657_0014536
1002 Ga0495657_0017885
1003 Ga0495657_0172181
1004 Ga0495646_0469007
1005 Ga0495658_0008951
1006 Ga0495658_0015036
1007 Ga0495613_0001013
1008 Ga0495613_0575386
1009 Ga0495624_0484128
1010 Ga0495581_0005979
1011 Ga0495674_0038572
1012 Ga0495674_0553522
1013 Ga0495672_0209611
1014 Ga0495680_0139741
1015 Ga0495680_0275656
1016 Ga0495675_0078945
1017 Ga0495677_0169400
1018 Ga0495684_0006238
1019 Ga0495593_0060384
1020 Ga0495602_0095019
1021 Ga0495602_0115793
1022 Ga0496100_0050543
1023 Ga0496100_0626265
1024 Ga0496101_0011487
1025 Ga0496101_0063467
1026 Ga0496101_1302183
1027 Ga0496101_1360197
1028 Ga0496102_0018211
1029 Ga0496102_0124204
1030 Ga0496102_0182811
1031 Ga0496102_0729006
1032 Ga0496102_0812875
1033 Ga0496102_0822336
1034 Ga0496103_0030530
1035 Ga0496103_0074926
1036 Ga0496103_0576858
1037 Ga0496104_0089578
1038 Ga0496104_0525627
1039 Ga0496105_0027585
1040 Ga0496105_0061917
1041 Ga0496105_0092686
1042 Ga0496105_0214820
1043 Ga0496105_0408959
1044 Ga0496107_0154740
1045 Ga0496107_0253047
1046 Ga0496107_0315902
1047 Ga0496108_0016493
1048 Ga0496108_0179221
1049 Ga0496108_0206443
1050 Ga0496109_0056932
1051 Ga0496109_0169324
1052 Ga0496109_0314012
1053 Ga0496112_0001808
1054 Ga0496113_0175999
1055 Ga0496113_0366860
1056 Ga0496113_1095521
1057 Ga0496114_0008221
1058 Ga0496114_0027612
1059 Ga0496114_0030465
1060 Ga0496114_0056824
1061 Ga0496114_0677749
1062 Ga0496115_0002644
1063 Ga0496115_0034356
1064 Ga0496115_0048890
1065 Ga0496115_0521265
1066 Ga0496125_0084712
1067 Ga0496126_0000055
1068 Ga0501309_016777
1069 Ga0501309_060490
1070 Ga0501317_064546
1071 Ga0501318_001955
1072 Ga0501318_002983
1073 Ga0501318_008711
1074 Ga0501318_044374
1075 Ga0501321_012067
1076 Ga0501031_0002491
1077 Ga0501031_0147051
1078 Ga0501031_0632214
1079 Ga0501032_0500394
1080 Ga0501034_0002482
1081 Ga0501034_0587878
1082 Ga0501034_0642018
1083 Ga0501036_0001496
1084 Ga0501036_0154649
1085 Ga0501037_0058570
1086 Ga0501038_0002265
1087 Ga0501039_0009195
1088 Ga0501039_0031305
1089 Ga0501039_0588135
1090 Ga0501040_0024662
1091 Ga0501041_0030083
1092 Ga0501042_0013030
1093 Ga0501042_0117799
1094 Ga0501043_0003597
1095 Ga0501043_0069772
1096 Ga0501043_0210546
1097 Ga0501043_0980993
1098 Ga0501046_0431371
1099 Ga0501047_0007321
1100 Ga0501048_0001877
1101 Ga0501048_0127641
1102 Ga0501067_0029164
1103 Ga0501067_0121435
1104 Ga0501068_0006663
1105 Ga0501068_0419468
1106 Ga0501069_0025634
1107 Ga0501069_0736306
1108 Ga0501070_0090507
1109 Ga0501070_0105508
1110 Ga0501070_0497269
1111 Ga0501071_0031205
1112 Ga0501071_0128035
1113 Ga0501072_0014914
1114 Ga0501072_0035775
1115 Ga0501072_0112473
1116 Ga0501073_0005568
1117 Ga0501073_0029283
1118 Ga0501074_0001601
1119 Ga0501074_0021979
1120 Ga0501074_0196516
1121 Ga0501075_0022583
1122 Ga0501076_0013492
1123 Ga0501076_0164957
1124 Ga0501076_0510394
1125 Ga0501077_0012346
1126 Ga0501077_0120096
1127 Ga0501077_0131992
1128 Ga0501253_060486
1129 Ga0501079_0015229
1130 Ga0501079_0099133
1131 Ga0501079_0434211
1132 Ga0501079_0867315
1133 Ga0501080_0118924
1134 Ga0501080_0347762
1135 Ga0501081_0036702
1136 Ga0501081_0040719
1137 Ga0501083_0017760
1138 Ga0501035_0110257
1139 Ga0501035_0322094
1140 Ga0501045_0048578
1141 Ga0501045_0061389
1142 Ga0501045_0692688
1143 nmdc:mga03683_106167_c1
1144 nmdc:mga03n38_26432_c1
1145 nmdc:mga03n38_335540_c1
1146 nmdc:mga00v17_56565_c1
1147 nmdc:mga0yw44_617595_c1
1148 nmdc:mga06z11_307475_c1
1149 nmdc:mga06z11_327272_c1
1150 nmdc:mga04h51_3172_c1
1151 nmdc:mga07m45_280025_c1
1152 nmdc:mga07m45_31534_c1
1153 nmdc:mga05p37_118154_c1
1154 nmdc:mga05p37_1390880_c1
1155 nmdc:mga05p37_1489366_c1
1156 nmdc:mga05p37_434023_c1
1157 nmdc:mga05p37_49456_c1
1158 nmdc:mga09592_11509_c1
1159 nmdc:mga09592_582585_c1
1160 nmdc:mga0qj67_40227_c1
1161 nmdc:mga0qj67_5524_c1
1162 nmdc:mga0qj67_948609_c1
1163 nmdc:mga0qj67_97150_c1
1164 nmdc:mga06r32_1175809_c1
1165 nmdc:mga06r32_316681_c1
1166 nmdc:mga06r32_382630_c1
1167 nmdc:mga06r32_43876_c1
1168 nmdc:mga0rr50_846284_c1
1169 Ga0495601_0007082
1170 Ga0495601_0038282
1171 Ga0495595_0017788
1172 Ga0495619_0022672
1173 Ga0495619_0041593
1174 Ga0500644_0000054
1175 Ga0500646_0095829
1176 Ga0500556_0000251
1177 Ga0500616_0001293
1178 Ga0501084_0006796
1179 Ga0590075_007115
1180 Ga0501082_0070264
1181 Ga0501082_0115459
1182 Ga0501082_0141948
1183 Ga0501082_0445092
1184 Ga0501082_1405638
1185 Ga0466962_0040773
1186 Ga0466962_0080581
1187 Ga0530510_0030216
1188 Ga0530510_0258250
1189 2623501641
1190 2808873970
1191 2870789045
1192 8002777380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

44

154

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8219 36 162
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.7916 40 158
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7866 37 161
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.7824 37 164
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.778 39 161
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8335 37 96 3.10.180.10
af_C6KSP5_186_307_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7966 43 157 3.10.180.10
af_K7KBB9_206_354_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7802 39 95 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.778 39 161 3.10.180.10
1h9sA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.778 64 94 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7W0GFR5-F1-model_v4 VOC family protein 0.9399 9 98
AF-A0A6J7KC72-F1-model_v4 Unannotated protein 0.9307 46 170
AF-A0A4V2ATK9-F1-model_v4 deleted 0.9212 35 97
AF-A0A7W0GFR5-F1-model_v4 VOC family protein 0.9206 9 98
AF-I0H322-F1-model_v4 VOC domain-containing protein 0.9177 108 171

Map