F467508

General Info

Members Datasets Scaffolds Average Seq Length
596 362 1192 155

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100177277|Ga0070683_1001772773
Length 180
Sequence MQLQDMYQEIILDHYRNPHHKGLRDPFDAQVYHVNPTCGDEVTLRVSLKDTGGEPVVEDVSFDSLGCSISQASASVMADLVIGKPVGEAMKIGDAFLELMQSKGRLEPDEDVLEDAVAFAGVSKYPARVKCALLGWMAWKDATTRALSSPGGRPPVPPDARPMGEPDDIGRASRVETTEE

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
89 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
90 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
91 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
92 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
183 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
184 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031633 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
187 3300031635 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
188 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
189 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
190 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
221 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
222 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
232 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
233 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
234 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
235 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
236 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
237 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
240 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
241 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
242 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
243 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
244 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
245 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
246 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
299 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
300 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
313 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
314 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
315 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
316 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
317 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
318 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
319 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
320 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
362 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.4
Metatranscriptomes 15.27
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.52
Rhizosphere 91.95
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100177277 3300005329 Bacteria 2023
2 JGI24738J21930_10063950 3300002075 Bacteria 757
3 Ga0006778J45830_1010108 3300003162 Bacteria 919
4 Ga0006759J45824_1012545 3300003163 Bacteria 1003
5 JGI25406J46586_10020959 3300003203 Bacteria 2631
6 Ga0006777J48905_1010447 3300003308 Bacteria 986
7 JGI25407J50210_10014235 3300003373 Bacteria 2050
8 JGI25407J50210_10071387 3300003373 Bacteria 866
9 Ga0007417J51691_1013696 3300003544 Bacteria 908
10 Ga0007427J51700_108864 3300003559 Bacteria 851
11 Ga0007410J51695_1012808 3300003574 Bacteria 928
12 Ga0007416J51690_1014312 3300003577 Bacteria 931
13 Ga0007429J51699_1007612 3300003579 Bacteria 1128
14 Ga0032354_1005608 3300003693 Bacteria 961
15 Ga0006780_1005377 3300003735 Bacteria 926
16 Ga0058863_11966191 3300004799 Bacteria 1177
17 Ga0058861_10010638 3300004800 Bacteria 1618
18 Ga0058861_11796351 3300004800 Bacteria 1104
19 Ga0058862_12884799 3300004803 Bacteria 1099
20 Ga0070658_10312548 3300005327 Bacteria 1341
21 Ga0070658_10315848 3300005327 Bacteria 1333
22 Ga0070658_10534696 3300005327 Bacteria 1014
23 Ga0070683_100004763 3300005329 Bacteria 11229
24 Ga0070683_100088092 3300005329 Bacteria 2912
25 Ga0070683_100185198 3300005329 Bacteria 1976
26 Ga0068869_100673903 3300005334 Bacteria 880
27 Ga0068869_100889418 3300005334 Bacteria 770
28 Ga0070680_100029458 3300005336 Bacteria 4410
29 Ga0070680_100306085 3300005336 Bacteria 1348
30 Ga0070682_100048440 3300005337 Bacteria 2646
31 Ga0070682_100336469 3300005337 Bacteria 1120
32 Ga0068868_100426775 3300005338 Bacteria 1149
33 Ga0070660_100028727 3300005339 Bacteria 4163
34 Ga0070691_10288013 3300005341 Bacteria 893
35 Ga0070661_100073475 3300005344 Bacteria 2518
36 Ga0070692_10085541 3300005345 Bacteria 1706
37 Ga0070692_10551846 3300005345 Bacteria 755
38 Ga0070668_100165013 3300005347 Bacteria 1799
39 Ga0070674_100098824 3300005356 Bacteria 2122
40 Ga0070674_101374327 3300005356 Bacteria 632
41 Ga0070673_100706284 3300005364 Bacteria 926
42 Ga0070659_100403866 3300005366 Bacteria 1154
43 Ga0070659_101684284 3300005366 Bacteria 567
44 Ga0070709_10141912 3300005434 Bacteria 1651
45 Ga0070709_10404825 3300005434 Bacteria 1019
46 Ga0070714_100032255 3300005435 Bacteria 4371
47 Ga0070714_100215325 3300005435 Bacteria 1763
48 Ga0070714_100247509 3300005435 Bacteria 1647
49 Ga0070714_100368733 3300005435 Bacteria 1352
50 Ga0070714_100438346 3300005435 Bacteria 1239
51 Ga0070714_101517397 3300005435 Bacteria 655
52 Ga0070713_100057621 3300005436 Bacteria 3236
53 Ga0070713_100058972 3300005436 Bacteria 3203
54 Ga0070713_100131287 3300005436 Bacteria 2209
55 Ga0070713_100156775 3300005436 Bacteria 2030
56 Ga0070713_100332523 3300005436 Bacteria 1406
57 Ga0070713_100363795 3300005436 Bacteria 1344
58 Ga0070713_100414692 3300005436 Bacteria 1260
59 Ga0070713_100518906 3300005436 Bacteria 1126
60 Ga0070713_100915948 3300005436 Bacteria 843
61 Ga0070710_10040693 3300005437 Bacteria 2562
62 Ga0070711_100795878 3300005439 Bacteria 801
63 Ga0070708_100968547 3300005445 Bacteria 798
64 Ga0070708_101791060 3300005445 Bacteria 570
65 Ga0070663_100153499 3300005455 Bacteria 1767
66 Ga0070663_100188053 3300005455 Bacteria 1606
67 Ga0070663_100357007 3300005455 Bacteria 1185
68 Ga0070678_100198610 3300005456 Bacteria 1654
69 Ga0070662_100061127 3300005457 Bacteria 2749
70 Ga0070681_10101050 3300005458 Bacteria 2829
71 Ga0070681_10734581 3300005458 Bacteria 903
72 Ga0070681_11626349 3300005458 Bacteria 572
73 Ga0068867_100147082 3300005459 Bacteria 1848
74 Ga0070685_10825946 3300005466 Bacteria 685
75 Ga0070707_100154441 3300005468 Bacteria 2236
76 Ga0070698_100011832 3300005471 Bacteria 9257
77 Ga0070679_100009873 3300005530 Bacteria 9031
78 Ga0070679_100233521 3300005530 Bacteria 1798
79 Ga0070679_100819265 3300005530 Bacteria 874
80 Ga0070684_100105734 3300005535 Bacteria 2519
81 Ga0070684_100268028 3300005535 Bacteria 1563
82 Ga0070684_100674682 3300005535 Bacteria 963
83 Ga0070684_100899142 3300005535 Bacteria 829
84 Ga0068853_100102552 3300005539 Bacteria 2532
85 Ga0070672_101364355 3300005543 Bacteria 634
86 Ga0070665_100157367 3300005548 Bacteria 2274
87 Ga0068857_100199342 3300005577 Bacteria 1824
88 Ga0068857_100293093 3300005577 Bacteria 1499
89 Ga0068856_100178274 3300005614 Bacteria 2137
90 Ga0070702_100120583 3300005615 Bacteria 1641
91 Ga0070702_100279074 3300005615 Bacteria 1146
92 Ga0068852_100109935 3300005616 Bacteria 2504
93 Ga0068852_100195796 3300005616 Bacteria 1910
94 Ga0068852_101383096 3300005616 Bacteria 726
95 Ga0068852_102302406 3300005616 Bacteria 560
96 Ga0068864_100148860 3300005618 Bacteria 2119
97 Ga0068866_10701538 3300005718 Bacteria 694
98 Ga0068861_100192334 3300005719 Bacteria 1707
99 Ga0068861_100197468 3300005719 Bacteria 1686
100 Ga0068851_10068342 3300005834 Bacteria 1834
101 Ga0068858_102172361 3300005842 Bacteria 549
102 Ga0081455_10007809 3300005937 Bacteria 11204
103 Ga0081455_10015310 3300005937 Bacteria 7457
104 Ga0081455_10122623 3300005937 Bacteria 2045
105 Ga0081455_10179881 3300005937 Bacteria 1602
106 Ga0081538_10000075 3300005981 Bacteria 94222
107 Ga0081538_10001393 3300005981 Bacteria 24785
108 Ga0081538_10031906 3300005981 Bacteria 3542
109 Ga0081538_10231483 3300005981 Bacteria 721
110 Ga0081540_1001276 3300005983 Bacteria 21966
111 Ga0081539_10000314 3300005985 Bacteria 108451
112 Ga0081539_10045430 3300005985 Bacteria 2526
113 Ga0070717_10116527 3300006028 Bacteria 2284
114 Ga0070717_10274087 3300006028 Bacteria 1495
115 Ga0070717_10709435 3300006028 Bacteria 914
116 Ga0075432_10000509 3300006058 Bacteria 11647
117 Ga0075432_10002341 3300006058 Bacteria 6313
118 Ga0070716_100655182 3300006173 Bacteria 797
119 Ga0070712_100041001 3300006175 Bacteria 3176
120 Ga0070712_100077329 3300006175 Bacteria 2399
121 Ga0075427_10014683 3300006194 Bacteria 1203
122 Ga0075428_100001731 3300006844 Bacteria 23290
123 Ga0075428_100011952 3300006844 Bacteria 9659
124 Ga0075428_100025431 3300006844 Bacteria 6552
125 Ga0075428_100067209 3300006844 Bacteria 3924
126 Ga0075428_100158128 3300006844 Bacteria 2460
127 Ga0075428_100158804 3300006844 Bacteria 2454
128 Ga0075428_101284762 3300006844 Bacteria 770
129 Ga0075428_102637962 3300006844 Bacteria 513
130 Ga0075430_100001112 3300006846 Bacteria 21393
131 Ga0075430_100001488 3300006846 Bacteria 19092
132 Ga0075430_100173682 3300006846 Bacteria 1793
133 Ga0075430_100205218 3300006846 Bacteria 1636
134 Ga0075431_100002366 3300006847 Bacteria 18112
135 Ga0075431_100008780 3300006847 Bacteria 10126
136 Ga0075431_100131664 3300006847 Bacteria 2579
137 Ga0075431_100238231 3300006847 Bacteria 1852
138 Ga0075431_100389617 3300006847 Bacteria 1396
139 Ga0075433_10005569 3300006852 Bacteria 9892
140 Ga0075433_10008249 3300006852 Bacteria 8301
141 Ga0075434_100000369 3300006871 Bacteria 32662
142 Ga0075434_100000609 3300006871 Bacteria 27718
143 Ga0075429_100005091 3300006880 Bacteria 11300
144 Ga0075429_100018407 3300006880 Bacteria 6052
145 Ga0075429_100125401 3300006880 Bacteria 2245
146 Ga0075429_100141021 3300006880 Bacteria 2110
147 Ga0075429_100740431 3300006880 Bacteria 861
148 Ga0068865_100068629 3300006881 Bacteria 2507
149 Ga0068865_100330502 3300006881 Bacteria 1229
150 Ga0075436_100001055 3300006914 Bacteria 18592
151 Ga0075435_100002301 3300007076 Bacteria 12629
152 Ga0075435_100052257 3300007076 Bacteria 3293
153 Ga0105240_10367717 3300009093 Bacteria 1627
154 Ga0111539_10000342 3300009094 Bacteria 57280
155 Ga0111539_10026716 3300009094 Bacteria 7055
156 Ga0105245_10097446 3300009098 Bacteria 2716
157 Ga0114129_10001259 3300009147 Bacteria 33804
158 Ga0114129_10001519 3300009147 Bacteria 31396
159 Ga0114129_10004718 3300009147 Bacteria 19248
160 Ga0114129_10429711 3300009147 Bacteria 1735
161 Ga0114129_10624947 3300009147 Bacteria 1393
162 Ga0114129_10745491 3300009147 Bacteria 1254
163 Ga0105243_10023890 3300009148 Bacteria 4658
164 Ga0105243_10033107 3300009148 Bacteria 3995
165 Ga0105243_11230666 3300009148 Bacteria 763
166 Ga0105242_10038129 3300009176 Bacteria 3863
167 Ga0105237_10761004 3300009545 Bacteria 975
168 Ga0105237_11226610 3300009545 Bacteria 756
169 Ga0105238_10494405 3300009551 Bacteria 1223
170 Ga0105238_10602967 3300009551 Bacteria 1106
171 Ga0105249_10033420 3300009553 Bacteria 4656
172 Ga0105249_10043611 3300009553 Bacteria 4078
173 Ga0105239_10027976 3300010375 Bacteria 6203
174 Ga0105239_10165410 3300010375 Bacteria 2473
175 Ga0105239_10381888 3300010375 Bacteria 1593
176 Ga0105246_10376677 3300011119 Bacteria 1171
177 Ga0105246_11197705 3300011119 Bacteria 699
178 Ga0105246_11417956 3300011119 Bacteria 649
179 Ga0157321_1018196 3300012487 Bacteria 620
180 Ga0157343_1005369 3300012488 Bacteria 829
181 Ga0157329_1001268 3300012491 Bacteria 1247
182 Ga0157342_1026721 3300012507 Bacteria 704
183 Ga0154012_171469 3300013059 Bacteria 709
184 Ga0157371_10786096 3300013102 Bacteria 717
185 Ga0157370_10020659 3300013104 Bacteria 6573
186 Ga0157370_10878892 3300013104 Bacteria 814
187 Ga0157369_10061978 3300013105 Bacteria 4031
188 Ga0157369_10062091 3300013105 Bacteria 4027
189 Ga0157378_10350785 3300013297 Bacteria 1441
190 Ga0157378_11800726 3300013297 Bacteria 660
191 Ga0163162_10043823 3300013306 Bacteria 4480
192 Ga0163162_10062585 3300013306 Bacteria 3761
193 Ga0163162_10999118 3300013306 Bacteria 946
194 Ga0157372_10026691 3300013307 Bacteria 6286
195 Ga0157372_10367594 3300013307 Bacteria 1676
196 Ga0157372_10510709 3300013307 Bacteria 1401
197 Ga0157372_11856279 3300013307 Bacteria 693
198 Ga0157375_11008433 3300013308 Bacteria 972
199 Ga0157375_13007377 3300013308 Bacteria 563
200 Ga0163163_10466793 3300014325 Bacteria 1323
201 Ga0157380_10870181 3300014326 Bacteria 925
202 Ga0182008_10202362 3300014497 Unclassified 1011
203 Ga0157379_12093650 3300014968 Bacteria 561
204 Ga0182005_1224981 3300015265 Bacteria 572
205 Ga0163161_10233437 3300017792 Bacteria 1428
206 Ga0163161_10309099 3300017792 Bacteria 1247
207 Ga0197907_10013784 3300020069 Bacteria 2030
208 Ga0197907_10180632 3300020069 Bacteria 1324
209 Ga0197907_10520392 3300020069 Bacteria 1565
210 Ga0197907_11310757 3300020069 Bacteria 761
211 Ga0206356_11435788 3300020070 Bacteria 784
212 Ga0206356_11906684 3300020070 Bacteria 1664
213 Ga0206349_1390947 3300020075 Bacteria 3192
214 Ga0206351_10076347 3300020077 Bacteria 1303
215 Ga0206352_10547388 3300020078 Bacteria 1634
216 Ga0206352_11156770 3300020078 Bacteria 1079
217 Ga0206350_10109418 3300020080 Bacteria 2603
218 Ga0206350_10380936 3300020080 Bacteria 2160
219 Ga0206354_10110348 3300020081 Bacteria 2454
220 Ga0206354_10514547 3300020081 Bacteria 2634
221 Ga0206354_11612694 3300020081 Bacteria 753
222 Ga0206353_10012202 3300020082 Bacteria 1183
223 Ga0206353_10476058 3300020082 Bacteria 3820
224 Ga0224712_10002260 3300022467 Bacteria 4713
225 Ga0224712_10012985 3300022467 Bacteria 2640
226 Ga0224712_10345595 3300022467 Bacteria 702
227 Ga0207692_10020794 3300025898 Bacteria 2992
228 Ga0207642_10047999 3300025899 Bacteria 1912
229 Ga0207642_10730162 3300025899 Bacteria 626
230 Ga0207688_10083973 3300025901 Bacteria 1822
231 Ga0207688_10127800 3300025901 Bacteria 1488
232 Ga0207699_10118087 3300025906 Bacteria 1711
233 Ga0207699_10193027 3300025906 Bacteria 1375
234 Ga0207699_10218489 3300025906 Bacteria 1300
235 Ga0207705_10016772 3300025909 Bacteria 5246
236 Ga0207705_10039451 3300025909 Bacteria 3385
237 Ga0207707_10053038 3300025912 Bacteria 3529
238 Ga0207707_10124619 3300025912 Bacteria 2253
239 Ga0207693_10036436 3300025915 Bacteria 3878
240 Ga0207693_10055089 3300025915 Bacteria 3120
241 Ga0207693_10081176 3300025915 Bacteria 2539
242 Ga0207693_10115084 3300025915 Bacteria 2111
243 Ga0207663_11573279 3300025916 Bacteria 529
244 Ga0207660_10025970 3300025917 Bacteria 3983
245 Ga0207657_10019291 3300025919 Bacteria 6479
246 Ga0207649_10048751 3300025920 Bacteria 2613
247 Ga0207652_10013383 3300025921 Bacteria 6642
248 Ga0207652_10777291 3300025921 Bacteria 851
249 Ga0207652_10844750 3300025921 Bacteria 811
250 Ga0207646_10129309 3300025922 Bacteria 2272
251 Ga0207694_10598164 3300025924 Bacteria 927
252 Ga0207687_10073048 3300025927 Bacteria 2455
253 Ga0207687_10144154 3300025927 Bacteria 1810
254 Ga0207700_10014921 3300025928 Bacteria 5106
255 Ga0207700_10024802 3300025928 Bacteria 4155
256 Ga0207700_10082550 3300025928 Bacteria 2513
257 Ga0207700_10116776 3300025928 Bacteria 2156
258 Ga0207700_10416580 3300025928 Bacteria 1179
259 Ga0207700_11081027 3300025928 Bacteria 717
260 Ga0207664_10023584 3300025929 Bacteria 4613
261 Ga0207664_10189622 3300025929 Bacteria 1769
262 Ga0207664_10204831 3300025929 Bacteria 1704
263 Ga0207664_10316474 3300025929 Bacteria 1376
264 Ga0207664_10399180 3300025929 Bacteria 1223
265 Ga0207664_10480419 3300025929 Bacteria 1111
266 Ga0207664_10640087 3300025929 Bacteria 955
267 Ga0207690_10074217 3300025932 Bacteria 2355
268 Ga0207690_10158287 3300025932 Bacteria 1686
269 Ga0207706_10005535 3300025933 Bacteria 11776
270 Ga0207686_10019197 3300025934 Bacteria 3884
271 Ga0207709_10003708 3300025935 Bacteria 8999
272 Ga0207709_10082201 3300025935 Bacteria 2079
273 Ga0207709_10395905 3300025935 Bacteria 1055
274 Ga0207669_10026107 3300025937 Bacteria 3171
275 Ga0207669_10407472 3300025937 Bacteria 1067
276 Ga0207669_10678943 3300025937 Bacteria 845
277 Ga0207704_10217348 3300025938 Bacteria 1411
278 Ga0207704_10778308 3300025938 Bacteria 798
279 Ga0207665_10018442 3300025939 Bacteria 4585
280 Ga0207689_10459009 3300025942 Bacteria 1065
281 Ga0207689_10461418 3300025942 Bacteria 1062
282 Ga0207661_10002859 3300025944 Bacteria 11934
283 Ga0207661_10010667 3300025944 Bacteria 6622
284 Ga0207661_10146352 3300025944 Bacteria 2039
285 Ga0207661_10893243 3300025944 Bacteria 818
286 Ga0207651_10583179 3300025960 Bacteria 976
287 Ga0207668_10082950 3300025972 Bacteria 2331
288 Ga0207640_10303951 3300025981 Bacteria 1263
289 Ga0207677_10223962 3300026023 Bacteria 1510
290 Ga0207703_11182498 3300026035 Bacteria 735
291 Ga0207639_11154035 3300026041 Bacteria 727
292 Ga0207678_10045337 3300026067 Bacteria 3802
293 Ga0207678_10494677 3300026067 Bacteria 1066
294 Ga0207678_10503392 3300026067 Bacteria 1056
295 Ga0207702_10613233 3300026078 Bacteria 1068
296 Ga0207648_10143329 3300026089 Bacteria 2107
297 Ga0207676_10571037 3300026095 Bacteria 1083
298 Ga0207676_10715789 3300026095 Bacteria 971
299 Ga0207676_11075278 3300026095 Bacteria 795
300 Ga0207674_10110837 3300026116 Bacteria 2719
301 Ga0207675_100042413 3300026118 Bacteria 4248
302 Ga0207675_100069215 3300026118 Bacteria 3298
303 Ga0207683_10272862 3300026121 Bacteria 1545
304 Ga0207683_10280863 3300026121 Bacteria 1522
305 Ga0207683_10704314 3300026121 Bacteria 936
306 Ga0207698_10335490 3300026142 Bacteria 1422
307 Ga0207698_10372609 3300026142 Bacteria 1356
308 Ga0207698_10687518 3300026142 Bacteria 1017
309 Ga0207428_10002250 3300027907 Bacteria 19386
310 Ga0207428_10004258 3300027907 Bacteria 13698
311 Ga0268265_10196831 3300028380 Bacteria 1745
312 Ga0268264_10254107 3300028381 Bacteria 1634
313 Ga0268264_10601575 3300028381 Bacteria 1083
314 Ga0265337_1000225 3300028556 Bacteria 30201
315 Ga0265326_10016180 3300028558 Bacteria 2157
316 Ga0265319_1000356 3300028563 Bacteria 33233
317 Ga0265334_10043842 3300028573 Bacteria 1739
318 Ga0265318_10040036 3300028577 Bacteria 1786
319 Ga0265323_10018756 3300028653 Bacteria 2674
320 Ga0265322_10013016 3300028654 Bacteria 2408
321 Ga0265336_10007394 3300028666 Bacteria 3905
322 Ga0265338_10000449 3300028800 Bacteria 73385
323 Ga0265338_10017447 3300028800 Bacteria 7734
324 Ga0265338_10025611 3300028800 Bacteria 5980
325 Ga0265324_10002014 3300029957 Bacteria 10821
326 Ga0265775_101092 3300030762 Bacteria 1238
327 Ga0265763_1017016 3300030763 Bacteria 734
328 Ga0265767_103254 3300030836 Bacteria 909
329 Ga0265766_1001331 3300030863 Bacteria 1236
330 Ga0265766_1001564 3300030863 Bacteria 1175
331 Ga0265777_103832 3300030877 Bacteria 939
332 Ga0265764_101889 3300030882 Bacteria 979
333 Ga0265769_102964 3300030888 Bacteria 920
334 Ga0265768_108289 3300030963 Bacteria 643
335 Ga0265771_1010108 3300031010 Bacteria 687
336 Ga0265325_10003579 3300031241 Bacteria 10079
337 Ga0265340_10000535 3300031247 Bacteria 20986
338 Ga0265339_10095015 3300031249 Bacteria 1557
339 Ga0265316_10024385 3300031344 Bacteria 5070
340 Ga0307408_100156247 3300031548 Bacteria 1806
341 Ga0310117_100468 3300031592 Bacteria 3055
342 Ga0310103_105733 3300031614 Bacteria 1654
343 Ga0310107_117501 3300031615 Bacteria 879
344 Ga0307508_10048629 3300031616 Bacteria 3777
345 Ga0310108_119904 3300031633 Bacteria 623
346 Ga0310115_102571 3300031635 Bacteria 2110
347 Ga0310111_113387 3300031667 Bacteria 1045
348 Ga0310119_111784 3300031686 Bacteria 1032
349 Ga0310101_107890 3300031690 Bacteria 1258
350 Ga0265342_10003409 3300031712 Bacteria 13072
351 Ga0307405_10001101 3300031731 Bacteria 11041
352 Ga0307405_10046974 3300031731 Bacteria 2656
353 Ga0307405_10174559 3300031731 Bacteria 1536
354 Ga0307405_11906831 3300031731 Bacteria 530
355 Ga0316045_116426 3300031815 Bacteria 758
356 Ga0307413_10008221 3300031824 Bacteria 4909
357 Ga0307413_10042242 3300031824 Bacteria 2677
358 Ga0307413_10055810 3300031824 Bacteria 2406
359 Ga0307413_10680469 3300031824 Bacteria 852
360 Ga0307410_10000838 3300031852 Bacteria 13071
361 Ga0307410_10261846 3300031852 Bacteria 1349
362 Ga0307410_10488148 3300031852 Bacteria 1011
363 Ga0307406_10000241 3300031901 Bacteria 33132
364 Ga0307406_10001305 3300031901 Bacteria 13982
365 Ga0307406_10155910 3300031901 Bacteria 1635
366 Ga0307406_10209307 3300031901 Bacteria 1441
367 Ga0307406_10960536 3300031901 Bacteria 731
368 Ga0307407_10008733 3300031903 Bacteria 4670
369 Ga0307407_10013389 3300031903 Bacteria 3980
370 Ga0307412_10033921 3300031911 Bacteria 3248
371 Ga0307412_10668892 3300031911 Bacteria 888
372 Ga0307409_100000319 3300031995 Bacteria 19718
373 Ga0307409_100153043 3300031995 Bacteria 2005
374 Ga0307409_100858082 3300031995 Bacteria 919
375 Ga0307409_101245284 3300031995 Bacteria 768
376 Ga0307409_101295232 3300031995 Bacteria 754
377 Ga0307416_100000079 3300032002 Bacteria 70731
378 Ga0307416_100072700 3300032002 Bacteria 2863
379 Ga0307416_100763662 3300032002 Bacteria 1060
380 Ga0307414_10002108 3300032004 Bacteria 10368
381 Ga0307414_10415876 3300032004 Bacteria 1171
382 Ga0307414_10450591 3300032004 Bacteria 1128
383 Ga0307414_10556628 3300032004 Bacteria 1023
384 Ga0307411_10009439 3300032005 Bacteria 5129
385 Ga0307411_10193537 3300032005 Bacteria 1555
386 Ga0307411_10292350 3300032005 Bacteria 1302
387 Ga0307415_100000527 3300032126 Bacteria 16676
388 Ga0307415_100069076 3300032126 Bacteria 2476
389 Ga0307415_100087434 3300032126 Bacteria 2245
390 Ga0307415_100087438 3300032126 Bacteria 2245
391 Ga0307415_100442083 3300032126 Bacteria 1122
392 Ga0316216_1003344 3300033548 Bacteria 1152
393 Ga0373934_0086631 3300035086 Bacteria 1260
394 Ga0373934_0112145 3300035086 Bacteria 1107
395 Ga0373923_0049902 3300035111 Bacteria 1751
396 Ga0373936_0047151 3300035113 Bacteria 1738
397 Ga0373953_0018592 3300035117 Bacteria 2574
398 Ga0373954_0248562 3300035118 Bacteria 875
399 Ga0373956_0237819 3300035119 Bacteria 865
400 Ga0373957_0054669 3300035120 Bacteria 1534
401 Ga0373955_0024888 3300035172 Bacteria 3066
402 Ga0316574_0254885 3300035398 Bacteria 1121
403 Ga0373924_0009162 3300035410 Bacteria 3622
404 Ga0373935_0438155 3300035692 Bacteria 942
405 Ga0373927_1062715 3300035695 Bacteria 534
406 Ga0373933_0100463 3300035724 Bacteria 1794
407 Ga0373937_0752752 3300036401 Bacteria 922
408 Ga0265778_007741 3300036457 Bacteria 1184
409 Ga0265778_020060 3300036457 Bacteria 821
410 Ga0310112_031331 3300036458 Bacteria 730
411 Ga0372808_003156 3300036459 Bacteria 1989
412 Ga0310109_008153 3300036534 Bacteria 1392
413 Ga0373925_0000261 3300037068 Bacteria 54902
414 Ga0373925_1023269 3300037068 Bacteria 680
415 Ga0395900_0710361 3300037418 Bacteria 938
416 Ga0436364_0710723 3300037853 Bacteria 2729
417 Ga0436365_0050923 3300039437 Bacteria 1148
418 Ga0436363_1509482 3300039450 Bacteria 1148
419 Ga0436362_0956728 3300039453 Bacteria 1004
420 Ga0451791_0964258 3300041451 Bacteria 1940
421 Ga0451793_0279617 3300041452 Bacteria 700
422 Ga0451793_0286422 3300041452 Bacteria 943
423 Ga0451797_0212605 3300041453 Bacteria 1111
424 Ga0451797_0978993 3300041453 Bacteria 868
425 Ga0451798_0736142 3300041458 Bacteria 634
426 Ga0451800_0458030 3300041459 Bacteria 1206
427 Ga0451833_0215660 3300041491 Bacteria 603
428 Ga0451841_0343559 3300041498 Bacteria 3125
429 Ga0451847_0486242 3300041503 Bacteria 744
430 Ga0451843_0306094 3300041509 Bacteria 965
431 Ga0451853_0737009 3300041512 Bacteria 991
432 Ga0439448_0051526 3300042005 Bacteria 1348
433 Ga0439448_0094081 3300042005 Bacteria 1014
434 Ga0439448_0122520 3300042005 Bacteria 893
435 Ga0439450_104918 3300042008 Bacteria 719
436 Ga0439450_129815 3300042008 Bacteria 653
437 Ga0439451_069956 3300042009 Bacteria 703
438 Ga0439463_001056 3300042016 Bacteria 7439
439 Ga0439463_002258 3300042016 Bacteria 4937
440 Ga0439444_0029835 3300042437 Bacteria 1018
441 Ga0439459_0160964 3300042438 Bacteria 592
442 Ga0439464_0234192 3300042439 Bacteria 591
443 Ga0439460_0185881 3300042461 Bacteria 704
444 Ga0439460_0247728 3300042461 Bacteria 615
445 Ga0451577_0000225 3300042876 Bacteria 116091
446 Ga0451577_0697568 3300042876 Bacteria 919
447 Ga0439440_0071154 3300042993 Bacteria 905
448 Ga0466963_0033933 3300044694 Bacteria 3318
449 Ga0453684_0559171 3300044712 Bacteria 1259
450 Ga0466968_0167101 3300044735 Bacteria 1018
451 Ga0466957_0872629 3300044842 Bacteria 642
452 Ga0466967_0131363 3300045976 Bacteria 2325
453 Ga0466967_0467277 3300045976 Bacteria 1235
454 Ga0466967_1385250 3300045976 Bacteria 700
455 Ga0495592_0608808 3300046454 Bacteria 665
456 Ga0495651_0013128 3300046462 Bacteria 6404
457 Ga0495651_0139200 3300046462 Bacteria 1762
458 Ga0495653_0058918 3300046463 Bacteria 2917
459 Ga0495662_0163472 3300046476 Bacteria 1097
460 Ga0495585_0271361 3300046492 Bacteria 841
461 Ga0495585_0404714 3300046492 Bacteria 657
462 Ga0495596_0129681 3300046500 Bacteria 979
463 Ga0495618_0003421 3300046514 Bacteria 9869
464 Ga0495620_0074156 3300046515 Bacteria 1386
465 Ga0495620_0222776 3300046515 Bacteria 722
466 Ga0495628_0633768 3300046516 Bacteria 760
467 Ga0495630_0284080 3300046517 Bacteria 1264
468 Ga0495663_0038273 3300046525 Bacteria 1449
469 Ga0495663_0112124 3300046525 Bacteria 907
470 Ga0495663_0245579 3300046525 Bacteria 634
471 Ga0495654_0246939 3300046530 Bacteria 745
472 Ga0495665_0162167 3300046531 Bacteria 1165
473 Ga0495640_0073395 3300046533 Bacteria 2291
474 Ga0495586_0029494 3300046535 Bacteria 2936
475 Ga0495587_0055605 3300046536 Bacteria 2330
476 Ga0495609_0223311 3300046538 Bacteria 782
477 Ga0495645_0040215 3300046543 Bacteria 3411
478 Ga0495633_0135049 3300046558 Bacteria 1141
479 Ga0495667_0142134 3300046559 Bacteria 1546
480 Ga0495656_0144423 3300046615 Bacteria 1144
481 Ga0495634_0016044 3300046642 Bacteria 5364
482 Ga0495635_0165924 3300046663 Bacteria 1502
483 Ga0495659_0114363 3300046664 Bacteria 1057
484 Ga0495661_0311299 3300046665 Bacteria 785
485 Ga0495657_0013892 3300046675 Bacteria 5921
486 Ga0495599_0006806 3300046678 Bacteria 6908
487 Ga0495623_0018007 3300046679 Bacteria 4561
488 Ga0495646_0222136 3300046680 Bacteria 1021
489 Ga0495613_0861060 3300046689 Bacteria 588
490 Ga0495670_0312049 3300046691 Bacteria 844
491 Ga0495649_0189138 3300046694 Bacteria 1072
492 Ga0495680_0123273 3300047322 Bacteria 1911
493 Ga0495684_0149281 3300047471 Bacteria 1748
494 Ga0495602_0734382 3300048088 Bacteria 667
495 Ga0496108_0001824 3300048911 Bacteria 17008
496 Ga0496109_0449953 3300048912 Bacteria 1216
497 Ga0496109_0672560 3300048912 Bacteria 973
498 Ga0496109_0981881 3300048912 Bacteria 782
499 Ga0496109_1670774 3300048912 Bacteria 571
500 Ga0496110_0007880 3300048913 Bacteria 8530
501 Ga0496113_0591293 3300048916 Bacteria 889
502 Ga0496113_0591335 3300048916 Bacteria 889
503 Ga0496114_0065380 3300048917 Bacteria 3047
504 Ga0496114_0173003 3300048917 Bacteria 1883
505 Ga0496114_0245559 3300048917 Bacteria 1575
506 Ga0496114_0916752 3300048917 Bacteria 758
507 Ga0496115_0122321 3300048918 Bacteria 2142
508 Ga0496115_0551072 3300048918 Bacteria 921
509 Ga0496118_0109607 3300048921 Bacteria 1837
510 Ga0496119_0234259 3300048922 Bacteria 932
511 Ga0496126_0008853 3300048929 Bacteria 10786
512 Ga0496126_0117741 3300048929 Bacteria 2307
513 Ga0496126_0180199 3300048929 Bacteria 1795
514 Ga0501291_017133 3300049514 Bacteria 1113
515 Ga0501298_035440 3300049521 Bacteria 996
516 Ga0501316_017215 3300049532 Bacteria 885
517 Ga0501317_025666 3300049533 Bacteria 827
518 Ga0501318_007817 3300049534 Bacteria 1128
519 Ga0501318_011589 3300049534 Bacteria 999
520 Ga0501323_024662 3300049539 Bacteria 815
521 Ga0501323_062289 3300049539 Bacteria 584
522 Ga0501325_006586 3300049541 Bacteria 959
523 Ga0501037_0015532 3300049573 Bacteria 5603
524 Ga0501038_0147545 3300049574 Bacteria 1919
525 Ga0501039_0073771 3300049575 Bacteria 2651
526 Ga0501039_0378141 3300049575 Bacteria 1112
527 Ga0501043_0044662 3300049579 Bacteria 3485
528 Ga0501046_0061210 3300049580 Bacteria 2944
529 Ga0501048_0018431 3300049582 Bacteria 5134
530 Ga0501077_0045552 3300049593 Bacteria 2787
531 Ga0501202_029156 3300049652 Bacteria 1143
532 Ga0501211_015453 3300049658 Bacteria 770
533 Ga0501216_017743 3300049660 Bacteria 1219
534 Ga0501233_115981 3300049668 Bacteria 720
535 Ga0501235_095134 3300049669 Bacteria 723
536 Ga0501243_020089 3300049675 Bacteria 1097
537 Ga0501248_004584 3300049678 Bacteria 1051
538 Ga0501253_012589 3300049683 Bacteria 1329
539 Ga0501261_015566 3300049690 Bacteria 1049
540 Ga0501079_0315824 3300049741 Bacteria 1223
541 Ga0501080_0738923 3300049742 Bacteria 866
542 Ga0501270_042058 3300049767 Bacteria 799
543 Ga0501035_0242957 3300049822 Bacteria 1531
544 Ga0501045_0473253 3300049824 Bacteria 931
545 Ga0501204_022131 3300049850 Bacteria 837
546 nmdc:mga05p37_459849_c1 3300050507 Bacteria 1471
547 nmdc:mga05p37_617254_c1 3300050507 Bacteria 1221
548 nmdc:mga05p37_800572_c1 3300050507 Bacteria 1031
549 nmdc:mga05p37_8107_c1 3300050507 Bacteria 12415
550 nmdc:mga05p37_8131_c1 3300050507 Bacteria 12399
551 nmdc:mga05p37_9607_c1 3300050507 Bacteria 11455
552 nmdc:mga09592_11313_c1 3300050508 Bacteria 7259
553 nmdc:mga09592_266518_c1 3300050508 Bacteria 1486
554 nmdc:mga09592_93577_c1 3300050508 Bacteria 2570
555 nmdc:mga0qj67_1396_c1 3300050509 Bacteria 16943
556 nmdc:mga0qj67_252100_c1 3300050509 Bacteria 1432
557 nmdc:mga0qj67_409074_c1 3300050509 Bacteria 1094
558 nmdc:mga06r32_236296_c1 3300050510 Bacteria 1815
559 nmdc:mga06r32_238656_c1 3300050510 Bacteria 1806
560 nmdc:mga06r32_9345_c1 3300050510 Bacteria 8842
561 nmdc:mga08y16_13084_c1 3300050511 Bacteria 8729
562 nmdc:mga08y16_14532_c1 3300050511 Bacteria 8282
563 nmdc:mga0n895_3418_c1 3300050512 Bacteria 12800
564 nmdc:mga0n895_536_c1 3300050512 Bacteria 25910
565 nmdc:mga0rr50_20919_c1 3300050513 Bacteria 4456
566 nmdc:mga0rr50_405035_c1 3300050513 Bacteria 1153
567 nmdc:mga08x19_1555_c1 3300050514 Bacteria 14244
568 nmdc:mga0a205_739_c2 3300050515 Bacteria 21316
569 Ga0495612_0052565 3300053078 Bacteria 1676
570 Ga0587066_091658 3300059490 Bacteria 676
571 Ga0587077_011112 3300059493 Bacteria 1409
572 Ga0587080_046495 3300059503 Bacteria 807
573 Ga0587082_049161 3300059504 Bacteria 799
574 Ga0587083_0023654 3300059505 Bacteria 1162
575 Ga0587083_0070317 3300059505 Bacteria 811
576 Ga0587085_030110 3300059506 Bacteria 887
577 Ga0587088_018565 3300059508 Bacteria 1134
578 Ga0587098_008471 3300059604 Bacteria 1095
579 Ga0587106_021917 3300059605 Bacteria 956
580 Ga0587101_033356 3300059623 Bacteria 815
581 Ga0587109_061881 3300059624 Bacteria 790
582 Ga0587122_020954 3300059628 Bacteria 710
583 Ga0587067_016003 3300059640 Bacteria 1225
584 Ga0587068_114046 3300059641 Bacteria 580
585 Ga0587069_023146 3300059642 Bacteria 949
586 Ga0587072_048909 3300059643 Bacteria 842
587 Ga0587075_013261 3300059644 Bacteria 1131
588 Ga0587076_025167 3300059645 Bacteria 1016
589 Ga0587079_056290 3300059647 Bacteria 840
590 Ga0587107_086579 3300059652 Bacteria 598
591 Ga0587114_038986 3300059655 Bacteria 762
592 Ga0587119_014760 3300059658 Bacteria 940
593 Ga0587071_040977 3300060344 Bacteria 927
594 Ga0587111_0040528 3300060346 Bacteria 991
595 2515850586 2515154155 Bacteria 7985436
596 8057572184 8057568493 Bacteria 7221719
597 Ga0070683_100177277
598 JGI24738J21930_10063950
599 Ga0006778J45830_1010108
600 Ga0006759J45824_1012545
601 JGI25406J46586_10020959
602 Ga0006777J48905_1010447
603 JGI25407J50210_10014235
604 JGI25407J50210_10071387
605 Ga0007417J51691_1013696
606 Ga0007427J51700_108864
607 Ga0007410J51695_1012808
608 Ga0007416J51690_1014312
609 Ga0007429J51699_1007612
610 Ga0032354_1005608
611 Ga0006780_1005377
612 Ga0058863_11966191
613 Ga0058861_10010638
614 Ga0058861_11796351
615 Ga0058862_12884799
616 Ga0070658_10312548
617 Ga0070658_10315848
618 Ga0070658_10534696
619 Ga0070683_100004763
620 Ga0070683_100088092
621 Ga0070683_100185198
622 Ga0068869_100673903
623 Ga0068869_100889418
624 Ga0070680_100029458
625 Ga0070680_100306085
626 Ga0070682_100048440
627 Ga0070682_100336469
628 Ga0068868_100426775
629 Ga0070660_100028727
630 Ga0070691_10288013
631 Ga0070661_100073475
632 Ga0070692_10085541
633 Ga0070692_10551846
634 Ga0070668_100165013
635 Ga0070674_100098824
636 Ga0070674_101374327
637 Ga0070673_100706284
638 Ga0070659_100403866
639 Ga0070659_101684284
640 Ga0070709_10141912
641 Ga0070709_10404825
642 Ga0070714_100032255
643 Ga0070714_100215325
644 Ga0070714_100247509
645 Ga0070714_100368733
646 Ga0070714_100438346
647 Ga0070714_101517397
648 Ga0070713_100057621
649 Ga0070713_100058972
650 Ga0070713_100131287
651 Ga0070713_100156775
652 Ga0070713_100332523
653 Ga0070713_100363795
654 Ga0070713_100414692
655 Ga0070713_100518906
656 Ga0070713_100915948
657 Ga0070710_10040693
658 Ga0070711_100795878
659 Ga0070708_100968547
660 Ga0070708_101791060
661 Ga0070663_100153499
662 Ga0070663_100188053
663 Ga0070663_100357007
664 Ga0070678_100198610
665 Ga0070662_100061127
666 Ga0070681_10101050
667 Ga0070681_10734581
668 Ga0070681_11626349
669 Ga0068867_100147082
670 Ga0070685_10825946
671 Ga0070707_100154441
672 Ga0070698_100011832
673 Ga0070679_100009873
674 Ga0070679_100233521
675 Ga0070679_100819265
676 Ga0070684_100105734
677 Ga0070684_100268028
678 Ga0070684_100674682
679 Ga0070684_100899142
680 Ga0068853_100102552
681 Ga0070672_101364355
682 Ga0070665_100157367
683 Ga0068857_100199342
684 Ga0068857_100293093
685 Ga0068856_100178274
686 Ga0070702_100120583
687 Ga0070702_100279074
688 Ga0068852_100109935
689 Ga0068852_100195796
690 Ga0068852_101383096
691 Ga0068852_102302406
692 Ga0068864_100148860
693 Ga0068866_10701538
694 Ga0068861_100192334
695 Ga0068861_100197468
696 Ga0068851_10068342
697 Ga0068858_102172361
698 Ga0081455_10007809
699 Ga0081455_10015310
700 Ga0081455_10122623
701 Ga0081455_10179881
702 Ga0081538_10000075
703 Ga0081538_10001393
704 Ga0081538_10031906
705 Ga0081538_10231483
706 Ga0081540_1001276
707 Ga0081539_10000314
708 Ga0081539_10045430
709 Ga0070717_10116527
710 Ga0070717_10274087
711 Ga0070717_10709435
712 Ga0075432_10000509
713 Ga0075432_10002341
714 Ga0070716_100655182
715 Ga0070712_100041001
716 Ga0070712_100077329
717 Ga0075427_10014683
718 Ga0075428_100001731
719 Ga0075428_100011952
720 Ga0075428_100025431
721 Ga0075428_100067209
722 Ga0075428_100158128
723 Ga0075428_100158804
724 Ga0075428_101284762
725 Ga0075428_102637962
726 Ga0075430_100001112
727 Ga0075430_100001488
728 Ga0075430_100173682
729 Ga0075430_100205218
730 Ga0075431_100002366
731 Ga0075431_100008780
732 Ga0075431_100131664
733 Ga0075431_100238231
734 Ga0075431_100389617
735 Ga0075433_10005569
736 Ga0075433_10008249
737 Ga0075434_100000369
738 Ga0075434_100000609
739 Ga0075429_100005091
740 Ga0075429_100018407
741 Ga0075429_100125401
742 Ga0075429_100141021
743 Ga0075429_100740431
744 Ga0068865_100068629
745 Ga0068865_100330502
746 Ga0075436_100001055
747 Ga0075435_100002301
748 Ga0075435_100052257
749 Ga0105240_10367717
750 Ga0111539_10000342
751 Ga0111539_10026716
752 Ga0105245_10097446
753 Ga0114129_10001259
754 Ga0114129_10001519
755 Ga0114129_10004718
756 Ga0114129_10429711
757 Ga0114129_10624947
758 Ga0114129_10745491
759 Ga0105243_10023890
760 Ga0105243_10033107
761 Ga0105243_11230666
762 Ga0105242_10038129
763 Ga0105237_10761004
764 Ga0105237_11226610
765 Ga0105238_10494405
766 Ga0105238_10602967
767 Ga0105249_10033420
768 Ga0105249_10043611
769 Ga0105239_10027976
770 Ga0105239_10165410
771 Ga0105239_10381888
772 Ga0105246_10376677
773 Ga0105246_11197705
774 Ga0105246_11417956
775 Ga0157321_1018196
776 Ga0157343_1005369
777 Ga0157329_1001268
778 Ga0157342_1026721
779 Ga0154012_171469
780 Ga0157371_10786096
781 Ga0157370_10020659
782 Ga0157370_10878892
783 Ga0157369_10061978
784 Ga0157369_10062091
785 Ga0157378_10350785
786 Ga0157378_11800726
787 Ga0163162_10043823
788 Ga0163162_10062585
789 Ga0163162_10999118
790 Ga0157372_10026691
791 Ga0157372_10367594
792 Ga0157372_10510709
793 Ga0157372_11856279
794 Ga0157375_11008433
795 Ga0157375_13007377
796 Ga0163163_10466793
797 Ga0157380_10870181
798 Ga0182008_10202362
799 Ga0157379_12093650
800 Ga0182005_1224981
801 Ga0163161_10233437
802 Ga0163161_10309099
803 Ga0197907_10013784
804 Ga0197907_10180632
805 Ga0197907_10520392
806 Ga0197907_11310757
807 Ga0206356_11435788
808 Ga0206356_11906684
809 Ga0206349_1390947
810 Ga0206351_10076347
811 Ga0206352_10547388
812 Ga0206352_11156770
813 Ga0206350_10109418
814 Ga0206350_10380936
815 Ga0206354_10110348
816 Ga0206354_10514547
817 Ga0206354_11612694
818 Ga0206353_10012202
819 Ga0206353_10476058
820 Ga0224712_10002260
821 Ga0224712_10012985
822 Ga0224712_10345595
823 Ga0207692_10020794
824 Ga0207642_10047999
825 Ga0207642_10730162
826 Ga0207688_10083973
827 Ga0207688_10127800
828 Ga0207699_10118087
829 Ga0207699_10193027
830 Ga0207699_10218489
831 Ga0207705_10016772
832 Ga0207705_10039451
833 Ga0207707_10053038
834 Ga0207707_10124619
835 Ga0207693_10036436
836 Ga0207693_10055089
837 Ga0207693_10081176
838 Ga0207693_10115084
839 Ga0207663_11573279
840 Ga0207660_10025970
841 Ga0207657_10019291
842 Ga0207649_10048751
843 Ga0207652_10013383
844 Ga0207652_10777291
845 Ga0207652_10844750
846 Ga0207646_10129309
847 Ga0207694_10598164
848 Ga0207687_10073048
849 Ga0207687_10144154
850 Ga0207700_10014921
851 Ga0207700_10024802
852 Ga0207700_10082550
853 Ga0207700_10116776
854 Ga0207700_10416580
855 Ga0207700_11081027
856 Ga0207664_10023584
857 Ga0207664_10189622
858 Ga0207664_10204831
859 Ga0207664_10316474
860 Ga0207664_10399180
861 Ga0207664_10480419
862 Ga0207664_10640087
863 Ga0207690_10074217
864 Ga0207690_10158287
865 Ga0207706_10005535
866 Ga0207686_10019197
867 Ga0207709_10003708
868 Ga0207709_10082201
869 Ga0207709_10395905
870 Ga0207669_10026107
871 Ga0207669_10407472
872 Ga0207669_10678943
873 Ga0207704_10217348
874 Ga0207704_10778308
875 Ga0207665_10018442
876 Ga0207689_10459009
877 Ga0207689_10461418
878 Ga0207661_10002859
879 Ga0207661_10010667
880 Ga0207661_10146352
881 Ga0207661_10893243
882 Ga0207651_10583179
883 Ga0207668_10082950
884 Ga0207640_10303951
885 Ga0207677_10223962
886 Ga0207703_11182498
887 Ga0207639_11154035
888 Ga0207678_10045337
889 Ga0207678_10494677
890 Ga0207678_10503392
891 Ga0207702_10613233
892 Ga0207648_10143329
893 Ga0207676_10571037
894 Ga0207676_10715789
895 Ga0207676_11075278
896 Ga0207674_10110837
897 Ga0207675_100042413
898 Ga0207675_100069215
899 Ga0207683_10272862
900 Ga0207683_10280863
901 Ga0207683_10704314
902 Ga0207698_10335490
903 Ga0207698_10372609
904 Ga0207698_10687518
905 Ga0207428_10002250
906 Ga0207428_10004258
907 Ga0268265_10196831
908 Ga0268264_10254107
909 Ga0268264_10601575
910 Ga0265337_1000225
911 Ga0265326_10016180
912 Ga0265319_1000356
913 Ga0265334_10043842
914 Ga0265318_10040036
915 Ga0265323_10018756
916 Ga0265322_10013016
917 Ga0265336_10007394
918 Ga0265338_10000449
919 Ga0265338_10017447
920 Ga0265338_10025611
921 Ga0265324_10002014
922 Ga0265775_101092
923 Ga0265763_1017016
924 Ga0265767_103254
925 Ga0265766_1001331
926 Ga0265766_1001564
927 Ga0265777_103832
928 Ga0265764_101889
929 Ga0265769_102964
930 Ga0265768_108289
931 Ga0265771_1010108
932 Ga0265325_10003579
933 Ga0265340_10000535
934 Ga0265339_10095015
935 Ga0265316_10024385
936 Ga0307408_100156247
937 Ga0310117_100468
938 Ga0310103_105733
939 Ga0310107_117501
940 Ga0307508_10048629
941 Ga0310108_119904
942 Ga0310115_102571
943 Ga0310111_113387
944 Ga0310119_111784
945 Ga0310101_107890
946 Ga0265342_10003409
947 Ga0307405_10001101
948 Ga0307405_10046974
949 Ga0307405_10174559
950 Ga0307405_11906831
951 Ga0316045_116426
952 Ga0307413_10008221
953 Ga0307413_10042242
954 Ga0307413_10055810
955 Ga0307413_10680469
956 Ga0307410_10000838
957 Ga0307410_10261846
958 Ga0307410_10488148
959 Ga0307406_10000241
960 Ga0307406_10001305
961 Ga0307406_10155910
962 Ga0307406_10209307
963 Ga0307406_10960536
964 Ga0307407_10008733
965 Ga0307407_10013389
966 Ga0307412_10033921
967 Ga0307412_10668892
968 Ga0307409_100000319
969 Ga0307409_100153043
970 Ga0307409_100858082
971 Ga0307409_101245284
972 Ga0307409_101295232
973 Ga0307416_100000079
974 Ga0307416_100072700
975 Ga0307416_100763662
976 Ga0307414_10002108
977 Ga0307414_10415876
978 Ga0307414_10450591
979 Ga0307414_10556628
980 Ga0307411_10009439
981 Ga0307411_10193537
982 Ga0307411_10292350
983 Ga0307415_100000527
984 Ga0307415_100069076
985 Ga0307415_100087434
986 Ga0307415_100087438
987 Ga0307415_100442083
988 Ga0316216_1003344
989 Ga0373934_0086631
990 Ga0373934_0112145
991 Ga0373923_0049902
992 Ga0373936_0047151
993 Ga0373953_0018592
994 Ga0373954_0248562
995 Ga0373956_0237819
996 Ga0373957_0054669
997 Ga0373955_0024888
998 Ga0316574_0254885
999 Ga0373924_0009162
1000 Ga0373935_0438155
1001 Ga0373927_1062715
1002 Ga0373933_0100463
1003 Ga0373937_0752752
1004 Ga0265778_007741
1005 Ga0265778_020060
1006 Ga0310112_031331
1007 Ga0372808_003156
1008 Ga0310109_008153
1009 Ga0373925_0000261
1010 Ga0373925_1023269
1011 Ga0395900_0710361
1012 Ga0436364_0710723
1013 Ga0436365_0050923
1014 Ga0436363_1509482
1015 Ga0436362_0956728
1016 Ga0451791_0964258
1017 Ga0451793_0279617
1018 Ga0451793_0286422
1019 Ga0451797_0212605
1020 Ga0451797_0978993
1021 Ga0451798_0736142
1022 Ga0451800_0458030
1023 Ga0451833_0215660
1024 Ga0451841_0343559
1025 Ga0451847_0486242
1026 Ga0451843_0306094
1027 Ga0451853_0737009
1028 Ga0439448_0051526
1029 Ga0439448_0094081
1030 Ga0439448_0122520
1031 Ga0439450_104918
1032 Ga0439450_129815
1033 Ga0439451_069956
1034 Ga0439463_001056
1035 Ga0439463_002258
1036 Ga0439444_0029835
1037 Ga0439459_0160964
1038 Ga0439464_0234192
1039 Ga0439460_0185881
1040 Ga0439460_0247728
1041 Ga0451577_0000225
1042 Ga0451577_0697568
1043 Ga0439440_0071154
1044 Ga0466963_0033933
1045 Ga0453684_0559171
1046 Ga0466968_0167101
1047 Ga0466957_0872629
1048 Ga0466967_0131363
1049 Ga0466967_0467277
1050 Ga0466967_1385250
1051 Ga0495592_0608808
1052 Ga0495651_0013128
1053 Ga0495651_0139200
1054 Ga0495653_0058918
1055 Ga0495662_0163472
1056 Ga0495585_0271361
1057 Ga0495585_0404714
1058 Ga0495596_0129681
1059 Ga0495618_0003421
1060 Ga0495620_0074156
1061 Ga0495620_0222776
1062 Ga0495628_0633768
1063 Ga0495630_0284080
1064 Ga0495663_0038273
1065 Ga0495663_0112124
1066 Ga0495663_0245579
1067 Ga0495654_0246939
1068 Ga0495665_0162167
1069 Ga0495640_0073395
1070 Ga0495586_0029494
1071 Ga0495587_0055605
1072 Ga0495609_0223311
1073 Ga0495645_0040215
1074 Ga0495633_0135049
1075 Ga0495667_0142134
1076 Ga0495656_0144423
1077 Ga0495634_0016044
1078 Ga0495635_0165924
1079 Ga0495659_0114363
1080 Ga0495661_0311299
1081 Ga0495657_0013892
1082 Ga0495599_0006806
1083 Ga0495623_0018007
1084 Ga0495646_0222136
1085 Ga0495613_0861060
1086 Ga0495670_0312049
1087 Ga0495649_0189138
1088 Ga0495680_0123273
1089 Ga0495684_0149281
1090 Ga0495602_0734382
1091 Ga0496108_0001824
1092 Ga0496109_0449953
1093 Ga0496109_0672560
1094 Ga0496109_0981881
1095 Ga0496109_1670774
1096 Ga0496110_0007880
1097 Ga0496113_0591293
1098 Ga0496113_0591335
1099 Ga0496114_0065380
1100 Ga0496114_0173003
1101 Ga0496114_0245559
1102 Ga0496114_0916752
1103 Ga0496115_0122321
1104 Ga0496115_0551072
1105 Ga0496118_0109607
1106 Ga0496119_0234259
1107 Ga0496126_0008853
1108 Ga0496126_0117741
1109 Ga0496126_0180199
1110 Ga0501291_017133
1111 Ga0501298_035440
1112 Ga0501316_017215
1113 Ga0501317_025666
1114 Ga0501318_007817
1115 Ga0501318_011589
1116 Ga0501323_024662
1117 Ga0501323_062289
1118 Ga0501325_006586
1119 Ga0501037_0015532
1120 Ga0501038_0147545
1121 Ga0501039_0073771
1122 Ga0501039_0378141
1123 Ga0501043_0044662
1124 Ga0501046_0061210
1125 Ga0501048_0018431
1126 Ga0501077_0045552
1127 Ga0501202_029156
1128 Ga0501211_015453
1129 Ga0501216_017743
1130 Ga0501233_115981
1131 Ga0501235_095134
1132 Ga0501243_020089
1133 Ga0501248_004584
1134 Ga0501253_012589
1135 Ga0501261_015566
1136 Ga0501079_0315824
1137 Ga0501080_0738923
1138 Ga0501270_042058
1139 Ga0501035_0242957
1140 Ga0501045_0473253
1141 Ga0501204_022131
1142 nmdc:mga05p37_459849_c1
1143 nmdc:mga05p37_617254_c1
1144 nmdc:mga05p37_800572_c1
1145 nmdc:mga05p37_8107_c1
1146 nmdc:mga05p37_8131_c1
1147 nmdc:mga05p37_9607_c1
1148 nmdc:mga09592_11313_c1
1149 nmdc:mga09592_266518_c1
1150 nmdc:mga09592_93577_c1
1151 nmdc:mga0qj67_1396_c1
1152 nmdc:mga0qj67_252100_c1
1153 nmdc:mga0qj67_409074_c1
1154 nmdc:mga06r32_236296_c1
1155 nmdc:mga06r32_238656_c1
1156 nmdc:mga06r32_9345_c1
1157 nmdc:mga08y16_13084_c1
1158 nmdc:mga08y16_14532_c1
1159 nmdc:mga0n895_3418_c1
1160 nmdc:mga0n895_536_c1
1161 nmdc:mga0rr50_20919_c1
1162 nmdc:mga0rr50_405035_c1
1163 nmdc:mga08x19_1555_c1
1164 nmdc:mga0a205_739_c2
1165 Ga0495612_0052565
1166 Ga0587066_091658
1167 Ga0587077_011112
1168 Ga0587080_046495
1169 Ga0587082_049161
1170 Ga0587083_0023654
1171 Ga0587083_0070317
1172 Ga0587085_030110
1173 Ga0587088_018565
1174 Ga0587098_008471
1175 Ga0587106_021917
1176 Ga0587101_033356
1177 Ga0587109_061881
1178 Ga0587122_020954
1179 Ga0587067_016003
1180 Ga0587068_114046
1181 Ga0587069_023146
1182 Ga0587072_048909
1183 Ga0587075_013261
1184 Ga0587076_025167
1185 Ga0587079_056290
1186 Ga0587107_086579
1187 Ga0587114_038986
1188 Ga0587119_014760
1189 Ga0587071_040977
1190 Ga0587111_0040528
1191 2515850586
1192 8057572184

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

6

132

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9675 4 139
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9495 1 139
6jzw-assembly3.cif.gz_C crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9488 3 141
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9453 4 139
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.945 3 140
ID Description Score Start End Superfamily
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9877 2 145 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.964 1 139 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9612 2 145 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9503 1 139 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9421 7 138 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A7V9RMP0-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9964 1 142 GO:0005506
GO:0016226
GO:0051536
AF-A0A255E9N7-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9949 1 142 GO:0005506
GO:0016226
GO:0051536
AF-W2F4K3-F1-model_v4 Nitrogen fixation protein NifU 0.9948 7 143 GO:0005506
GO:0016226
GO:0051536
AF-A0A7I9ZQR0-F1-model_v4 Iron-sulfur cluster assembly scaffold protein NifU 0.9947 1 144 GO:0005506
GO:0016226
GO:0051536
AF-A0A222VSE3-F1-model_v4 Nitrogen fixation protein NifU 0.9942 1 146 GO:0005506
GO:0016226
GO:0051536

Map