F467496

General Info

Members Datasets Scaffolds Average Seq Length
595 302 558 264

Family's Representative Sequence

Representative Sequence 3300053724|Ga0500570_000135|Ga0500570_000135_11191_12135
Length 314
Sequence MPEYLSNRLPAPGSLCHEHHPMNDLIETDVPDDLXXXAPLPPGLYIVATPIGNLGDLSPRAASILSRVETIAVEDSRVTAKLLHRIGVKRAMTPYHDHNADKVRPGLIERMGRSAVALVSDAGTPRISDPGYKLVRDARAAGHAVTTIPGPCAAIAALTLAGLPTDRFFFLGFLPSKEKARADTIAEVAAIRATLIFYESGPRLGAMLAALHDGLGDRDAAVVREITKTYEEAVTGTLSALAERYAEQGPKGEIVVVVGPPGEAPVASAADADALLIEALKRLPAARAASEVAKATGLPRRDLYVRATALKGEG

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
11 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
12 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
13 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
14 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
15 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
16 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
17 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
18 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
19 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
20 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
21 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
22 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
23 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
24 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
25 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
26 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
27 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
28 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
29 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
30 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
31 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
32 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
33 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
34 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
35 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
36 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
37 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
38 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
43 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
44 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
45 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
267 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
268 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
269 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
270 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
271 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
272 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
273 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
274 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
275 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
291 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
292 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
295 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
296 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
297 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
300 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
301 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
302 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.45
Metatranscriptomes 0.34
Isolates 6.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.84
Bulb 0
Endosphere 8.91
Nodule 0
Rhizoplane 3.36
Rhizosphere 75.63
Stem 0
Stem Tuber 0.17
Unclassified 11.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000173 3300001904 Bacteria 11479
2 JGI24741J21665_1000026 3300001915 Bacteria 35267
3 JGI24741J21665_1000724 3300001915 Bacteria 9929
4 JGI24740J21852_10001292 3300001979 Bacteria 11377
5 JGI24739J22299_10001495 3300001989 Bacteria 8828
6 JGI24739J22299_10003988 3300001989 Bacteria 5651
7 JGI24737J22298_10002224 3300001990 Bacteria 6918
8 JGI24737J22298_10006518 3300001990 Bacteria 3984
9 JGI24737J22298_10052684 3300001990 Bacteria 1233
10 JGI24735J21928_10001457 3300002067 Bacteria 8363
11 JGI24735J21928_10001790 3300002067 Bacteria 7539
12 JGI24735J21928_10006905 3300002067 Bacteria 3718
13 JGI24735J21928_10016675 3300002067 Bacteria 2275
14 JGI24738J21930_10001463 3300002075 Bacteria 6561
15 JGI24738J21930_10007207 3300002075 Bacteria 2576
16 JGI24749J21850_1000934 3300002076 Bacteria 4165
17 JGI24751J29686_10000055 3300002459 Bacteria 64731
18 JGI25153J46596_10000070 3300003215 Bacteria 117125
19 rootH2_10095765 3300003320 Bacteria 4118
20 rootL2_10377998 3300003322 Bacteria 1657
21 Ga0055542_1000040 3300003762 Bacteria 214035
22 Ga0055529_1000037 3300003763 Bacteria 237307
23 Ga0055530_10000131 3300003791 Bacteria 65535
24 Ga0055531_10000514 3300003794 Bacteria 34947
25 JGI25405J52794_10007325 3300003911 Bacteria 2034
26 Ga0065165_1047593 3300005262 Bacteria 1237
27 Ga0065707_10086768 3300005295 Bacteria 5313
28 Ga0070658_10000281 3300005327 Bacteria 44679
29 Ga0070658_10002876 3300005327 Bacteria 14299
30 Ga0070658_10005279 3300005327 Bacteria 10493
31 Ga0070658_10021879 3300005327 Bacteria 5127
32 Ga0070658_10033836 3300005327 Bacteria 4112
33 Ga0070676_10024614 3300005328 Bacteria 3393
34 Ga0070670_100000082 3300005331 Bacteria 91524
35 Ga0070670_100006073 3300005331 Bacteria 10216
36 Ga0070670_100192447 3300005331 Bacteria 1772
37 Ga0070680_100159289 3300005336 Bacteria 1896
38 Ga0070682_100182143 3300005337 Bacteria 1468
39 Ga0068868_100018436 3300005338 Bacteria 5219
40 Ga0068868_100227642 3300005338 Bacteria 1563
41 Ga0070660_100110087 3300005339 Bacteria 2190
42 Ga0070660_100129524 3300005339 Bacteria 2018
43 Ga0070661_100001799 3300005344 Bacteria 14873
44 Ga0070661_100049038 3300005344 Bacteria 3092
45 Ga0070661_100051672 3300005344 Bacteria 3008
46 Ga0070661_100185058 3300005344 Bacteria 1586
47 Ga0070661_100216754 3300005344 Bacteria 1467
48 Ga0070668_100000239 3300005347 Bacteria 36109
49 Ga0070668_100017003 3300005347 Bacteria 5441
50 Ga0070668_100025389 3300005347 Bacteria 4492
51 Ga0070669_100000015 3300005353 Bacteria 197597
52 Ga0070669_100362367 3300005353 Bacteria 1179
53 Ga0070671_100001987 3300005355 Bacteria 15701
54 Ga0070671_100121806 3300005355 Bacteria 2195
55 Ga0070674_100415816 3300005356 Bacteria 1102
56 Ga0070673_100043642 3300005364 Bacteria 3466
57 Ga0070659_100015172 3300005366 Bacteria 5764
58 Ga0070659_100149661 3300005366 Bacteria 1903
59 Ga0070667_100000003 3300005367 Bacteria 447715
60 Ga0070667_100000302 3300005367 Bacteria 55150
61 Ga0070667_100013773 3300005367 Bacteria 6685
62 Ga0070667_100087970 3300005367 Bacteria 2667
63 Ga0070663_100004887 3300005455 Bacteria 7911
64 Ga0070663_100006789 3300005455 Bacteria 6915
65 Ga0070663_100045051 3300005455 Bacteria 3114
66 Ga0070663_100100815 3300005455 Bacteria 2154
67 Ga0070663_100279726 3300005455 Bacteria 1329
68 Ga0070678_100000147 3300005456 Bacteria 29187
69 Ga0070678_100567895 3300005456 Bacteria 1009
70 Ga0070662_100010572 3300005457 Bacteria 6065
71 Ga0070662_100023112 3300005457 Bacteria 4267
72 Ga0070662_100446875 3300005457 Bacteria 1072
73 Ga0070681_10060953 3300005458 Bacteria 3749
74 Ga0070681_10178316 3300005458 Bacteria 2046
75 Ga0068853_100018116 3300005539 Bacteria 5823
76 Ga0070665_100000023 3300005548 Bacteria 375278
77 Ga0070665_100037912 3300005548 Bacteria 4845
78 Ga0068855_100056357 3300005563 Bacteria 4612
79 Ga0068855_100084253 3300005563 Bacteria 3681
80 Ga0068855_100147492 3300005563 Bacteria 2677
81 Ga0070664_100010146 3300005564 Bacteria 7637
82 Ga0070664_100027450 3300005564 Bacteria 4731
83 Ga0070664_100267051 3300005564 Bacteria 1540
84 Ga0068857_100066462 3300005577 Bacteria 3208
85 Ga0068857_100084926 3300005577 Bacteria 2829
86 Ga0068854_100010580 3300005578 Bacteria 5986
87 Ga0068854_100044961 3300005578 Bacteria 3137
88 Ga0068856_100023313 3300005614 Bacteria 6018
89 Ga0068856_100046685 3300005614 Bacteria 4265
90 Ga0068856_100062368 3300005614 Bacteria 3682
91 Ga0068859_100039142 3300005617 Bacteria 4756
92 Ga0068859_100057802 3300005617 Bacteria 3907
93 Ga0068859_100722376 3300005617 Bacteria 1086
94 Ga0068864_100000114 3300005618 Bacteria 79636
95 Ga0068864_100000177 3300005618 Bacteria 58504
96 Ga0068864_100017243 3300005618 Bacteria 6022
97 Ga0068864_100289156 3300005618 Bacteria 1532
98 Ga0068861_100001270 3300005719 Bacteria 15759
99 Ga0068861_100273468 3300005719 Bacteria 1451
100 Ga0068851_10001318 3300005834 Bacteria 10811
101 Ga0068851_10039195 3300005834 Bacteria 2379
102 Ga0068851_10064305 3300005834 Bacteria 1885
103 Ga0068863_100002334 3300005841 Bacteria 18851
104 Ga0068858_100000897 3300005842 Bacteria 30873
105 Ga0068858_100006035 3300005842 Bacteria 11808
106 Ga0068858_100584775 3300005842 Bacteria 1082
107 Ga0068860_100000068 3300005843 Bacteria 179208
108 Ga0068860_100000416 3300005843 Bacteria 55156
109 Ga0068862_100000006 3300005844 Bacteria 346828
110 Ga0068862_100000085 3300005844 Bacteria 110879
111 Ga0068862_100001068 3300005844 Bacteria 26256
112 Ga0068862_100007732 3300005844 Bacteria 8890
113 Ga0068862_100031816 3300005844 Bacteria 4456
114 Ga0081455_10000215 3300005937 Bacteria 73808
115 Ga0075369_10060962 3300006186 Bacteria 1646
116 Ga0075366_10068079 3300006195 Bacteria 2119
117 Ga0068871_100281337 3300006358 Bacteria 1455
118 Ga0075430_100121363 3300006846 Bacteria 2179
119 Ga0075429_100075740 3300006880 Bacteria 2931
120 Ga0097620_100039143 3300006931 Bacteria 4756
121 Ga0097620_100057801 3300006931 Bacteria 3907
122 Ga0097620_100722312 3300006931 Bacteria 1086
123 Ga0105240_10004567 3300009093 Bacteria 20996
124 Ga0105243_10000990 3300009148 Bacteria 26409
125 Ga0105241_10001330 3300009174 Bacteria 18768
126 Ga0105241_10016301 3300009174 Bacteria 5446
127 Ga0105248_10000066 3300009177 Bacteria 121254
128 Ga0105248_10073612 3300009177 Bacteria 3839
129 Ga0105248_10210064 3300009177 Bacteria 2193
130 Ga0105237_10005899 3300009545 Bacteria 13731
131 Ga0105237_10017495 3300009545 Bacteria 7429
132 Ga0105237_10097523 3300009545 Bacteria 2930
133 Ga0105238_10012734 3300009551 Bacteria 8490
134 Ga0105238_10188370 3300009551 Bacteria 2040
135 Ga0105249_10000038 3300009553 Bacteria 196425
136 Ga0105249_10125010 3300009553 Bacteria 2448
137 Ga0105239_10000461 3300010375 Bacteria 59449
138 Ga0105239_10138533 3300010375 Bacteria 2710
139 Ga0157326_1000962 3300012513 Bacteria 3268
140 Ga0157373_10151575 3300013100 Bacteria 1631
141 Ga0157373_10175635 3300013100 Bacteria 1507
142 Ga0157373_10195237 3300013100 Bacteria 1427
143 Ga0157371_10000747 3300013102 Bacteria 37686
144 Ga0157371_10018089 3300013102 Bacteria 5218
145 Ga0157371_10039485 3300013102 Bacteria 3375
146 Ga0157370_10018262 3300013104 Bacteria 7054
147 Ga0157370_10255949 3300013104 Bacteria 1619
148 Ga0157369_10129064 3300013105 Bacteria 2680
149 Ga0157369_10418832 3300013105 Bacteria 1388
150 Ga0157369_10480859 3300013105 Bacteria 1285
151 Ga0157374_10033403 3300013296 Bacteria 4694
152 Ga0157374_10181585 3300013296 Bacteria 2055
153 Ga0157374_10819410 3300013296 Bacteria 947
154 Ga0157378_10028808 3300013297 Bacteria 4902
155 Ga0157378_10318207 3300013297 Bacteria 1511
156 Ga0163162_10151422 3300013306 Bacteria 2437
157 Ga0157372_10213884 3300013307 Bacteria 2234
158 Ga0157380_10000114 3300014326 Bacteria 44326
159 Ga0213873_10000007 3300021358 Bacteria 309961
160 Ga0213876_10000005 3300021384 Bacteria 727326
161 Ga0207425_1035154 3300025245 Bacteria 979
162 Ga0209148_1000011 3300025254 Bacteria 1196503
163 Ga0209148_1004174 3300025254 Bacteria 3631
164 Ga0209233_1011300 3300025261 Bacteria 2635
165 Ga0209455_1000006 3300025272 Bacteria 1196503
166 Ga0209455_1006523 3300025272 Bacteria 3430
167 Ga0209758_1000023 3300025297 Bacteria 612453
168 Ga0209758_1023592 3300025297 Bacteria 2776
169 Ga0209050_1000347 3300025298 Bacteria 90767
170 Ga0209257_1000371 3300025304 Bacteria 90767
171 Ga0209257_1005932 3300025304 Bacteria 8214
172 Ga0207656_10007853 3300025321 Bacteria 3906
173 Ga0207656_10014475 3300025321 Bacteria 3039
174 Ga0207656_10017108 3300025321 Bacteria 2835
175 Ga0207647_10001988 3300025904 Bacteria 15633
176 Ga0207647_10091795 3300025904 Bacteria 1811
177 Ga0207647_10092176 3300025904 Bacteria 1806
178 Ga0207645_10031970 3300025907 Bacteria 3384
179 Ga0207705_10000022 3300025909 Bacteria 302232
180 Ga0207705_10000319 3300025909 Bacteria 43949
181 Ga0207705_10061000 3300025909 Bacteria 2724
182 Ga0207705_10208736 3300025909 Bacteria 1481
183 Ga0207654_10001234 3300025911 Bacteria 13658
184 Ga0207695_10001501 3300025913 Bacteria 38827
185 Ga0207695_10046884 3300025913 Bacteria 4578
186 Ga0207695_10048566 3300025913 Bacteria 4481
187 Ga0207671_10009474 3300025914 Bacteria 8135
188 Ga0207671_10015329 3300025914 Bacteria 6007
189 Ga0207671_10029820 3300025914 Bacteria 4072
190 Ga0207657_10002244 3300025919 Bacteria 20950
191 Ga0207657_10005304 3300025919 Bacteria 13508
192 Ga0207657_10009148 3300025919 Bacteria 9996
193 Ga0207657_10012074 3300025919 Bacteria 8542
194 Ga0207657_10074431 3300025919 Bacteria 2868
195 Ga0207649_10001413 3300025920 Bacteria 14200
196 Ga0207649_10017406 3300025920 Bacteria 4072
197 Ga0207649_10058862 3300025920 Bacteria 2408
198 Ga0207649_10074293 3300025920 Bacteria 2181
199 Ga0207649_10093736 3300025920 Bacteria 1971
200 Ga0207652_10369282 3300025921 Bacteria 1295
201 Ga0207681_10000001 3300025923 Bacteria 1105841
202 Ga0207681_10230780 3300025923 Bacteria 1436
203 Ga0207681_10448003 3300025923 Bacteria 1050
204 Ga0207694_10013185 3300025924 Bacteria 6222
205 Ga0207694_10037902 3300025924 Bacteria 3705
206 Ga0207650_10000050 3300025925 Bacteria 169589
207 Ga0207650_10198717 3300025925 Bacteria 1605
208 Ga0207644_10000836 3300025931 Bacteria 19551
209 Ga0207644_10027862 3300025931 Bacteria 3905
210 Ga0207690_10000511 3300025932 Bacteria 25174
211 Ga0207690_10013320 3300025932 Bacteria 4939
212 Ga0207690_10029358 3300025932 Bacteria 3495
213 Ga0207690_10101618 3300025932 Bacteria 2054
214 Ga0207690_10112872 3300025932 Bacteria 1960
215 Ga0207706_10010249 3300025933 Bacteria 8570
216 Ga0207706_10010971 3300025933 Bacteria 8262
217 Ga0207706_10024099 3300025933 Bacteria 5458
218 Ga0207706_10036429 3300025933 Bacteria 4370
219 Ga0207706_10115900 3300025933 Bacteria 2356
220 Ga0207709_10000039 3300025935 Bacteria 260127
221 Ga0207669_10000076 3300025937 Bacteria 50334
222 Ga0207669_10318539 3300025937 Bacteria 1189
223 Ga0207711_10000317 3300025941 Bacteria 51561
224 Ga0207711_10024879 3300025941 Bacteria 5023
225 Ga0207679_10139324 3300025945 Bacteria 1959
226 Ga0207679_10333986 3300025945 Bacteria 1316
227 Ga0207667_10000006 3300025949 Bacteria 679876
228 Ga0207667_10047515 3300025949 Bacteria 4542
229 Ga0207667_10136055 3300025949 Bacteria 2530
230 Ga0207667_10179290 3300025949 Bacteria 2176
231 Ga0207712_10000002 3300025961 Bacteria 706628
232 Ga0207712_10103597 3300025961 Bacteria 2120
233 Ga0207668_10000045 3300025972 Bacteria 103160
234 Ga0207668_10004682 3300025972 Bacteria 8051
235 Ga0207668_10190457 3300025972 Bacteria 1625
236 Ga0207640_10006816 3300025981 Bacteria 6282
237 Ga0207640_10019101 3300025981 Bacteria 4042
238 Ga0207640_10019501 3300025981 Bacteria 4008
239 Ga0207640_10114024 3300025981 Bacteria 1922
240 Ga0207658_10000002 3300025986 Bacteria 1364188
241 Ga0207658_10000263 3300025986 Bacteria 55175
242 Ga0207658_10008852 3300025986 Bacteria 6831
243 Ga0207658_10046286 3300025986 Bacteria 3176
244 Ga0207658_10212603 3300025986 Bacteria 1622
245 Ga0207677_10077077 3300026023 Bacteria 2376
246 Ga0207703_10000483 3300026035 Bacteria 41615
247 Ga0207703_10003498 3300026035 Bacteria 13135
248 Ga0207639_10000252 3300026041 Bacteria 39391
249 Ga0207639_10001496 3300026041 Bacteria 15730
250 Ga0207639_10006688 3300026041 Bacteria 7841
251 Ga0207639_10067025 3300026041 Bacteria 2792
252 Ga0207639_10216638 3300026041 Bacteria 1651
253 Ga0207678_10000857 3300026067 Bacteria 27922
254 Ga0207678_10004587 3300026067 Bacteria 12421
255 Ga0207678_10008946 3300026067 Bacteria 8818
256 Ga0207678_10015794 3300026067 Bacteria 6637
257 Ga0207678_10027339 3300026067 Bacteria 4975
258 Ga0207702_10002982 3300026078 Bacteria 15760
259 Ga0207702_10005818 3300026078 Bacteria 10724
260 Ga0207702_10033026 3300026078 Bacteria 4320
261 Ga0207702_10034073 3300026078 Bacteria 4255
262 Ga0207702_10777493 3300026078 Bacteria 946
263 Ga0207641_10000944 3300026088 Bacteria 29967
264 Ga0207641_10001679 3300026088 Bacteria 21542
265 Ga0207641_10004405 3300026088 Bacteria 12201
266 Ga0207641_10004428 3300026088 Bacteria 12170
267 Ga0207676_10000004 3300026095 Bacteria 725417
268 Ga0207676_10000723 3300026095 Bacteria 25873
269 Ga0207676_10000895 3300026095 Bacteria 23119
270 Ga0207676_10142017 3300026095 Bacteria 2057
271 Ga0207674_10011507 3300026116 Bacteria 9939
272 Ga0207674_10014177 3300026116 Bacteria 8811
273 Ga0207674_10020781 3300026116 Bacteria 7085
274 Ga0207674_10025014 3300026116 Bacteria 6373
275 Ga0207674_10037637 3300026116 Bacteria 5029
276 Ga0207674_10512697 3300026116 Bacteria 1158
277 Ga0207675_100001609 3300026118 Bacteria 22629
278 Ga0207675_100294562 3300026118 Bacteria 1579
279 Ga0207683_10000715 3300026121 Bacteria 30136
280 Ga0207698_10018012 3300026142 Bacteria 4803
281 Ga0207698_10160685 3300026142 Bacteria 1964
282 Ga0207698_10255564 3300026142 Bacteria 1606
283 Ga0207698_10420011 3300026142 Bacteria 1283
284 Ga0268266_10000002 3300028379 Bacteria 3059047
285 Ga0268266_10038407 3300028379 Bacteria 4076
286 Ga0268265_10000002 3300028380 Bacteria 1035381
287 Ga0268265_10000104 3300028380 Bacteria 105776
288 Ga0268265_10000946 3300028380 Bacteria 26688
289 Ga0268265_10005705 3300028380 Bacteria 8501
290 Ga0268265_10024259 3300028380 Bacteria 4289
291 Ga0268264_10000103 3300028381 Bacteria 222439
292 Ga0268264_10000184 3300028381 Bacteria 131402
293 Ga0268264_10001970 3300028381 Bacteria 18446
294 Ga0307517_10035942 3300028786 Bacteria 5590
295 Ga0265770_1001694 3300030878 Bacteria 3020
296 Ga0265760_10001598 3300031090 Bacteria 6665
297 Ga0307513_10066112 3300031456 Bacteria 3801
298 Ga0307513_10076622 3300031456 Bacteria 3467
299 Ga0307513_10161811 3300031456 Bacteria 2130
300 Ga0307508_10003330 3300031616 Bacteria 16325
301 Ga0307405_10005258 3300031731 Bacteria 6222
302 Ga0307405_10031119 3300031731 Bacteria 3137
303 Ga0307405_10032751 3300031731 Bacteria 3075
304 Ga0307405_10044668 3300031731 Bacteria 2711
305 Ga0307405_10189704 3300031731 Bacteria 1483
306 Ga0307413_10010036 3300031824 Bacteria 4566
307 Ga0307413_10262998 3300031824 Bacteria 1287
308 Ga0307412_10000220 3300031911 Bacteria 38370
309 Ga0307412_10001641 3300031911 Bacteria 12348
310 Ga0307412_10012894 3300031911 Bacteria 4884
311 Ga0307412_10031478 3300031911 Bacteria 3351
312 Ga0307412_10124580 3300031911 Bacteria 1861
313 Ga0307409_100238632 3300031995 Bacteria 1653
314 Ga0307416_100013238 3300032002 Bacteria 5599
315 Ga0307416_100062443 3300032002 Bacteria 3046
316 Ga0307416_100144544 3300032002 Bacteria 2169
317 Ga0307414_10000420 3300032004 Bacteria 22862
318 Ga0307415_100409527 3300032126 Bacteria 1160
319 Ga0307510_10007125 3300033180 Bacteria 13314
320 Ga0307510_10134865 3300033180 Bacteria 2130
321 Ga0373947_0053772 3300035725 Bacteria 2429
322 Ga0395899_0029626 3300037312 Bacteria 4117
323 Ga0395899_0392378 3300037312 Bacteria 920
324 Ga0395900_0007250 3300037418 Bacteria 11480
325 Ga0395900_0012204 3300037418 Bacteria 8782
326 Ga0395900_0062831 3300037418 Bacteria 3817
327 Ga0395900_0096292 3300037418 Bacteria 3041
328 Ga0395900_0105344 3300037418 Bacteria 2897
329 Ga0395900_0109005 3300037418 Bacteria 2845
330 Ga0395900_0220584 3300037418 Bacteria 1911
331 Ga0395900_0371191 3300037418 Bacteria 1400
332 Ga0395898_0034211 3300037466 Bacteria 5066
333 Ga0395898_0155038 3300037466 Bacteria 2191
334 Ga0395898_0192783 3300037466 Bacteria 1947
335 Ga0395905_0045374 3300037471 Bacteria 4122
336 Ga0395905_0074027 3300037471 Bacteria 3192
337 Ga0395905_0075641 3300037471 Bacteria 3156
338 Ga0395901_0000241 3300038443 Bacteria 68503
339 Ga0395901_0065395 3300038443 Bacteria 3786
340 Ga0395901_0181149 3300038443 Bacteria 2210
341 Ga0395901_0200988 3300038443 Bacteria 2089
342 Ga0395901_0403970 3300038443 Bacteria 1403
343 Ga0436365_0352550 3300039437 Bacteria 74350
344 Ga0436362_0451893 3300039453 Bacteria 163419
345 Ga0439465_0004583 3300041413 Bacteria 4462
346 Ga0451802_1408326 3300041460 Bacteria 1690
347 Ga0439445_0045670 3300042004 Bacteria 1172
348 Ga0439448_0000532 3300042005 Bacteria 8847
349 Ga0439432_048699 3300042006 Bacteria 1326
350 Ga0439446_0010748 3300042156 Bacteria 2472
351 Ga0451577_0082626 3300042876 Bacteria 2865
352 Ga0466973_0105572 3300044659 Bacteria 2374
353 Ga0453683_0031873 3300044673 Bacteria 3328
354 Ga0466966_0000007 3300044684 Bacteria 155702
355 Ga0466966_0130795 3300044684 Bacteria 1537
356 Ga0466961_0058770 3300044693 Bacteria 2446
357 Ga0466961_0181099 3300044693 Bacteria 1308
358 Ga0466963_0019639 3300044694 Bacteria 4241
359 Ga0466963_0023290 3300044694 Bacteria 3930
360 Ga0466957_0166316 3300044842 Bacteria 1435
361 Ga0466960_0304674 3300044901 Bacteria 899
362 Ga0466959_0096352 3300045049 Bacteria 2121
363 Ga0451576_0008370 3300045051 Bacteria 12145
364 Ga0466958_0121513 3300045836 Bacteria 1635
365 Ga0466967_0079802 3300045976 Bacteria 2951
366 Ga0466967_0207440 3300045976 Bacteria 1858
367 Ga0495627_038549 3300046453 Bacteria 1477
368 Ga0495638_0000011 3300046460 Bacteria 442453
369 Ga0495638_0235608 3300046460 Bacteria 1016
370 Ga0495638_0297704 3300046460 Bacteria 870
371 Ga0495650_0001636 3300046471 Bacteria 20810
372 Ga0495585_0053683 3300046492 Bacteria 2230
373 Ga0495596_0127034 3300046500 Bacteria 990
374 Ga0495583_0000242 3300046506 Bacteria 90367
375 Ga0495583_0001079 3300046506 Bacteria 30373
376 Ga0495583_0062278 3300046506 Bacteria 1661
377 Ga0495583_0106066 3300046506 Bacteria 1194
378 Ga0495583_0131394 3300046506 Bacteria 1047
379 Ga0495606_0003229 3300046507 Bacteria 17530
380 Ga0495606_0072771 3300046507 Bacteria 2158
381 Ga0495610_0161439 3300046512 Bacteria 947
382 Ga0495631_0166167 3300046518 Bacteria 947
383 Ga0495632_0000007 3300046519 Bacteria 343246
384 Ga0495632_0000638 3300046519 Bacteria 32240
385 Ga0495637_0010641 3300046520 Bacteria 4441
386 Ga0495637_0061206 3300046520 Bacteria 1544
387 Ga0495643_0000070 3300046522 Bacteria 170879
388 Ga0495643_0003013 3300046522 Bacteria 12664
389 Ga0495643_0010574 3300046522 Bacteria 5670
390 Ga0495643_0147394 3300046522 Bacteria 1168
391 Ga0495648_0000023 3300046524 Bacteria 240174
392 Ga0495648_0000146 3300046524 Bacteria 84443
393 Ga0495648_0024880 3300046524 Bacteria 4065
394 Ga0495648_0063847 3300046524 Bacteria 2172
395 Ga0495663_0000005 3300046525 Bacteria 342265
396 Ga0495663_0002929 3300046525 Bacteria 5024
397 Ga0495663_0004752 3300046525 Bacteria 3802
398 Ga0495642_0015477 3300046528 Bacteria 2965
399 Ga0495654_0001135 3300046530 Bacteria 19108
400 Ga0495654_0011421 3300046530 Bacteria 4807
401 Ga0495598_0000719 3300046537 Bacteria 6304
402 Ga0495597_0010652 3300046542 Bacteria 4483
403 Ga0495622_0013278 3300046557 Bacteria 3822
404 Ga0495633_0001524 3300046558 Bacteria 17834
405 Ga0495633_0002794 3300046558 Bacteria 12067
406 Ga0495633_0014470 3300046558 Bacteria 4125
407 Ga0495633_0025117 3300046558 Bacteria 2936
408 Ga0495633_0147860 3300046558 Bacteria 1085
409 Ga0495668_0000181 3300046616 Bacteria 94147
410 Ga0495668_0003385 3300046616 Bacteria 11999
411 Ga0495668_0009501 3300046616 Bacteria 5968
412 Ga0495668_0050130 3300046616 Bacteria 2314
413 Ga0495611_0141468 3300046648 Bacteria 1123
414 Ga0495625_0000312 3300046660 Bacteria 74208
415 Ga0495625_0021310 3300046660 Bacteria 4992
416 Ga0495625_0039551 3300046660 Bacteria 3442
417 Ga0495625_0054819 3300046660 Bacteria 2846
418 Ga0495661_0222849 3300046665 Bacteria 976
419 Ga0495669_0000179 3300046684 Bacteria 39746
420 Ga0495669_0006848 3300046684 Bacteria 4769
421 Ga0495669_0012371 3300046684 Bacteria 3632
422 Ga0495669_0024586 3300046684 Bacteria 2623
423 Ga0495670_0000037 3300046691 Bacteria 77395
424 Ga0495670_0003180 3300046691 Bacteria 8087
425 Ga0495670_0003777 3300046691 Bacteria 7438
426 Ga0495670_0006231 3300046691 Bacteria 5856
427 Ga0495671_0000012 3300046692 Bacteria 358632
428 Ga0495671_0000039 3300046692 Bacteria 170879
429 Ga0495600_0007940 3300046809 Bacteria 6504
430 Ga0495660_0087819 3300046810 Bacteria 1621
431 Ga0495683_0015848 3300047323 Bacteria 3914
432 Ga0495683_0151672 3300047323 Bacteria 1078
433 Ga0495687_000838 3300047443 Bacteria 32810
434 Ga0495677_0008582 3300047445 Bacteria 3793
435 Ga0495673_0000029 3300047469 Bacteria 471019
436 Ga0495673_0027126 3300047469 Bacteria 2730
437 Ga0495681_0016351 3300047470 Bacteria 4161
438 Ga0495686_0000366 3300047472 Bacteria 73243
439 Ga0495686_0000430 3300047472 Bacteria 65300
440 Ga0495686_0039352 3300047472 Bacteria 3020
441 Ga0496102_0000630 3300048905 Bacteria 35909
442 Ga0496103_0000463 3300048906 Bacteria 34406
443 Ga0496104_0035400 3300048907 Bacteria 4661
444 Ga0496104_0061491 3300048907 Bacteria 3561
445 Ga0496105_0004827 3300048908 Bacteria 10186
446 Ga0496105_0014062 3300048908 Bacteria 6369
447 Ga0496107_0320023 3300048910 Bacteria 1154
448 Ga0496108_0000302 3300048911 Bacteria 42284
449 Ga0496108_0043425 3300048911 Bacteria 3755
450 Ga0496109_0104635 3300048912 Bacteria 2628
451 Ga0496110_0045014 3300048913 Bacteria 3855
452 Ga0496113_0166502 3300048916 Bacteria 1744
453 Ga0496114_0004797 3300048917 Bacteria 10530
454 Ga0496114_0051844 3300048917 Bacteria 3417
455 Ga0496115_0000286 3300048918 Bacteria 43642
456 Ga0496115_0000392 3300048918 Bacteria 35987
457 Ga0496115_0002651 3300048918 Bacteria 12843
458 Ga0496116_0011350 3300048919 Bacteria 7389
459 Ga0496117_0000142 3300048920 Bacteria 157953
460 Ga0496117_0012434 3300048920 Bacteria 7499
461 Ga0496117_0201157 3300048920 Bacteria 1125
462 Ga0496118_0001428 3300048921 Bacteria 35960
463 Ga0496118_0004623 3300048921 Bacteria 16165
464 Ga0496118_0127967 3300048921 Bacteria 1637
465 Ga0496119_0003295 3300048922 Bacteria 16869
466 Ga0496119_0092626 3300048922 Bacteria 1714
467 Ga0496120_0010755 3300048923 Bacteria 6345
468 Ga0496120_0078302 3300048923 Bacteria 1797
469 Ga0496120_0150982 3300048923 Bacteria 1168
470 Ga0496121_0002043 3300048924 Bacteria 31958
471 Ga0496121_0009605 3300048924 Bacteria 11083
472 Ga0496121_0028750 3300048924 Bacteria 5166
473 Ga0496121_0041132 3300048924 Bacteria 4045
474 Ga0496121_0289995 3300048924 Bacteria 1115
475 Ga0496122_0000858 3300048925 Bacteria 57235
476 Ga0496122_0004170 3300048925 Bacteria 18218
477 Ga0496122_0033624 3300048925 Bacteria 4213
478 Ga0496122_0102775 3300048925 Bacteria 1904
479 Ga0496122_0184281 3300048925 Bacteria 1241
480 Ga0496123_0001920 3300048926 Bacteria 27131
481 Ga0496123_0017787 3300048926 Bacteria 5695
482 Ga0496123_0034710 3300048926 Bacteria 3607
483 Ga0496123_0110137 3300048926 Bacteria 1576
484 Ga0496124_0000041 3300048927 Bacteria 303887
485 Ga0496124_0000907 3300048927 Bacteria 47809
486 Ga0496124_0004898 3300048927 Bacteria 15390
487 Ga0496124_0008532 3300048927 Bacteria 10696
488 Ga0496124_0022693 3300048927 Bacteria 5747
489 Ga0496124_0043808 3300048927 Bacteria 3844
490 Ga0496124_0068891 3300048927 Bacteria 2939
491 Ga0496124_0374694 3300048927 Bacteria 998
492 Ga0496125_0000238 3300048928 Bacteria 113252
493 Ga0496125_0009979 3300048928 Bacteria 9652
494 Ga0496125_0015219 3300048928 Bacteria 7449
495 Ga0496125_0063100 3300048928 Bacteria 2957
496 Ga0496125_0070073 3300048928 Bacteria 2747
497 Ga0496125_0071993 3300048928 Bacteria 2697
498 Ga0496126_0001472 3300048929 Bacteria 36627
499 Ga0501033_0022441 3300049570 Bacteria 4762
500 Ga0501042_0666707 3300049578 Bacteria 756
501 Ga0501046_0069641 3300049580 Bacteria 2737
502 Ga0501047_0003460 3300049581 Bacteria 14916
503 Ga0501067_0154404 3300049583 Unclassified 1279
504 Ga0501068_0128713 3300049584 Bacteria 1582
505 Ga0501071_0499264 3300049587 Bacteria 933
506 Ga0501222_000846 3300049662 Bacteria 4415
507 Ga0501223_000039 3300049663 Bacteria 45537
508 Ga0501223_005328 3300049663 Bacteria 2707
509 Ga0501224_002810 3300049664 Bacteria 2398
510 Ga0501257_000007 3300049686 Bacteria 54757
511 Ga0501259_001381 3300049688 Bacteria 4061
512 Ga0501261_000011 3300049690 Bacteria 48296
513 Ga0501225_0000010 3300049705 Bacteria 82395
514 Ga0501225_0022505 3300049705 Bacteria 1740
515 Ga0501225_0045145 3300049705 Bacteria 1220
516 Ga0501279_000010 3300049775 Bacteria 103375
517 Ga0501280_000099 3300049776 Bacteria 22972
518 Ga0501280_003711 3300049776 Bacteria 2314
519 Ga0501281_00413 3300049777 Bacteria 4227
520 Ga0501035_0147740 3300049822 Bacteria 2041
521 Ga0501044_0050810 3300049823 Bacteria 4277
522 Ga0501044_0329206 3300049823 Bacteria 1451
523 nmdc:mga09592_352823_c1 3300050508 Bacteria 1273
524 Ga0495612_0081780 3300053078 Bacteria 1358
525 Ga0500610_0000299 3300053079 Bacteria 14964
526 Ga0500643_001133 3300053087 Bacteria 15906
527 Ga0500643_002728 3300053087 Bacteria 8858
528 Ga0500643_005562 3300053087 Bacteria 5408
529 Ga0500643_005761 3300053087 Bacteria 5285
530 Ga0500643_075769 3300053087 Bacteria 929
531 Ga0500644_0042932 3300053088 Bacteria 1510
532 Ga0500583_0080149 3300053092 Bacteria 1576
533 Ga0500651_0014272 3300053093 Bacteria 4859
534 Ga0500651_0240211 3300053093 Bacteria 1057
535 Ga0500641_0025271 3300053096 Bacteria 2297
536 Ga0500562_013822 3300053108 Bacteria 2065
537 Ga0500592_000445 3300053116 Bacteria 6908
538 Ga0500592_001313 3300053116 Bacteria 4045
539 Ga0500592_001693 3300053116 Bacteria 3574
540 Ga0500595_023151 3300053119 Bacteria 2187
541 Ga0500618_012199 3300053125 Bacteria 2255
542 Ga0500642_0003941 3300053130 Bacteria 4576
543 Ga0500642_0007123 3300053130 Bacteria 3738
544 Ga0500655_000094 3300053133 Bacteria 23193
545 Ga0500559_0010893 3300053136 Bacteria 3897
546 Ga0500559_0063063 3300053136 Bacteria 1656
547 Ga0500568_0047100 3300053139 Bacteria 1709
548 Ga0500590_006053 3300053148 Bacteria 5865
549 Ga0500619_014363 3300053154 Bacteria 2126
550 Ga0500624_000002 3300053157 Bacteria 257900
551 Ga0500627_0000851 3300053158 Bacteria 8159
552 Ga0500627_0001031 3300053158 Bacteria 7597
553 Ga0500636_0003715 3300053177 Bacteria 8614
554 Ga0500636_0026939 3300053177 Bacteria 3394
555 Ga0500570_000135 3300053724 Bacteria 21948
556 Ga0500645_000132 3300053730 Bacteria 58716
557 Ga0500645_026699 3300053730 Bacteria 1756
558 Ga0500661_000742 3300055283 Bacteria 6126

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025933 Ga0207706_10010249 Ga0207706_100102495 207
2 3300026116 Ga0207674_10025014 Ga0207674_100250145 207
3 3300032002 Ga0307416_100062443 Ga0307416_1000624434 207
4 3300049578 Ga0501042_0666707 Ga0501042_0666707_13_741 218
5 3300045976 Ga0466967_0079802 Ga0466967_0079802_1453_2286 231
6 3300037418 Ga0395900_0007250 Ga0395900_0007250_10480_11313 232
7 3300005577 Ga0068857_100084926 Ga0068857_1000849264 234
8 3300026116 Ga0207674_10512697 Ga0207674_105126972 234
9 3300037471 Ga0395905_0074027 Ga0395905_0074027_1805_2701 234
10 3300044684 Ga0466966_0130795 Ga0466966_0130795_643_1476 234
11 3300044693 Ga0466961_0058770 Ga0466961_0058770_1044_1877 234
12 3300045049 Ga0466959_0096352 Ga0466959_0096352_132_965 234
13 3300045836 Ga0466958_0121513 Ga0466958_0121513_425_1258 234
14 3300046537 Ga0495598_0000719 Ga0495598_0000719_1193_2053 235
15 3300046684 Ga0495669_0012371 Ga0495669_0012371_585_1445 235
16 3300046691 Ga0495670_0006231 Ga0495670_0006231_3507_4367 235
17 3300038443 Ga0395901_0000241 Ga0395901_0000241_17272_18105 238
18 3300025261 Ga0209233_1011300 Ga0209233_10113002 241
19 3300044694 Ga0466963_0023290 Ga0466963_0023290_1451_2284 244
20 3300046684 Ga0495669_0006848 Ga0495669_0006848_2254_3078 245
21 3300005338 Ga0068868_100227642 Ga0068868_1002276422 246
22 3300046506 Ga0495583_0106066 Ga0495583_0106066_69_887 246
23 3300053079 Ga0500610_0000299 Ga0500610_0000299_12760_13578 246
24 3300053730 Ga0500645_000132 Ga0500645_000132_48602_49420 246
25 3300005842 Ga0068858_100584775 Ga0068858_1005847752 247
26 3300025923 Ga0207681_10448003 Ga0207681_104480031 247
27 3300031731 Ga0307405_10189704 Ga0307405_101897042 247
28 3300031824 Ga0307413_10010036 Ga0307413_100100362 247
29 3300031995 Ga0307409_100238632 Ga0307409_1002386322 247
30 3300032004 Ga0307414_10000420 Ga0307414_1000042018 247
31 3300032126 Ga0307415_100409527 Ga0307415_1004095272 247
32 3300045051 Ga0451576_0008370 Ga0451576_0008370_6054_6902 247
33 3300049587 Ga0501071_0499264 Ga0501071_0499264_16_849 247
34 3300053116 Ga0500592_001313 Ga0500592_001313_123_1004 247
35 3300025949 Ga0207667_10047515 Ga0207667_100475155 248
36 3300026116 Ga0207674_10037637 Ga0207674_100376372 248
37 3300047445 Ga0495677_0008582 Ga0495677_0008582_1349_2173 248
38 3300005344 Ga0070661_100216754 Ga0070661_1002167542 249
39 3300009551 Ga0105238_10188370 Ga0105238_101883703 249
40 3300013307 Ga0157372_10213884 Ga0157372_102138843 249
41 3300025920 Ga0207649_10093736 Ga0207649_100937363 249
42 3300026041 Ga0207639_10067025 Ga0207639_100670253 249
43 3300037418 Ga0395900_0220584 Ga0395900_0220584_855_1691 249
44 3300044842 Ga0466957_0166316 Ga0466957_0166316_164_1027 249
45 3300001989 JGI24739J22299_10003988 JGI24739J22299_100039882 250
46 3300002075 JGI24738J21930_10007207 JGI24738J21930_100072072 250
47 3300005457 Ga0070662_100010572 Ga0070662_1000105726 250
48 3300005539 Ga0068853_100018116 Ga0068853_1000181163 250
49 3300021358 Ga0213873_10000007 Ga0213873_10000007153 250
50 3300021384 Ga0213876_10000005 Ga0213876_10000005189 250
51 3300025933 Ga0207706_10024099 Ga0207706_100240995 250
52 3300025949 Ga0207667_10179290 Ga0207667_101792902 250
53 3300025981 Ga0207640_10019501 Ga0207640_100195014 250
54 3300025981 Ga0207640_10114024 Ga0207640_101140242 250
55 3300026041 Ga0207639_10006688 Ga0207639_100066886 250
56 3300026116 Ga0207674_10020781 Ga0207674_100207813 250
57 3300031731 Ga0307405_10031119 Ga0307405_100311193 250
58 3300031731 Ga0307405_10032751 Ga0307405_100327512 250
59 3300031911 Ga0307412_10124580 Ga0307412_101245801 250
60 3300053087 Ga0500643_002728 Ga0500643_002728_3502_4335 250
61 3300005344 Ga0070661_100049038 Ga0070661_1000490382 251
62 3300005563 Ga0068855_100056357 Ga0068855_1000563574 251
63 3300005614 Ga0068856_100046685 Ga0068856_1000466854 251
64 3300006846 Ga0075430_100121363 Ga0075430_1001213632 251
65 3300013105 Ga0157369_10129064 Ga0157369_101290642 251
66 3300025949 Ga0207667_10136055 Ga0207667_101360552 251
67 3300026078 Ga0207702_10033026 Ga0207702_100330264 251
68 3300026142 Ga0207698_10018012 Ga0207698_100180123 251
69 3300044684 Ga0466966_0000007 Ga0466966_0000007_82484_83320 251
70 3300044693 Ga0466961_0181099 Ga0466961_0181099_452_1285 251
71 3300046660 Ga0495625_0039551 Ga0495625_0039551_54_887 251
72 3300047443 Ga0495687_000838 Ga0495687_000838_12124_12957 251
73 3300001915 JGI24741J21665_1000724 JGI24741J21665_10007243 252
74 3300001990 JGI24737J22298_10002224 JGI24737J22298_100022248 252
75 3300005327 Ga0070658_10000281 Ga0070658_1000028120 252
76 3300005339 Ga0070660_100129524 Ga0070660_1001295242 252
77 3300005344 Ga0070661_100001799 Ga0070661_1000017993 252
78 3300005344 Ga0070661_100185058 Ga0070661_1001850581 252
79 3300005353 Ga0070669_100362367 Ga0070669_1003623672 252
80 3300005366 Ga0070659_100015172 Ga0070659_1000151725 252
81 3300005367 Ga0070667_100000302 Ga0070667_10000030230 252
82 3300005455 Ga0070663_100006789 Ga0070663_1000067892 252
83 3300005458 Ga0070681_10060953 Ga0070681_100609533 252
84 3300005563 Ga0068855_100084253 Ga0068855_1000842533 252
85 3300005614 Ga0068856_100062368 Ga0068856_1000623683 252
86 3300005834 Ga0068851_10064305 Ga0068851_100643052 252
87 3300005843 Ga0068860_100000416 Ga0068860_10000041630 252
88 3300009174 Ga0105241_10016301 Ga0105241_100163016 252
89 3300009177 Ga0105248_10210064 Ga0105248_102100641 252
90 3300013100 Ga0157373_10195237 Ga0157373_101952372 252
91 3300013102 Ga0157371_10000747 Ga0157371_1000074723 252
92 3300025321 Ga0207656_10014475 Ga0207656_100144753 252
93 3300025909 Ga0207705_10000319 Ga0207705_1000031922 252
94 3300025911 Ga0207654_10001234 Ga0207654_1000123413 252
95 3300025913 Ga0207695_10048566 Ga0207695_100485665 252
96 3300025919 Ga0207657_10002244 Ga0207657_1000224422 252
97 3300025920 Ga0207649_10001413 Ga0207649_1000141316 252
98 3300025920 Ga0207649_10074293 Ga0207649_100742932 252
99 3300025932 Ga0207690_10000511 Ga0207690_1000051121 252
100 3300025933 Ga0207706_10010971 Ga0207706_100109718 252
101 3300025949 Ga0207667_10000006 Ga0207667_10000006572 252
102 3300025981 Ga0207640_10019101 Ga0207640_100191013 252
103 3300025986 Ga0207658_10000263 Ga0207658_1000026329 252
104 3300026041 Ga0207639_10001496 Ga0207639_100014967 252
105 3300026067 Ga0207678_10008946 Ga0207678_100089463 252
106 3300026078 Ga0207702_10002982 Ga0207702_1000298211 252
107 3300026078 Ga0207702_10034073 Ga0207702_100340732 252
108 3300026078 Ga0207702_10777493 Ga0207702_107774931 252
109 3300026088 Ga0207641_10004428 Ga0207641_100044281 252
110 3300026116 Ga0207674_10014177 Ga0207674_100141773 252
111 3300026142 Ga0207698_10160685 Ga0207698_101606852 252
112 3300028381 Ga0268264_10000184 Ga0268264_1000018429 252
113 3300031731 Ga0307405_10005258 Ga0307405_100052584 252
114 3300044901 Ga0466960_0304674 Ga0466960_0304674_19_855 252
115 3300046616 Ga0495668_0050130 Ga0495668_0050130_878_1687 252
116 3300047323 Ga0495683_0151672 Ga0495683_0151672_55_873 252
117 3300001990 JGI24737J22298_10052684 JGI24737J22298_100526841 253
118 3300003911 JGI25405J52794_10007325 JGI25405J52794_100073251 253
119 3300005455 Ga0070663_100100815 Ga0070663_1001008151 253
120 3300005577 Ga0068857_100066462 Ga0068857_1000664623 253
121 3300005937 Ga0081455_10000215 Ga0081455_1000021536 253
122 3300013104 Ga0157370_10255949 Ga0157370_102559492 253
123 3300026067 Ga0207678_10027339 Ga0207678_100273394 253
124 3300044694 Ga0466963_0019639 Ga0466963_0019639_3280_4113 253
125 3300046512 Ga0495610_0161439 Ga0495610_0161439_86_904 253
126 3300046525 Ga0495663_0002929 Ga0495663_0002929_3422_4276 253
127 3300046530 Ga0495654_0001135 Ga0495654_0001135_9179_10033 253
128 3300046616 Ga0495668_0003385 Ga0495668_0003385_4798_5652 253
129 3300048918 Ga0496115_0000286 Ga0496115_0000286_23379_24212 253
130 3300053158 Ga0500627_0000851 Ga0500627_0000851_5261_6115 253
131 3300005262 Ga0065165_1047593 Ga0065165_10475932 254
132 3300025304 Ga0209257_1005932 Ga0209257_10059327 254
133 3300045976 Ga0466967_0207440 Ga0466967_0207440_41_904 254
134 3300046691 Ga0495670_0000037 Ga0495670_0000037_34902_35735 254
135 3300048925 Ga0496122_0184281 Ga0496122_0184281_58_891 254
136 3300049664 Ga0501224_002810 Ga0501224_002810_645_1481 254
137 3300049705 Ga0501225_0045145 Ga0501225_0045145_159_995 254
138 3300049777 Ga0501281_00413 Ga0501281_00413_1599_2435 254
139 3300053078 Ga0495612_0081780 Ga0495612_0081780_498_1337 254
140 iso_pu_bacteria 2852680915 2852684037 254
141 3300005564 Ga0070664_100027450 Ga0070664_1000274506 255
142 3300009545 Ga0105237_10017495 Ga0105237_100174954 255
143 3300025914 Ga0207671_10009474 Ga0207671_100094749 255
144 3300025919 Ga0207657_10009148 Ga0207657_1000914810 255
145 3300025932 Ga0207690_10112872 Ga0207690_101128723 255
146 3300025945 Ga0207679_10333986 Ga0207679_103339862 255
147 3300026142 Ga0207698_10255564 Ga0207698_102555642 255
148 3300031456 Ga0307513_10161811 Ga0307513_101618111 255
149 3300031731 Ga0307405_10044668 Ga0307405_100446683 255
150 3300032002 Ga0307416_100013238 Ga0307416_1000132386 255
151 3300039437 Ga0436365_0352550 Ga0436365_0352550_15529_16374 255
152 3300039453 Ga0436362_0451893 Ga0436362_0451893_145512_146357 255
153 3300048924 Ga0496121_0009605 Ga0496121_0009605_6399_7232 255
154 3300053093 Ga0500651_0240211 Ga0500651_0240211_34_906 255
155 3300053177 Ga0500636_0026939 Ga0500636_0026939_2271_3104 255
156 3300003215 JGI25153J46596_10000070 JGI25153J46596_1000007096 256
157 3300005347 Ga0070668_100025389 Ga0070668_1000253895 256
158 3300005617 Ga0068859_100057802 Ga0068859_1000578024 256
159 3300005841 Ga0068863_100002334 Ga0068863_10000233418 256
160 3300005844 Ga0068862_100000085 Ga0068862_10000008560 256
161 3300005844 Ga0068862_100007732 Ga0068862_1000077325 256
162 3300006931 Ga0097620_100057801 Ga0097620_1000578014 256
163 3300009553 Ga0105249_10000038 Ga0105249_10000038138 256
164 3300025245 Ga0207425_1035154 Ga0207425_10351541 256
165 3300025297 Ga0209758_1000023 Ga0209758_1000023474 256
166 3300025297 Ga0209758_1023592 Ga0209758_10235924 256
167 3300025961 Ga0207712_10000002 Ga0207712_10000002138 256
168 3300025972 Ga0207668_10004682 Ga0207668_100046822 256
169 3300026088 Ga0207641_10000944 Ga0207641_1000094422 256
170 3300028380 Ga0268265_10000104 Ga0268265_1000010447 256
171 3300028380 Ga0268265_10024259 Ga0268265_100242594 256
172 3300028381 Ga0268264_10001970 Ga0268264_1000197016 256
173 3300041413 Ga0439465_0004583 Ga0439465_0004583_2318_3154 256
174 3300042004 Ga0439445_0045670 Ga0439445_0045670_197_1033 256
175 3300042156 Ga0439446_0010748 Ga0439446_0010748_1280_2116 256
176 3300046460 Ga0495638_0000011 Ga0495638_0000011_316619_317452 256
177 3300046524 Ga0495648_0000023 Ga0495648_0000023_114339_115172 256
178 3300048911 Ga0496108_0000302 Ga0496108_0000302_32746_33582 256
179 3300048920 Ga0496117_0012434 Ga0496117_0012434_5202_6050 256
180 3300048921 Ga0496118_0004623 Ga0496118_0004623_14630_15478 256
181 3300048924 Ga0496121_0041132 Ga0496121_0041132_2699_3541 256
182 3300048924 Ga0496121_0289995 Ga0496121_0289995_195_1043 256
183 3300048925 Ga0496122_0004170 Ga0496122_0004170_10322_11164 256
184 3300048927 Ga0496124_0008532 Ga0496124_0008532_2145_2987 256
185 3300048928 Ga0496125_0009979 Ga0496125_0009979_461_1303 256
186 3300049662 Ga0501222_000846 Ga0501222_000846_327_1172 256
187 3300049663 Ga0501223_005328 Ga0501223_005328_126_971 256
188 3300049688 Ga0501259_001381 Ga0501259_001381_2889_3734 256
189 3300049690 Ga0501261_000011 Ga0501261_000011_31759_32604 256
190 3300049775 Ga0501279_000010 Ga0501279_000010_53872_54717 256
191 3300049776 Ga0501280_000099 Ga0501280_000099_6487_7332 256
192 3300053087 Ga0500643_075769 Ga0500643_075769_29_865 256
193 3300002076 JGI24749J21850_1000934 JGI24749J21850_10009344 257
194 3300002459 JGI24751J29686_10000055 JGI24751J29686_1000005511 257
195 3300005295 Ga0065707_10086768 Ga0065707_100867682 257
196 3300005327 Ga0070658_10002876 Ga0070658_1000287610 257
197 3300005331 Ga0070670_100000082 Ga0070670_10000008258 257
198 3300005331 Ga0070670_100006073 Ga0070670_1000060733 257
199 3300005347 Ga0070668_100000239 Ga0070668_10000023921 257
200 3300005353 Ga0070669_100000015 Ga0070669_10000001558 257
201 3300005355 Ga0070671_100001987 Ga0070671_1000019872 257
202 3300005367 Ga0070667_100000003 Ga0070667_1000000037 257
203 3300005367 Ga0070667_100013773 Ga0070667_1000137735 257
204 3300005617 Ga0068859_100039142 Ga0068859_1000391423 257
205 3300005618 Ga0068864_100000177 Ga0068864_10000017734 257
206 3300005719 Ga0068861_100001270 Ga0068861_10000127015 257
207 3300005843 Ga0068860_100000068 Ga0068860_100000068179 257
208 3300005844 Ga0068862_100000006 Ga0068862_100000006108 257
209 3300005844 Ga0068862_100001068 Ga0068862_1000010686 257
210 3300006931 Ga0097620_100039143 Ga0097620_1000391433 257
211 3300009177 Ga0105248_10000066 Ga0105248_1000006624 257
212 3300009545 Ga0105237_10097523 Ga0105237_100975233 257
213 3300014326 Ga0157380_10000114 Ga0157380_100001144 257
214 3300025909 Ga0207705_10000022 Ga0207705_1000002298 257
215 3300025914 Ga0207671_10015329 Ga0207671_100153293 257
216 3300025923 Ga0207681_10000001 Ga0207681_10000001782 257
217 3300025925 Ga0207650_10000050 Ga0207650_10000050125 257
218 3300025931 Ga0207644_10000836 Ga0207644_1000083620 257
219 3300025941 Ga0207711_10000317 Ga0207711_100003175 257
220 3300025972 Ga0207668_10000045 Ga0207668_1000004521 257
221 3300025986 Ga0207658_10000002 Ga0207658_10000002909 257
222 3300025986 Ga0207658_10008852 Ga0207658_100088525 257
223 3300026088 Ga0207641_10004405 Ga0207641_100044052 257
224 3300026095 Ga0207676_10000004 Ga0207676_10000004218 257
225 3300026116 Ga0207674_10011507 Ga0207674_100115077 257
226 3300026118 Ga0207675_100001609 Ga0207675_1000016097 257
227 3300028380 Ga0268265_10000002 Ga0268265_10000002835 257
228 3300028380 Ga0268265_10000946 Ga0268265_1000094624 257
229 3300028381 Ga0268264_10000103 Ga0268264_10000103223 257
230 3300046506 Ga0495583_0062278 Ga0495583_0062278_816_1634 257
231 3300046530 Ga0495654_0011421 Ga0495654_0011421_3900_4751 257
232 3300048925 Ga0496122_0000858 Ga0496122_0000858_54619_55464 257
233 3300048926 Ga0496123_0001920 Ga0496123_0001920_8298_9143 257
234 3300048926 Ga0496123_0017787 Ga0496123_0017787_2572_3405 257
235 3300048926 Ga0496123_0110137 Ga0496123_0110137_80_913 257
236 3300048927 Ga0496124_0004898 Ga0496124_0004898_13964_14797 257
237 3300048927 Ga0496124_0022693 Ga0496124_0022693_3670_4503 257
238 3300048927 Ga0496124_0068891 Ga0496124_0068891_596_1429 257
239 3300048928 Ga0496125_0071993 Ga0496125_0071993_880_1713 257
240 3300049686 Ga0501257_000007 Ga0501257_000007_48827_49678 257
241 3300049776 Ga0501280_003711 Ga0501280_003711_716_1567 257
242 3300053087 Ga0500643_005761 Ga0500643_005761_1391_2272 257
243 3300053116 Ga0500592_000445 Ga0500592_000445_5424_6275 257
244 3300053136 Ga0500559_0010893 Ga0500559_0010893_2878_3723 257
245 3300053158 Ga0500627_0001031 Ga0500627_0001031_6733_7584 257
246 3300003320 rootH2_10095765 rootH2_100957654 258
247 3300003762 Ga0055542_1000040 Ga0055542_1000040183 258
248 3300003763 Ga0055529_1000037 Ga0055529_100003738 258
249 3300005331 Ga0070670_100192447 Ga0070670_1001924472 258
250 3300005347 Ga0070668_100017003 Ga0070668_1000170036 258
251 3300005456 Ga0070678_100000147 Ga0070678_10000014716 258
252 3300005578 Ga0068854_100010580 Ga0068854_1000105805 258
253 3300006186 Ga0075369_10060962 Ga0075369_100609623 258
254 3300006195 Ga0075366_10068079 Ga0075366_100680792 258
255 3300006880 Ga0075429_100075740 Ga0075429_1000757402 258
256 3300009148 Ga0105243_10000990 Ga0105243_1000099012 258
257 3300025254 Ga0209148_1000011 Ga0209148_10000111080 258
258 3300025272 Ga0209455_1000006 Ga0209455_1000006112 258
259 3300025925 Ga0207650_10198717 Ga0207650_101987171 258
260 3300025933 Ga0207706_10115900 Ga0207706_101159002 258
261 3300025935 Ga0207709_10000039 Ga0207709_10000039111 258
262 3300025937 Ga0207669_10000076 Ga0207669_1000007619 258
263 3300025972 Ga0207668_10190457 Ga0207668_101904571 258
264 3300025981 Ga0207640_10006816 Ga0207640_100068163 258
265 3300025986 Ga0207658_10046286 Ga0207658_100462862 258
266 3300026121 Ga0207683_10000715 Ga0207683_100007157 258
267 3300028786 Ga0307517_10035942 Ga0307517_100359421 258
268 3300031456 Ga0307513_10076622 Ga0307513_100766224 258
269 3300031911 Ga0307412_10012894 Ga0307412_100128942 258
270 3300033180 Ga0307510_10134865 Ga0307510_101348652 258
271 3300044659 Ga0466973_0105572 Ga0466973_0105572_407_1288 258
272 3300046460 Ga0495638_0235608 Ga0495638_0235608_86_904 258
273 3300046471 Ga0495650_0001636 Ga0495650_0001636_17632_18450 258
274 3300046492 Ga0495585_0053683 Ga0495585_0053683_1383_2201 258
275 3300046500 Ga0495596_0127034 Ga0495596_0127034_35_853 258
276 3300046506 Ga0495583_0001079 Ga0495583_0001079_14336_15154 258
277 3300046506 Ga0495583_0131394 Ga0495583_0131394_161_979 258
278 3300046507 Ga0495606_0003229 Ga0495606_0003229_12736_13554 258
279 3300046507 Ga0495606_0072771 Ga0495606_0072771_578_1396 258
280 3300046518 Ga0495631_0166167 Ga0495631_0166167_73_891 258
281 3300046522 Ga0495643_0003013 Ga0495643_0003013_6905_7723 258
282 3300046522 Ga0495643_0010574 Ga0495643_0010574_3252_4070 258
283 3300046522 Ga0495643_0147394 Ga0495643_0147394_147_965 258
284 3300046524 Ga0495648_0000146 Ga0495648_0000146_16438_17256 258
285 3300046525 Ga0495663_0004752 Ga0495663_0004752_805_1623 258
286 3300046528 Ga0495642_0015477 Ga0495642_0015477_1203_2021 258
287 3300046557 Ga0495622_0013278 Ga0495622_0013278_107_925 258
288 3300046558 Ga0495633_0001524 Ga0495633_0001524_8850_9668 258
289 3300046558 Ga0495633_0147860 Ga0495633_0147860_80_898 258
290 3300046616 Ga0495668_0000181 Ga0495668_0000181_81359_82177 258
291 3300046648 Ga0495611_0141468 Ga0495611_0141468_211_1029 258
292 3300046660 Ga0495625_0000312 Ga0495625_0000312_56529_57347 258
293 3300046660 Ga0495625_0054819 Ga0495625_0054819_1370_2188 258
294 3300046665 Ga0495661_0222849 Ga0495661_0222849_138_956 258
295 3300046684 Ga0495669_0000179 Ga0495669_0000179_13147_13965 258
296 3300046691 Ga0495670_0003180 Ga0495670_0003180_3402_4220 258
297 3300046810 Ga0495660_0087819 Ga0495660_0087819_372_1190 258
298 3300047323 Ga0495683_0015848 Ga0495683_0015848_112_930 258
299 3300048905 Ga0496102_0000630 Ga0496102_0000630_17186_18004 258
300 3300048906 Ga0496103_0000463 Ga0496103_0000463_17973_18791 258
301 3300048907 Ga0496104_0061491 Ga0496104_0061491_394_1212 258
302 3300048908 Ga0496105_0014062 Ga0496105_0014062_2233_3051 258
303 3300048913 Ga0496110_0045014 Ga0496110_0045014_1775_2593 258
304 3300048917 Ga0496114_0051844 Ga0496114_0051844_2518_3336 258
305 3300048918 Ga0496115_0000392 Ga0496115_0000392_17156_17974 258
306 3300048919 Ga0496116_0011350 Ga0496116_0011350_5492_6310 258
307 3300048920 Ga0496117_0000142 Ga0496117_0000142_139188_140006 258
308 3300048921 Ga0496118_0001428 Ga0496118_0001428_17912_18730 258
309 3300048922 Ga0496119_0003295 Ga0496119_0003295_1290_2108 258
310 3300048923 Ga0496120_0010755 Ga0496120_0010755_4515_5333 258
311 3300048924 Ga0496121_0002043 Ga0496121_0002043_16973_17791 258
312 3300048925 Ga0496122_0033624 Ga0496122_0033624_1273_2091 258
313 3300048926 Ga0496123_0034710 Ga0496123_0034710_1575_2393 258
314 3300048927 Ga0496124_0000041 Ga0496124_0000041_177197_178015 258
315 3300048928 Ga0496125_0000238 Ga0496125_0000238_94458_95276 258
316 3300048929 Ga0496126_0001472 Ga0496126_0001472_18560_19378 258
317 3300049580 Ga0501046_0069641 Ga0501046_0069641_545_1426 258
318 3300049581 Ga0501047_0003460 Ga0501047_0003460_9437_10318 258
319 3300050508 nmdc:mga09592_352823_c1 nmdc:mga09592_352823_c1_403_1236 258
320 3300053130 Ga0500642_0007123 Ga0500642_0007123_1498_2316 258
321 3300053154 Ga0500619_014363 Ga0500619_014363_1221_2039 258
322 iso_pu_bacteria 2830075706 2830078277 258
323 iso_pu_bacteria 2882806704 2882807792 258
324 iso_pu_bacteria 2990265787 2990266136 258
325 iso_pu_bacteria 2993693658 2993696070 258
326 3300003322 rootL2_10377998 rootL2_103779982 259
327 3300005328 Ga0070676_10024614 Ga0070676_100246144 259
328 3300005338 Ga0068868_100018436 Ga0068868_1000184363 259
329 3300005339 Ga0070660_100110087 Ga0070660_1001100872 259
330 3300005344 Ga0070661_100051672 Ga0070661_1000516724 259
331 3300005366 Ga0070659_100149661 Ga0070659_1001496612 259
332 3300005367 Ga0070667_100087970 Ga0070667_1000879703 259
333 3300005455 Ga0070663_100279726 Ga0070663_1002797262 259
334 3300005456 Ga0070678_100567895 Ga0070678_1005678951 259
335 3300005564 Ga0070664_100267051 Ga0070664_1002670512 259
336 3300005578 Ga0068854_100044961 Ga0068854_1000449613 259
337 3300005617 Ga0068859_100722376 Ga0068859_1007223761 259
338 3300005834 Ga0068851_10001318 Ga0068851_100013183 259
339 3300005842 Ga0068858_100000897 Ga0068858_10000089713 259
340 3300006931 Ga0097620_100722312 Ga0097620_1007223121 259
341 3300009551 Ga0105238_10012734 Ga0105238_100127343 259
342 3300013100 Ga0157373_10175635 Ga0157373_101756353 259
343 3300013296 Ga0157374_10033403 Ga0157374_100334033 259
344 3300013296 Ga0157374_10181585 Ga0157374_101815852 259
345 3300013296 Ga0157374_10819410 Ga0157374_108194101 259
346 3300013297 Ga0157378_10028808 Ga0157378_100288083 259
347 3300025272 Ga0209455_1006523 Ga0209455_10065233 259
348 3300025321 Ga0207656_10017108 Ga0207656_100171083 259
349 3300025907 Ga0207645_10031970 Ga0207645_100319704 259
350 3300025919 Ga0207657_10012074 Ga0207657_100120742 259
351 3300025920 Ga0207649_10017406 Ga0207649_100174066 259
352 3300025920 Ga0207649_10058862 Ga0207649_100588623 259
353 3300025924 Ga0207694_10013185 Ga0207694_100131855 259
354 3300025932 Ga0207690_10101618 Ga0207690_101016182 259
355 3300025986 Ga0207658_10212603 Ga0207658_102126032 259
356 3300026023 Ga0207677_10077077 Ga0207677_100770773 259
357 3300026035 Ga0207703_10000483 Ga0207703_1000048320 259
358 3300026041 Ga0207639_10216638 Ga0207639_102166383 259
359 3300026067 Ga0207678_10004587 Ga0207678_1000458710 259
360 3300026142 Ga0207698_10420011 Ga0207698_104200112 259
361 3300031616 Ga0307508_10003330 Ga0307508_1000333015 259
362 3300046506 Ga0495583_0000242 Ga0495583_0000242_68903_69736 259
363 3300046519 Ga0495632_0000638 Ga0495632_0000638_11464_12297 259
364 3300046558 Ga0495633_0014470 Ga0495633_0014470_2579_3412 259
365 3300046692 Ga0495671_0000012 Ga0495671_0000012_117058_117891 259
366 3300047469 Ga0495673_0000029 Ga0495673_0000029_240742_241575 259
367 3300049584 Ga0501068_0128713 Ga0501068_0128713_441_1298 259
368 3300053088 Ga0500644_0042932 Ga0500644_0042932_253_1086 259
369 iso_pu_bacteria 2599185354 2600203025 259
370 iso_pu_bacteria 2599185359 2600228335 259
371 iso_pu_bacteria 2751185897 2753767392 259
372 iso_pu_bacteria 2818991466 2819716069 259
373 iso_pu_bacteria 2879163058 2879163344 259
374 iso_pu_bacteria 2885427238 2885427889 259
375 iso_pu_bacteria 2885429604 2885430235 259
376 iso_pu_bacteria 2928526807 2928528129 259
377 iso_pu_bacteria 2928968154 2928971364 259
378 3300005548 Ga0070665_100037912 Ga0070665_1000379123 260
379 3300005618 Ga0068864_100017243 Ga0068864_1000172433 260
380 3300012513 Ga0157326_1000962 Ga0157326_10009624 260
381 3300025923 Ga0207681_10230780 Ga0207681_102307802 260
382 3300026088 Ga0207641_10001679 Ga0207641_1000167920 260
383 3300026095 Ga0207676_10000895 Ga0207676_1000089514 260
384 3300028379 Ga0268266_10038407 Ga0268266_100384075 260
385 3300031911 Ga0307412_10000220 Ga0307412_1000022017 260
386 3300042876 Ga0451577_0082626 Ga0451577_0082626_679_1572 260
387 3300044673 Ga0453683_0031873 Ga0453683_0031873_2340_3233 260
388 3300046453 Ga0495627_038549 Ga0495627_038549_162_995 260
389 3300046558 Ga0495633_0025117 Ga0495633_0025117_2074_2907 260
390 3300048907 Ga0496104_0035400 Ga0496104_0035400_719_1582 260
391 3300048908 Ga0496105_0004827 Ga0496105_0004827_2337_3200 260
392 3300048910 Ga0496107_0320023 Ga0496107_0320023_36_899 260
393 3300048917 Ga0496114_0004797 Ga0496114_0004797_7246_8109 260
394 3300048918 Ga0496115_0002651 Ga0496115_0002651_7825_8688 260
395 3300048922 Ga0496119_0092626 Ga0496119_0092626_534_1373 260
396 3300048923 Ga0496120_0078302 Ga0496120_0078302_391_1230 260
397 3300048927 Ga0496124_0000907 Ga0496124_0000907_27885_28718 260
398 3300049823 Ga0501044_0329206 Ga0501044_0329206_403_1275 260
399 3300053157 Ga0500624_000002 Ga0500624_000002_33861_34694 260
400 iso_pu_bacteria 2643221622 2644128216 260
401 iso_pu_bacteria 3000865235 3000866092 260
402 3300003791 Ga0055530_10000131 Ga0055530_1000013136 261
403 3300003794 Ga0055531_10000514 Ga0055531_1000051420 261
404 3300005356 Ga0070674_100415816 Ga0070674_1004158161 261
405 3300025298 Ga0209050_1000347 Ga0209050_100034754 261
406 3300025304 Ga0209257_1000371 Ga0209257_100037154 261
407 3300025937 Ga0207669_10318539 Ga0207669_103185392 261
408 3300030878 Ga0265770_1001694 Ga0265770_10016942 261
409 3300031090 Ga0265760_10001598 Ga0265760_100015981 261
410 3300031456 Ga0307513_10066112 Ga0307513_100661122 261
411 3300033180 Ga0307510_10007125 Ga0307510_100071259 261
412 3300042005 Ga0439448_0000532 Ga0439448_0000532_7197_8060 261
413 3300046460 Ga0495638_0297704 Ga0495638_0297704_10_843 261
414 3300046524 Ga0495648_0024880 Ga0495648_0024880_1522_2355 261
415 3300046616 Ga0495668_0009501 Ga0495668_0009501_4453_5286 261
416 3300046660 Ga0495625_0021310 Ga0495625_0021310_191_1024 261
417 3300048928 Ga0496125_0070073 Ga0496125_0070073_445_1326 261
418 3300053087 Ga0500643_001133 Ga0500643_001133_1295_2128 261
419 3300053177 Ga0500636_0003715 Ga0500636_0003715_3832_4698 261
420 3300002067 JGI24735J21928_10006905 JGI24735J21928_100069053 262
421 3300002067 JGI24735J21928_10016675 JGI24735J21928_100166752 262
422 3300005327 Ga0070658_10005279 Ga0070658_100052792 262
423 3300006358 Ga0068871_100281337 Ga0068871_1002813372 262
424 3300013297 Ga0157378_10318207 Ga0157378_103182072 262
425 3300025254 Ga0209148_1004174 Ga0209148_10041742 262
426 3300025904 Ga0207647_10092176 Ga0207647_100921762 262
427 3300037418 Ga0395900_0062831 Ga0395900_0062831_39_905 262
428 3300037418 Ga0395900_0096292 Ga0395900_0096292_177_1010 262
429 3300038443 Ga0395901_0200988 Ga0395901_0200988_225_1058 262
430 3300046519 Ga0495632_0000007 Ga0495632_0000007_272451_273293 262
431 3300046520 Ga0495637_0010641 Ga0495637_0010641_2210_3067 262
432 3300046522 Ga0495643_0000070 Ga0495643_0000070_168598_169455 262
433 3300046524 Ga0495648_0063847 Ga0495648_0063847_675_1532 262
434 3300046525 Ga0495663_0000005 Ga0495663_0000005_271470_272312 262
435 3300046558 Ga0495633_0002794 Ga0495633_0002794_4647_5504 262
436 3300046691 Ga0495670_0003777 Ga0495670_0003777_5742_6575 262
437 3300046692 Ga0495671_0000039 Ga0495671_0000039_1425_2282 262
438 3300047470 Ga0495681_0016351 Ga0495681_0016351_2314_3171 262
439 3300047472 Ga0495686_0039352 Ga0495686_0039352_848_1690 262
440 3300048925 Ga0496122_0102775 Ga0496122_0102775_604_1446 262
441 3300048927 Ga0496124_0043808 Ga0496124_0043808_2381_3232 262
442 3300053730 Ga0500645_026699 Ga0500645_026699_795_1676 262
443 3300055283 Ga0500661_000742 Ga0500661_000742_2135_2968 262
444 iso_pu_bacteria 2512564014 2512645470 262
445 iso_pu_bacteria 2582581305 2585263050 262
446 iso_pu_bacteria 2643221541 2643727545 262
447 iso_pu_bacteria 2643221605 2644037435 262
448 iso_pu_bacteria 2643221606 2644041295 262
449 iso_pu_bacteria 2643221671 2644394835 262
450 iso_pu_bacteria 2808606401 2809062566 262
451 iso_pu_bacteria 2808606404 2809078750 262
452 iso_pu_bacteria 2808606405 2809082955 262
453 iso_pu_bacteria 2880518877 2880521629 262
454 iso_pu_bacteria 2919709256 2919712115 262
455 iso_pu_bacteria 2928027323 2928028572 262
456 iso_pu_bacteria 2984555340 2984555851 262
457 iso_pu_bacteria 2984564862 2984566040 262
458 iso_pu_bacteria 2993356040 2993357051 262
459 iso_pu_bacteria 8057101203 8057105408 262
460 3300005327 Ga0070658_10021879 Ga0070658_100218793 263
461 3300005336 Ga0070680_100159289 Ga0070680_1001592893 263
462 3300005337 Ga0070682_100182143 Ga0070682_1001821432 263
463 3300005455 Ga0070663_100045051 Ga0070663_1000450513 263
464 3300005457 Ga0070662_100023112 Ga0070662_1000231125 263
465 3300005458 Ga0070681_10178316 Ga0070681_101783162 263
466 3300005548 Ga0070665_100000023 Ga0070665_100000023372 263
467 3300005564 Ga0070664_100010146 Ga0070664_1000101466 263
468 3300005618 Ga0068864_100000114 Ga0068864_10000011417 263
469 3300005719 Ga0068861_100273468 Ga0068861_1002734682 263
470 3300005834 Ga0068851_10039195 Ga0068851_100391953 263
471 3300005842 Ga0068858_100006035 Ga0068858_1000060357 263
472 3300005844 Ga0068862_100031816 Ga0068862_1000318163 263
473 3300009093 Ga0105240_10004567 Ga0105240_1000456714 263
474 3300009177 Ga0105248_10073612 Ga0105248_100736124 263
475 3300009553 Ga0105249_10125010 Ga0105249_101250102 263
476 3300010375 Ga0105239_10000461 Ga0105239_1000046155 263
477 3300013102 Ga0157371_10018089 Ga0157371_100180894 263
478 3300013102 Ga0157371_10039485 Ga0157371_100394853 263
479 3300013105 Ga0157369_10418832 Ga0157369_104188322 263
480 3300013306 Ga0163162_10151422 Ga0163162_101514223 263
481 3300025909 Ga0207705_10061000 Ga0207705_100610002 263
482 3300025913 Ga0207695_10001501 Ga0207695_1000150118 263
483 3300025919 Ga0207657_10005304 Ga0207657_100053048 263
484 3300025919 Ga0207657_10074431 Ga0207657_100744313 263
485 3300025921 Ga0207652_10369282 Ga0207652_103692822 263
486 3300025932 Ga0207690_10029358 Ga0207690_100293584 263
487 3300025933 Ga0207706_10036429 Ga0207706_100364293 263
488 3300025941 Ga0207711_10024879 Ga0207711_100248794 263
489 3300025961 Ga0207712_10103597 Ga0207712_101035972 263
490 3300026035 Ga0207703_10003498 Ga0207703_100034987 263
491 3300026067 Ga0207678_10015794 Ga0207678_100157947 263
492 3300026095 Ga0207676_10000723 Ga0207676_1000072310 263
493 3300026118 Ga0207675_100294562 Ga0207675_1002945622 263
494 3300028379 Ga0268266_10000002 Ga0268266_100000021109 263
495 3300028380 Ga0268265_10005705 Ga0268265_100057059 263
496 3300031911 Ga0307412_10001641 Ga0307412_100016418 263
497 3300031911 Ga0307412_10031478 Ga0307412_100314781 263
498 3300032002 Ga0307416_100144544 Ga0307416_1001445442 263
499 3300037312 Ga0395899_0029626 Ga0395899_0029626_2043_2879 263
500 3300037312 Ga0395899_0392378 Ga0395899_0392378_26_859 263
501 3300037418 Ga0395900_0012204 Ga0395900_0012204_2381_3217 263
502 3300037418 Ga0395900_0105344 Ga0395900_0105344_1434_2285 263
503 3300037418 Ga0395900_0109005 Ga0395900_0109005_1044_1880 263
504 3300037418 Ga0395900_0371191 Ga0395900_0371191_78_914 263
505 3300037466 Ga0395898_0034211 Ga0395898_0034211_1056_1892 263
506 3300037466 Ga0395898_0155038 Ga0395898_0155038_760_1611 263
507 3300037466 Ga0395898_0192783 Ga0395898_0192783_56_892 263
508 3300037471 Ga0395905_0045374 Ga0395905_0045374_2025_2867 263
509 3300037471 Ga0395905_0075641 Ga0395905_0075641_1518_2354 263
510 3300038443 Ga0395901_0065395 Ga0395901_0065395_1185_2021 263
511 3300038443 Ga0395901_0181149 Ga0395901_0181149_619_1470 263
512 3300038443 Ga0395901_0403970 Ga0395901_0403970_83_925 263
513 3300042006 Ga0439432_048699 Ga0439432_048699_470_1306 263
514 3300046809 Ga0495600_0007940 Ga0495600_0007940_1249_2082 263
515 3300047469 Ga0495673_0027126 Ga0495673_0027126_1068_1907 263
516 3300047472 Ga0495686_0000366 Ga0495686_0000366_12052_12891 263
517 3300047472 Ga0495686_0000430 Ga0495686_0000430_63353_64186 263
518 3300048921 Ga0496118_0127967 Ga0496118_0127967_95_928 263
519 3300048924 Ga0496121_0028750 Ga0496121_0028750_1468_2301 263
520 3300049570 Ga0501033_0022441 Ga0501033_0022441_1037_1876 263
521 3300049583 Ga0501067_0154404 Ga0501067_0154404_56_916 263
522 3300049663 Ga0501223_000039 Ga0501223_000039_31627_32469 263
523 3300049705 Ga0501225_0000010 Ga0501225_0000010_59388_60230 263
524 3300049705 Ga0501225_0022505 Ga0501225_0022505_203_1045 263
525 3300049823 Ga0501044_0050810 Ga0501044_0050810_2500_3339 263
526 3300053108 Ga0500562_013822 Ga0500562_013822_1110_1949 263
527 3300053119 Ga0500595_023151 Ga0500595_023151_116_949 263
528 3300053136 Ga0500559_0063063 Ga0500559_0063063_14_847 263
529 iso_pu_bacteria 2643221560 2643822192 263
530 iso_pu_bacteria 2643221563 2643833348 263
531 iso_pu_bacteria 2643221608 2644054275 263
532 3300001990 JGI24737J22298_10006518 JGI24737J22298_100065183 264
533 3300002067 JGI24735J21928_10001457 JGI24735J21928_100014577 264
534 3300005355 Ga0070671_100121806 Ga0070671_1001218063 264
535 3300005364 Ga0070673_100043642 Ga0070673_1000436424 264
536 3300025931 Ga0207644_10027862 Ga0207644_100278624 264
537 3300035725 Ga0373947_0053772 Ga0373947_0053772_500_1381 264
538 3300046520 Ga0495637_0061206 Ga0495637_0061206_550_1431 264
539 3300046542 Ga0495597_0010652 Ga0495597_0010652_2170_3051 264
540 3300046684 Ga0495669_0024586 Ga0495669_0024586_929_1810 264
541 3300048911 Ga0496108_0043425 Ga0496108_0043425_2103_2945 264
542 3300048912 Ga0496109_0104635 Ga0496109_0104635_1045_1887 264
543 3300048916 Ga0496113_0166502 Ga0496113_0166502_129_971 264
544 3300048920 Ga0496117_0201157 Ga0496117_0201157_14_877 264
545 3300048923 Ga0496120_0150982 Ga0496120_0150982_250_1113 264
546 3300048927 Ga0496124_0374694 Ga0496124_0374694_53_916 264
547 3300048928 Ga0496125_0015219 Ga0496125_0015219_4472_5314 264
548 3300048928 Ga0496125_0063100 Ga0496125_0063100_1480_2328 264
549 3300053087 Ga0500643_005562 Ga0500643_005562_3240_4091 264
550 3300053092 Ga0500583_0080149 Ga0500583_0080149_200_1081 264
551 3300053093 Ga0500651_0014272 Ga0500651_0014272_2861_3742 264
552 3300053096 Ga0500641_0025271 Ga0500641_0025271_103_984 264
553 3300053125 Ga0500618_012199 Ga0500618_012199_1130_2011 264
554 3300053130 Ga0500642_0003941 Ga0500642_0003941_2624_3505 264
555 3300053133 Ga0500655_000094 Ga0500655_000094_6771_7652 264
556 3300053148 Ga0500590_006053 Ga0500590_006053_417_1298 264
557 3300005618 Ga0068864_100289156 Ga0068864_1002891562 265
558 3300026095 Ga0207676_10142017 Ga0207676_101420173 265
559 3300041460 Ga0451802_1408326 Ga0451802_1408326_788_1639 265
560 3300053116 Ga0500592_001693 Ga0500592_001693_1756_2610 265
561 3300053139 Ga0500568_0047100 Ga0500568_0047100_173_1027 265
562 iso_pu_bacteria 2946787523 2946789583 265
563 iso_pu_bacteria 2775507255 2778125128 266
564 3300025904 Ga0207647_10091795 Ga0207647_100917953 268
565 3300049822 Ga0501035_0147740 Ga0501035_0147740_799_1662 268
566 3300001904 JGI24736J21556_1000173 JGI24736J21556_10001737 270
567 3300001915 JGI24741J21665_1000026 JGI24741J21665_100002613 270
568 3300001979 JGI24740J21852_10001292 JGI24740J21852_100012925 270
569 3300001989 JGI24739J22299_10001495 JGI24739J22299_100014956 270
570 3300002067 JGI24735J21928_10001790 JGI24735J21928_100017907 270
571 3300002075 JGI24738J21930_10001463 JGI24738J21930_100014634 270
572 3300005327 Ga0070658_10033836 Ga0070658_100338362 270
573 3300005455 Ga0070663_100004887 Ga0070663_1000048879 270
574 3300005457 Ga0070662_100446875 Ga0070662_1004468751 270
575 3300005563 Ga0068855_100147492 Ga0068855_1001474922 270
576 3300005614 Ga0068856_100023313 Ga0068856_1000233132 270
577 3300009174 Ga0105241_10001330 Ga0105241_1000133010 270
578 3300009545 Ga0105237_10005899 Ga0105237_100058992 270
579 3300010375 Ga0105239_10138533 Ga0105239_101385334 270
580 3300013100 Ga0157373_10151575 Ga0157373_101515752 270
581 3300013104 Ga0157370_10018262 Ga0157370_100182622 270
582 3300013105 Ga0157369_10480859 Ga0157369_104808592 270
583 3300025321 Ga0207656_10007853 Ga0207656_100078534 270
584 3300025904 Ga0207647_10001988 Ga0207647_1000198816 270
585 3300025909 Ga0207705_10208736 Ga0207705_102087362 270
586 3300025913 Ga0207695_10046884 Ga0207695_100468845 270
587 3300025914 Ga0207671_10029820 Ga0207671_100298205 270
588 3300025924 Ga0207694_10037902 Ga0207694_100379022 270
589 3300025932 Ga0207690_10013320 Ga0207690_100133202 270
590 3300025945 Ga0207679_10139324 Ga0207679_101393242 270
591 3300026041 Ga0207639_10000252 Ga0207639_1000025235 270
592 3300026067 Ga0207678_10000857 Ga0207678_100008576 270
593 3300026078 Ga0207702_10005818 Ga0207702_1000581811 270
594 3300031824 Ga0307413_10262998 Ga0307413_102629982 270
595 3300053724 Ga0500570_000135 Ga0500570_000135_11191_12135 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23016

RsmI_C

RsmI C-terminal HTH domain

266

311

0.97

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

43

242

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fq6-assembly1.cif.gz_A the crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi 0.915 111 221
3ffy-assembly1.cif.gz_A-2 putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis. 0.9125 111 219
3fq6-assembly1.cif.gz_A the crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi 0.8847 111 221
3ffy-assembly1.cif.gz_A-2 putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis. 0.8818 111 219
3kwp-assembly1.cif.gz_A-2 crystal structure of putative methyltransferase from lactobacillus brevis 0.8803 16 221
ID Description Score Start End Superfamily
af_Q338C6_169_282_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9609 109 219 3.30.950.10
3kwpA02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9542 108 221 3.30.950.10
5hw4C02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9414 108 218 3.30.950.10
af_Q338C6_169_282_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9285 109 219 3.30.950.10
af_P9WGW7_115_230_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9254 108 226 3.30.950.10
ID Description Score Start End GO Terms
AF-K2DCQ5-F1-model_v4 Tetrapyrrole methylase family protein 0.9596 117 221 GO:0008168
GO:0032259
AF-A0A258BUN3-F1-model_v4 rRNA (Cytidine-2'-O-)-methyltransferase 0.9528 8 95 GO:0008168
GO:0032259
AF-X1SAQ7-F1-model_v4 Tetrapyrrole methylase domain-containing protein 0.9492 102 222 GO:0005737
GO:0006364
GO:0008168
AF-A0A2M7E8N8-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9446 120 221 GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A258BUN3-F1-model_v4 rRNA (Cytidine-2'-O-)-methyltransferase 0.9423 8 95 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
85.77 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map