F467496
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 595 | 302 | 558 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300053724|Ga0500570_000135|Ga0500570_000135_11191_12135 |
| Length | 314 |
| Sequence | MPEYLSNRLPAPGSLCHEHHPMNDLIETDVPDDLXXXAPLPPGLYIVATPIGNLGDLSPRAASILSRVETIAVEDSRVTAKLLHRIGVKRAMTPYHDHNADKVRPGLIERMGRSAVALVSDAGTPRISDPGYKLVRDARAAGHAVTTIPGPCAAIAALTLAGLPTDRFFFLGFLPSKEKARADTIAEVAAIRATLIFYESGPRLGAMLAALHDGLGDRDAAVVREITKTYEEAVTGTLSALAERYAEQGPKGEIVVVVGPPGEAPVASAADADALLIEALKRLPAARAASEVAKATGLPRRDLYVRATALKGEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 6 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 7 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 8 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 9 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 10 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 11 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 12 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 13 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 14 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 15 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 16 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 17 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 18 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 19 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 20 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 21 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 22 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 23 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 24 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 25 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 26 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 27 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 28 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 29 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 30 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 31 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 32 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 33 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 34 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 35 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 36 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 37 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 38 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 39 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 40 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 41 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 42 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 43 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 44 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 45 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 46 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 47 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 48 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 55 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 62 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 164 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 185 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 186 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 187 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 188 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 189 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 192 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 267 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 270 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 271 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 274 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 275 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 281 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 282 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 284 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 285 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 287 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 289 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 291 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 292 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 296 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 297 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 300 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 301 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 302 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.45 |
| Metatranscriptomes | 0.34 |
| Isolates | 6.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.84 |
| Bulb | 0 |
| Endosphere | 8.91 |
| Nodule | 0 |
| Rhizoplane | 3.36 |
| Rhizosphere | 75.63 |
| Stem | 0 |
| Stem Tuber | 0.17 |
| Unclassified | 11.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000173 | 3300001904 | Bacteria | 11479 |
| 2 | JGI24741J21665_1000026 | 3300001915 | Bacteria | 35267 |
| 3 | JGI24741J21665_1000724 | 3300001915 | Bacteria | 9929 |
| 4 | JGI24740J21852_10001292 | 3300001979 | Bacteria | 11377 |
| 5 | JGI24739J22299_10001495 | 3300001989 | Bacteria | 8828 |
| 6 | JGI24739J22299_10003988 | 3300001989 | Bacteria | 5651 |
| 7 | JGI24737J22298_10002224 | 3300001990 | Bacteria | 6918 |
| 8 | JGI24737J22298_10006518 | 3300001990 | Bacteria | 3984 |
| 9 | JGI24737J22298_10052684 | 3300001990 | Bacteria | 1233 |
| 10 | JGI24735J21928_10001457 | 3300002067 | Bacteria | 8363 |
| 11 | JGI24735J21928_10001790 | 3300002067 | Bacteria | 7539 |
| 12 | JGI24735J21928_10006905 | 3300002067 | Bacteria | 3718 |
| 13 | JGI24735J21928_10016675 | 3300002067 | Bacteria | 2275 |
| 14 | JGI24738J21930_10001463 | 3300002075 | Bacteria | 6561 |
| 15 | JGI24738J21930_10007207 | 3300002075 | Bacteria | 2576 |
| 16 | JGI24749J21850_1000934 | 3300002076 | Bacteria | 4165 |
| 17 | JGI24751J29686_10000055 | 3300002459 | Bacteria | 64731 |
| 18 | JGI25153J46596_10000070 | 3300003215 | Bacteria | 117125 |
| 19 | rootH2_10095765 | 3300003320 | Bacteria | 4118 |
| 20 | rootL2_10377998 | 3300003322 | Bacteria | 1657 |
| 21 | Ga0055542_1000040 | 3300003762 | Bacteria | 214035 |
| 22 | Ga0055529_1000037 | 3300003763 | Bacteria | 237307 |
| 23 | Ga0055530_10000131 | 3300003791 | Bacteria | 65535 |
| 24 | Ga0055531_10000514 | 3300003794 | Bacteria | 34947 |
| 25 | JGI25405J52794_10007325 | 3300003911 | Bacteria | 2034 |
| 26 | Ga0065165_1047593 | 3300005262 | Bacteria | 1237 |
| 27 | Ga0065707_10086768 | 3300005295 | Bacteria | 5313 |
| 28 | Ga0070658_10000281 | 3300005327 | Bacteria | 44679 |
| 29 | Ga0070658_10002876 | 3300005327 | Bacteria | 14299 |
| 30 | Ga0070658_10005279 | 3300005327 | Bacteria | 10493 |
| 31 | Ga0070658_10021879 | 3300005327 | Bacteria | 5127 |
| 32 | Ga0070658_10033836 | 3300005327 | Bacteria | 4112 |
| 33 | Ga0070676_10024614 | 3300005328 | Bacteria | 3393 |
| 34 | Ga0070670_100000082 | 3300005331 | Bacteria | 91524 |
| 35 | Ga0070670_100006073 | 3300005331 | Bacteria | 10216 |
| 36 | Ga0070670_100192447 | 3300005331 | Bacteria | 1772 |
| 37 | Ga0070680_100159289 | 3300005336 | Bacteria | 1896 |
| 38 | Ga0070682_100182143 | 3300005337 | Bacteria | 1468 |
| 39 | Ga0068868_100018436 | 3300005338 | Bacteria | 5219 |
| 40 | Ga0068868_100227642 | 3300005338 | Bacteria | 1563 |
| 41 | Ga0070660_100110087 | 3300005339 | Bacteria | 2190 |
| 42 | Ga0070660_100129524 | 3300005339 | Bacteria | 2018 |
| 43 | Ga0070661_100001799 | 3300005344 | Bacteria | 14873 |
| 44 | Ga0070661_100049038 | 3300005344 | Bacteria | 3092 |
| 45 | Ga0070661_100051672 | 3300005344 | Bacteria | 3008 |
| 46 | Ga0070661_100185058 | 3300005344 | Bacteria | 1586 |
| 47 | Ga0070661_100216754 | 3300005344 | Bacteria | 1467 |
| 48 | Ga0070668_100000239 | 3300005347 | Bacteria | 36109 |
| 49 | Ga0070668_100017003 | 3300005347 | Bacteria | 5441 |
| 50 | Ga0070668_100025389 | 3300005347 | Bacteria | 4492 |
| 51 | Ga0070669_100000015 | 3300005353 | Bacteria | 197597 |
| 52 | Ga0070669_100362367 | 3300005353 | Bacteria | 1179 |
| 53 | Ga0070671_100001987 | 3300005355 | Bacteria | 15701 |
| 54 | Ga0070671_100121806 | 3300005355 | Bacteria | 2195 |
| 55 | Ga0070674_100415816 | 3300005356 | Bacteria | 1102 |
| 56 | Ga0070673_100043642 | 3300005364 | Bacteria | 3466 |
| 57 | Ga0070659_100015172 | 3300005366 | Bacteria | 5764 |
| 58 | Ga0070659_100149661 | 3300005366 | Bacteria | 1903 |
| 59 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 60 | Ga0070667_100000302 | 3300005367 | Bacteria | 55150 |
| 61 | Ga0070667_100013773 | 3300005367 | Bacteria | 6685 |
| 62 | Ga0070667_100087970 | 3300005367 | Bacteria | 2667 |
| 63 | Ga0070663_100004887 | 3300005455 | Bacteria | 7911 |
| 64 | Ga0070663_100006789 | 3300005455 | Bacteria | 6915 |
| 65 | Ga0070663_100045051 | 3300005455 | Bacteria | 3114 |
| 66 | Ga0070663_100100815 | 3300005455 | Bacteria | 2154 |
| 67 | Ga0070663_100279726 | 3300005455 | Bacteria | 1329 |
| 68 | Ga0070678_100000147 | 3300005456 | Bacteria | 29187 |
| 69 | Ga0070678_100567895 | 3300005456 | Bacteria | 1009 |
| 70 | Ga0070662_100010572 | 3300005457 | Bacteria | 6065 |
| 71 | Ga0070662_100023112 | 3300005457 | Bacteria | 4267 |
| 72 | Ga0070662_100446875 | 3300005457 | Bacteria | 1072 |
| 73 | Ga0070681_10060953 | 3300005458 | Bacteria | 3749 |
| 74 | Ga0070681_10178316 | 3300005458 | Bacteria | 2046 |
| 75 | Ga0068853_100018116 | 3300005539 | Bacteria | 5823 |
| 76 | Ga0070665_100000023 | 3300005548 | Bacteria | 375278 |
| 77 | Ga0070665_100037912 | 3300005548 | Bacteria | 4845 |
| 78 | Ga0068855_100056357 | 3300005563 | Bacteria | 4612 |
| 79 | Ga0068855_100084253 | 3300005563 | Bacteria | 3681 |
| 80 | Ga0068855_100147492 | 3300005563 | Bacteria | 2677 |
| 81 | Ga0070664_100010146 | 3300005564 | Bacteria | 7637 |
| 82 | Ga0070664_100027450 | 3300005564 | Bacteria | 4731 |
| 83 | Ga0070664_100267051 | 3300005564 | Bacteria | 1540 |
| 84 | Ga0068857_100066462 | 3300005577 | Bacteria | 3208 |
| 85 | Ga0068857_100084926 | 3300005577 | Bacteria | 2829 |
| 86 | Ga0068854_100010580 | 3300005578 | Bacteria | 5986 |
| 87 | Ga0068854_100044961 | 3300005578 | Bacteria | 3137 |
| 88 | Ga0068856_100023313 | 3300005614 | Bacteria | 6018 |
| 89 | Ga0068856_100046685 | 3300005614 | Bacteria | 4265 |
| 90 | Ga0068856_100062368 | 3300005614 | Bacteria | 3682 |
| 91 | Ga0068859_100039142 | 3300005617 | Bacteria | 4756 |
| 92 | Ga0068859_100057802 | 3300005617 | Bacteria | 3907 |
| 93 | Ga0068859_100722376 | 3300005617 | Bacteria | 1086 |
| 94 | Ga0068864_100000114 | 3300005618 | Bacteria | 79636 |
| 95 | Ga0068864_100000177 | 3300005618 | Bacteria | 58504 |
| 96 | Ga0068864_100017243 | 3300005618 | Bacteria | 6022 |
| 97 | Ga0068864_100289156 | 3300005618 | Bacteria | 1532 |
| 98 | Ga0068861_100001270 | 3300005719 | Bacteria | 15759 |
| 99 | Ga0068861_100273468 | 3300005719 | Bacteria | 1451 |
| 100 | Ga0068851_10001318 | 3300005834 | Bacteria | 10811 |
| 101 | Ga0068851_10039195 | 3300005834 | Bacteria | 2379 |
| 102 | Ga0068851_10064305 | 3300005834 | Bacteria | 1885 |
| 103 | Ga0068863_100002334 | 3300005841 | Bacteria | 18851 |
| 104 | Ga0068858_100000897 | 3300005842 | Bacteria | 30873 |
| 105 | Ga0068858_100006035 | 3300005842 | Bacteria | 11808 |
| 106 | Ga0068858_100584775 | 3300005842 | Bacteria | 1082 |
| 107 | Ga0068860_100000068 | 3300005843 | Bacteria | 179208 |
| 108 | Ga0068860_100000416 | 3300005843 | Bacteria | 55156 |
| 109 | Ga0068862_100000006 | 3300005844 | Bacteria | 346828 |
| 110 | Ga0068862_100000085 | 3300005844 | Bacteria | 110879 |
| 111 | Ga0068862_100001068 | 3300005844 | Bacteria | 26256 |
| 112 | Ga0068862_100007732 | 3300005844 | Bacteria | 8890 |
| 113 | Ga0068862_100031816 | 3300005844 | Bacteria | 4456 |
| 114 | Ga0081455_10000215 | 3300005937 | Bacteria | 73808 |
| 115 | Ga0075369_10060962 | 3300006186 | Bacteria | 1646 |
| 116 | Ga0075366_10068079 | 3300006195 | Bacteria | 2119 |
| 117 | Ga0068871_100281337 | 3300006358 | Bacteria | 1455 |
| 118 | Ga0075430_100121363 | 3300006846 | Bacteria | 2179 |
| 119 | Ga0075429_100075740 | 3300006880 | Bacteria | 2931 |
| 120 | Ga0097620_100039143 | 3300006931 | Bacteria | 4756 |
| 121 | Ga0097620_100057801 | 3300006931 | Bacteria | 3907 |
| 122 | Ga0097620_100722312 | 3300006931 | Bacteria | 1086 |
| 123 | Ga0105240_10004567 | 3300009093 | Bacteria | 20996 |
| 124 | Ga0105243_10000990 | 3300009148 | Bacteria | 26409 |
| 125 | Ga0105241_10001330 | 3300009174 | Bacteria | 18768 |
| 126 | Ga0105241_10016301 | 3300009174 | Bacteria | 5446 |
| 127 | Ga0105248_10000066 | 3300009177 | Bacteria | 121254 |
| 128 | Ga0105248_10073612 | 3300009177 | Bacteria | 3839 |
| 129 | Ga0105248_10210064 | 3300009177 | Bacteria | 2193 |
| 130 | Ga0105237_10005899 | 3300009545 | Bacteria | 13731 |
| 131 | Ga0105237_10017495 | 3300009545 | Bacteria | 7429 |
| 132 | Ga0105237_10097523 | 3300009545 | Bacteria | 2930 |
| 133 | Ga0105238_10012734 | 3300009551 | Bacteria | 8490 |
| 134 | Ga0105238_10188370 | 3300009551 | Bacteria | 2040 |
| 135 | Ga0105249_10000038 | 3300009553 | Bacteria | 196425 |
| 136 | Ga0105249_10125010 | 3300009553 | Bacteria | 2448 |
| 137 | Ga0105239_10000461 | 3300010375 | Bacteria | 59449 |
| 138 | Ga0105239_10138533 | 3300010375 | Bacteria | 2710 |
| 139 | Ga0157326_1000962 | 3300012513 | Bacteria | 3268 |
| 140 | Ga0157373_10151575 | 3300013100 | Bacteria | 1631 |
| 141 | Ga0157373_10175635 | 3300013100 | Bacteria | 1507 |
| 142 | Ga0157373_10195237 | 3300013100 | Bacteria | 1427 |
| 143 | Ga0157371_10000747 | 3300013102 | Bacteria | 37686 |
| 144 | Ga0157371_10018089 | 3300013102 | Bacteria | 5218 |
| 145 | Ga0157371_10039485 | 3300013102 | Bacteria | 3375 |
| 146 | Ga0157370_10018262 | 3300013104 | Bacteria | 7054 |
| 147 | Ga0157370_10255949 | 3300013104 | Bacteria | 1619 |
| 148 | Ga0157369_10129064 | 3300013105 | Bacteria | 2680 |
| 149 | Ga0157369_10418832 | 3300013105 | Bacteria | 1388 |
| 150 | Ga0157369_10480859 | 3300013105 | Bacteria | 1285 |
| 151 | Ga0157374_10033403 | 3300013296 | Bacteria | 4694 |
| 152 | Ga0157374_10181585 | 3300013296 | Bacteria | 2055 |
| 153 | Ga0157374_10819410 | 3300013296 | Bacteria | 947 |
| 154 | Ga0157378_10028808 | 3300013297 | Bacteria | 4902 |
| 155 | Ga0157378_10318207 | 3300013297 | Bacteria | 1511 |
| 156 | Ga0163162_10151422 | 3300013306 | Bacteria | 2437 |
| 157 | Ga0157372_10213884 | 3300013307 | Bacteria | 2234 |
| 158 | Ga0157380_10000114 | 3300014326 | Bacteria | 44326 |
| 159 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 160 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 161 | Ga0207425_1035154 | 3300025245 | Bacteria | 979 |
| 162 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 163 | Ga0209148_1004174 | 3300025254 | Bacteria | 3631 |
| 164 | Ga0209233_1011300 | 3300025261 | Bacteria | 2635 |
| 165 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 166 | Ga0209455_1006523 | 3300025272 | Bacteria | 3430 |
| 167 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 168 | Ga0209758_1023592 | 3300025297 | Bacteria | 2776 |
| 169 | Ga0209050_1000347 | 3300025298 | Bacteria | 90767 |
| 170 | Ga0209257_1000371 | 3300025304 | Bacteria | 90767 |
| 171 | Ga0209257_1005932 | 3300025304 | Bacteria | 8214 |
| 172 | Ga0207656_10007853 | 3300025321 | Bacteria | 3906 |
| 173 | Ga0207656_10014475 | 3300025321 | Bacteria | 3039 |
| 174 | Ga0207656_10017108 | 3300025321 | Bacteria | 2835 |
| 175 | Ga0207647_10001988 | 3300025904 | Bacteria | 15633 |
| 176 | Ga0207647_10091795 | 3300025904 | Bacteria | 1811 |
| 177 | Ga0207647_10092176 | 3300025904 | Bacteria | 1806 |
| 178 | Ga0207645_10031970 | 3300025907 | Bacteria | 3384 |
| 179 | Ga0207705_10000022 | 3300025909 | Bacteria | 302232 |
| 180 | Ga0207705_10000319 | 3300025909 | Bacteria | 43949 |
| 181 | Ga0207705_10061000 | 3300025909 | Bacteria | 2724 |
| 182 | Ga0207705_10208736 | 3300025909 | Bacteria | 1481 |
| 183 | Ga0207654_10001234 | 3300025911 | Bacteria | 13658 |
| 184 | Ga0207695_10001501 | 3300025913 | Bacteria | 38827 |
| 185 | Ga0207695_10046884 | 3300025913 | Bacteria | 4578 |
| 186 | Ga0207695_10048566 | 3300025913 | Bacteria | 4481 |
| 187 | Ga0207671_10009474 | 3300025914 | Bacteria | 8135 |
| 188 | Ga0207671_10015329 | 3300025914 | Bacteria | 6007 |
| 189 | Ga0207671_10029820 | 3300025914 | Bacteria | 4072 |
| 190 | Ga0207657_10002244 | 3300025919 | Bacteria | 20950 |
| 191 | Ga0207657_10005304 | 3300025919 | Bacteria | 13508 |
| 192 | Ga0207657_10009148 | 3300025919 | Bacteria | 9996 |
| 193 | Ga0207657_10012074 | 3300025919 | Bacteria | 8542 |
| 194 | Ga0207657_10074431 | 3300025919 | Bacteria | 2868 |
| 195 | Ga0207649_10001413 | 3300025920 | Bacteria | 14200 |
| 196 | Ga0207649_10017406 | 3300025920 | Bacteria | 4072 |
| 197 | Ga0207649_10058862 | 3300025920 | Bacteria | 2408 |
| 198 | Ga0207649_10074293 | 3300025920 | Bacteria | 2181 |
| 199 | Ga0207649_10093736 | 3300025920 | Bacteria | 1971 |
| 200 | Ga0207652_10369282 | 3300025921 | Bacteria | 1295 |
| 201 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 202 | Ga0207681_10230780 | 3300025923 | Bacteria | 1436 |
| 203 | Ga0207681_10448003 | 3300025923 | Bacteria | 1050 |
| 204 | Ga0207694_10013185 | 3300025924 | Bacteria | 6222 |
| 205 | Ga0207694_10037902 | 3300025924 | Bacteria | 3705 |
| 206 | Ga0207650_10000050 | 3300025925 | Bacteria | 169589 |
| 207 | Ga0207650_10198717 | 3300025925 | Bacteria | 1605 |
| 208 | Ga0207644_10000836 | 3300025931 | Bacteria | 19551 |
| 209 | Ga0207644_10027862 | 3300025931 | Bacteria | 3905 |
| 210 | Ga0207690_10000511 | 3300025932 | Bacteria | 25174 |
| 211 | Ga0207690_10013320 | 3300025932 | Bacteria | 4939 |
| 212 | Ga0207690_10029358 | 3300025932 | Bacteria | 3495 |
| 213 | Ga0207690_10101618 | 3300025932 | Bacteria | 2054 |
| 214 | Ga0207690_10112872 | 3300025932 | Bacteria | 1960 |
| 215 | Ga0207706_10010249 | 3300025933 | Bacteria | 8570 |
| 216 | Ga0207706_10010971 | 3300025933 | Bacteria | 8262 |
| 217 | Ga0207706_10024099 | 3300025933 | Bacteria | 5458 |
| 218 | Ga0207706_10036429 | 3300025933 | Bacteria | 4370 |
| 219 | Ga0207706_10115900 | 3300025933 | Bacteria | 2356 |
| 220 | Ga0207709_10000039 | 3300025935 | Bacteria | 260127 |
| 221 | Ga0207669_10000076 | 3300025937 | Bacteria | 50334 |
| 222 | Ga0207669_10318539 | 3300025937 | Bacteria | 1189 |
| 223 | Ga0207711_10000317 | 3300025941 | Bacteria | 51561 |
| 224 | Ga0207711_10024879 | 3300025941 | Bacteria | 5023 |
| 225 | Ga0207679_10139324 | 3300025945 | Bacteria | 1959 |
| 226 | Ga0207679_10333986 | 3300025945 | Bacteria | 1316 |
| 227 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 228 | Ga0207667_10047515 | 3300025949 | Bacteria | 4542 |
| 229 | Ga0207667_10136055 | 3300025949 | Bacteria | 2530 |
| 230 | Ga0207667_10179290 | 3300025949 | Bacteria | 2176 |
| 231 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 232 | Ga0207712_10103597 | 3300025961 | Bacteria | 2120 |
| 233 | Ga0207668_10000045 | 3300025972 | Bacteria | 103160 |
| 234 | Ga0207668_10004682 | 3300025972 | Bacteria | 8051 |
| 235 | Ga0207668_10190457 | 3300025972 | Bacteria | 1625 |
| 236 | Ga0207640_10006816 | 3300025981 | Bacteria | 6282 |
| 237 | Ga0207640_10019101 | 3300025981 | Bacteria | 4042 |
| 238 | Ga0207640_10019501 | 3300025981 | Bacteria | 4008 |
| 239 | Ga0207640_10114024 | 3300025981 | Bacteria | 1922 |
| 240 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 241 | Ga0207658_10000263 | 3300025986 | Bacteria | 55175 |
| 242 | Ga0207658_10008852 | 3300025986 | Bacteria | 6831 |
| 243 | Ga0207658_10046286 | 3300025986 | Bacteria | 3176 |
| 244 | Ga0207658_10212603 | 3300025986 | Bacteria | 1622 |
| 245 | Ga0207677_10077077 | 3300026023 | Bacteria | 2376 |
| 246 | Ga0207703_10000483 | 3300026035 | Bacteria | 41615 |
| 247 | Ga0207703_10003498 | 3300026035 | Bacteria | 13135 |
| 248 | Ga0207639_10000252 | 3300026041 | Bacteria | 39391 |
| 249 | Ga0207639_10001496 | 3300026041 | Bacteria | 15730 |
| 250 | Ga0207639_10006688 | 3300026041 | Bacteria | 7841 |
| 251 | Ga0207639_10067025 | 3300026041 | Bacteria | 2792 |
| 252 | Ga0207639_10216638 | 3300026041 | Bacteria | 1651 |
| 253 | Ga0207678_10000857 | 3300026067 | Bacteria | 27922 |
| 254 | Ga0207678_10004587 | 3300026067 | Bacteria | 12421 |
| 255 | Ga0207678_10008946 | 3300026067 | Bacteria | 8818 |
| 256 | Ga0207678_10015794 | 3300026067 | Bacteria | 6637 |
| 257 | Ga0207678_10027339 | 3300026067 | Bacteria | 4975 |
| 258 | Ga0207702_10002982 | 3300026078 | Bacteria | 15760 |
| 259 | Ga0207702_10005818 | 3300026078 | Bacteria | 10724 |
| 260 | Ga0207702_10033026 | 3300026078 | Bacteria | 4320 |
| 261 | Ga0207702_10034073 | 3300026078 | Bacteria | 4255 |
| 262 | Ga0207702_10777493 | 3300026078 | Bacteria | 946 |
| 263 | Ga0207641_10000944 | 3300026088 | Bacteria | 29967 |
| 264 | Ga0207641_10001679 | 3300026088 | Bacteria | 21542 |
| 265 | Ga0207641_10004405 | 3300026088 | Bacteria | 12201 |
| 266 | Ga0207641_10004428 | 3300026088 | Bacteria | 12170 |
| 267 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 268 | Ga0207676_10000723 | 3300026095 | Bacteria | 25873 |
| 269 | Ga0207676_10000895 | 3300026095 | Bacteria | 23119 |
| 270 | Ga0207676_10142017 | 3300026095 | Bacteria | 2057 |
| 271 | Ga0207674_10011507 | 3300026116 | Bacteria | 9939 |
| 272 | Ga0207674_10014177 | 3300026116 | Bacteria | 8811 |
| 273 | Ga0207674_10020781 | 3300026116 | Bacteria | 7085 |
| 274 | Ga0207674_10025014 | 3300026116 | Bacteria | 6373 |
| 275 | Ga0207674_10037637 | 3300026116 | Bacteria | 5029 |
| 276 | Ga0207674_10512697 | 3300026116 | Bacteria | 1158 |
| 277 | Ga0207675_100001609 | 3300026118 | Bacteria | 22629 |
| 278 | Ga0207675_100294562 | 3300026118 | Bacteria | 1579 |
| 279 | Ga0207683_10000715 | 3300026121 | Bacteria | 30136 |
| 280 | Ga0207698_10018012 | 3300026142 | Bacteria | 4803 |
| 281 | Ga0207698_10160685 | 3300026142 | Bacteria | 1964 |
| 282 | Ga0207698_10255564 | 3300026142 | Bacteria | 1606 |
| 283 | Ga0207698_10420011 | 3300026142 | Bacteria | 1283 |
| 284 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 285 | Ga0268266_10038407 | 3300028379 | Bacteria | 4076 |
| 286 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 287 | Ga0268265_10000104 | 3300028380 | Bacteria | 105776 |
| 288 | Ga0268265_10000946 | 3300028380 | Bacteria | 26688 |
| 289 | Ga0268265_10005705 | 3300028380 | Bacteria | 8501 |
| 290 | Ga0268265_10024259 | 3300028380 | Bacteria | 4289 |
| 291 | Ga0268264_10000103 | 3300028381 | Bacteria | 222439 |
| 292 | Ga0268264_10000184 | 3300028381 | Bacteria | 131402 |
| 293 | Ga0268264_10001970 | 3300028381 | Bacteria | 18446 |
| 294 | Ga0307517_10035942 | 3300028786 | Bacteria | 5590 |
| 295 | Ga0265770_1001694 | 3300030878 | Bacteria | 3020 |
| 296 | Ga0265760_10001598 | 3300031090 | Bacteria | 6665 |
| 297 | Ga0307513_10066112 | 3300031456 | Bacteria | 3801 |
| 298 | Ga0307513_10076622 | 3300031456 | Bacteria | 3467 |
| 299 | Ga0307513_10161811 | 3300031456 | Bacteria | 2130 |
| 300 | Ga0307508_10003330 | 3300031616 | Bacteria | 16325 |
| 301 | Ga0307405_10005258 | 3300031731 | Bacteria | 6222 |
| 302 | Ga0307405_10031119 | 3300031731 | Bacteria | 3137 |
| 303 | Ga0307405_10032751 | 3300031731 | Bacteria | 3075 |
| 304 | Ga0307405_10044668 | 3300031731 | Bacteria | 2711 |
| 305 | Ga0307405_10189704 | 3300031731 | Bacteria | 1483 |
| 306 | Ga0307413_10010036 | 3300031824 | Bacteria | 4566 |
| 307 | Ga0307413_10262998 | 3300031824 | Bacteria | 1287 |
| 308 | Ga0307412_10000220 | 3300031911 | Bacteria | 38370 |
| 309 | Ga0307412_10001641 | 3300031911 | Bacteria | 12348 |
| 310 | Ga0307412_10012894 | 3300031911 | Bacteria | 4884 |
| 311 | Ga0307412_10031478 | 3300031911 | Bacteria | 3351 |
| 312 | Ga0307412_10124580 | 3300031911 | Bacteria | 1861 |
| 313 | Ga0307409_100238632 | 3300031995 | Bacteria | 1653 |
| 314 | Ga0307416_100013238 | 3300032002 | Bacteria | 5599 |
| 315 | Ga0307416_100062443 | 3300032002 | Bacteria | 3046 |
| 316 | Ga0307416_100144544 | 3300032002 | Bacteria | 2169 |
| 317 | Ga0307414_10000420 | 3300032004 | Bacteria | 22862 |
| 318 | Ga0307415_100409527 | 3300032126 | Bacteria | 1160 |
| 319 | Ga0307510_10007125 | 3300033180 | Bacteria | 13314 |
| 320 | Ga0307510_10134865 | 3300033180 | Bacteria | 2130 |
| 321 | Ga0373947_0053772 | 3300035725 | Bacteria | 2429 |
| 322 | Ga0395899_0029626 | 3300037312 | Bacteria | 4117 |
| 323 | Ga0395899_0392378 | 3300037312 | Bacteria | 920 |
| 324 | Ga0395900_0007250 | 3300037418 | Bacteria | 11480 |
| 325 | Ga0395900_0012204 | 3300037418 | Bacteria | 8782 |
| 326 | Ga0395900_0062831 | 3300037418 | Bacteria | 3817 |
| 327 | Ga0395900_0096292 | 3300037418 | Bacteria | 3041 |
| 328 | Ga0395900_0105344 | 3300037418 | Bacteria | 2897 |
| 329 | Ga0395900_0109005 | 3300037418 | Bacteria | 2845 |
| 330 | Ga0395900_0220584 | 3300037418 | Bacteria | 1911 |
| 331 | Ga0395900_0371191 | 3300037418 | Bacteria | 1400 |
| 332 | Ga0395898_0034211 | 3300037466 | Bacteria | 5066 |
| 333 | Ga0395898_0155038 | 3300037466 | Bacteria | 2191 |
| 334 | Ga0395898_0192783 | 3300037466 | Bacteria | 1947 |
| 335 | Ga0395905_0045374 | 3300037471 | Bacteria | 4122 |
| 336 | Ga0395905_0074027 | 3300037471 | Bacteria | 3192 |
| 337 | Ga0395905_0075641 | 3300037471 | Bacteria | 3156 |
| 338 | Ga0395901_0000241 | 3300038443 | Bacteria | 68503 |
| 339 | Ga0395901_0065395 | 3300038443 | Bacteria | 3786 |
| 340 | Ga0395901_0181149 | 3300038443 | Bacteria | 2210 |
| 341 | Ga0395901_0200988 | 3300038443 | Bacteria | 2089 |
| 342 | Ga0395901_0403970 | 3300038443 | Bacteria | 1403 |
| 343 | Ga0436365_0352550 | 3300039437 | Bacteria | 74350 |
| 344 | Ga0436362_0451893 | 3300039453 | Bacteria | 163419 |
| 345 | Ga0439465_0004583 | 3300041413 | Bacteria | 4462 |
| 346 | Ga0451802_1408326 | 3300041460 | Bacteria | 1690 |
| 347 | Ga0439445_0045670 | 3300042004 | Bacteria | 1172 |
| 348 | Ga0439448_0000532 | 3300042005 | Bacteria | 8847 |
| 349 | Ga0439432_048699 | 3300042006 | Bacteria | 1326 |
| 350 | Ga0439446_0010748 | 3300042156 | Bacteria | 2472 |
| 351 | Ga0451577_0082626 | 3300042876 | Bacteria | 2865 |
| 352 | Ga0466973_0105572 | 3300044659 | Bacteria | 2374 |
| 353 | Ga0453683_0031873 | 3300044673 | Bacteria | 3328 |
| 354 | Ga0466966_0000007 | 3300044684 | Bacteria | 155702 |
| 355 | Ga0466966_0130795 | 3300044684 | Bacteria | 1537 |
| 356 | Ga0466961_0058770 | 3300044693 | Bacteria | 2446 |
| 357 | Ga0466961_0181099 | 3300044693 | Bacteria | 1308 |
| 358 | Ga0466963_0019639 | 3300044694 | Bacteria | 4241 |
| 359 | Ga0466963_0023290 | 3300044694 | Bacteria | 3930 |
| 360 | Ga0466957_0166316 | 3300044842 | Bacteria | 1435 |
| 361 | Ga0466960_0304674 | 3300044901 | Bacteria | 899 |
| 362 | Ga0466959_0096352 | 3300045049 | Bacteria | 2121 |
| 363 | Ga0451576_0008370 | 3300045051 | Bacteria | 12145 |
| 364 | Ga0466958_0121513 | 3300045836 | Bacteria | 1635 |
| 365 | Ga0466967_0079802 | 3300045976 | Bacteria | 2951 |
| 366 | Ga0466967_0207440 | 3300045976 | Bacteria | 1858 |
| 367 | Ga0495627_038549 | 3300046453 | Bacteria | 1477 |
| 368 | Ga0495638_0000011 | 3300046460 | Bacteria | 442453 |
| 369 | Ga0495638_0235608 | 3300046460 | Bacteria | 1016 |
| 370 | Ga0495638_0297704 | 3300046460 | Bacteria | 870 |
| 371 | Ga0495650_0001636 | 3300046471 | Bacteria | 20810 |
| 372 | Ga0495585_0053683 | 3300046492 | Bacteria | 2230 |
| 373 | Ga0495596_0127034 | 3300046500 | Bacteria | 990 |
| 374 | Ga0495583_0000242 | 3300046506 | Bacteria | 90367 |
| 375 | Ga0495583_0001079 | 3300046506 | Bacteria | 30373 |
| 376 | Ga0495583_0062278 | 3300046506 | Bacteria | 1661 |
| 377 | Ga0495583_0106066 | 3300046506 | Bacteria | 1194 |
| 378 | Ga0495583_0131394 | 3300046506 | Bacteria | 1047 |
| 379 | Ga0495606_0003229 | 3300046507 | Bacteria | 17530 |
| 380 | Ga0495606_0072771 | 3300046507 | Bacteria | 2158 |
| 381 | Ga0495610_0161439 | 3300046512 | Bacteria | 947 |
| 382 | Ga0495631_0166167 | 3300046518 | Bacteria | 947 |
| 383 | Ga0495632_0000007 | 3300046519 | Bacteria | 343246 |
| 384 | Ga0495632_0000638 | 3300046519 | Bacteria | 32240 |
| 385 | Ga0495637_0010641 | 3300046520 | Bacteria | 4441 |
| 386 | Ga0495637_0061206 | 3300046520 | Bacteria | 1544 |
| 387 | Ga0495643_0000070 | 3300046522 | Bacteria | 170879 |
| 388 | Ga0495643_0003013 | 3300046522 | Bacteria | 12664 |
| 389 | Ga0495643_0010574 | 3300046522 | Bacteria | 5670 |
| 390 | Ga0495643_0147394 | 3300046522 | Bacteria | 1168 |
| 391 | Ga0495648_0000023 | 3300046524 | Bacteria | 240174 |
| 392 | Ga0495648_0000146 | 3300046524 | Bacteria | 84443 |
| 393 | Ga0495648_0024880 | 3300046524 | Bacteria | 4065 |
| 394 | Ga0495648_0063847 | 3300046524 | Bacteria | 2172 |
| 395 | Ga0495663_0000005 | 3300046525 | Bacteria | 342265 |
| 396 | Ga0495663_0002929 | 3300046525 | Bacteria | 5024 |
| 397 | Ga0495663_0004752 | 3300046525 | Bacteria | 3802 |
| 398 | Ga0495642_0015477 | 3300046528 | Bacteria | 2965 |
| 399 | Ga0495654_0001135 | 3300046530 | Bacteria | 19108 |
| 400 | Ga0495654_0011421 | 3300046530 | Bacteria | 4807 |
| 401 | Ga0495598_0000719 | 3300046537 | Bacteria | 6304 |
| 402 | Ga0495597_0010652 | 3300046542 | Bacteria | 4483 |
| 403 | Ga0495622_0013278 | 3300046557 | Bacteria | 3822 |
| 404 | Ga0495633_0001524 | 3300046558 | Bacteria | 17834 |
| 405 | Ga0495633_0002794 | 3300046558 | Bacteria | 12067 |
| 406 | Ga0495633_0014470 | 3300046558 | Bacteria | 4125 |
| 407 | Ga0495633_0025117 | 3300046558 | Bacteria | 2936 |
| 408 | Ga0495633_0147860 | 3300046558 | Bacteria | 1085 |
| 409 | Ga0495668_0000181 | 3300046616 | Bacteria | 94147 |
| 410 | Ga0495668_0003385 | 3300046616 | Bacteria | 11999 |
| 411 | Ga0495668_0009501 | 3300046616 | Bacteria | 5968 |
| 412 | Ga0495668_0050130 | 3300046616 | Bacteria | 2314 |
| 413 | Ga0495611_0141468 | 3300046648 | Bacteria | 1123 |
| 414 | Ga0495625_0000312 | 3300046660 | Bacteria | 74208 |
| 415 | Ga0495625_0021310 | 3300046660 | Bacteria | 4992 |
| 416 | Ga0495625_0039551 | 3300046660 | Bacteria | 3442 |
| 417 | Ga0495625_0054819 | 3300046660 | Bacteria | 2846 |
| 418 | Ga0495661_0222849 | 3300046665 | Bacteria | 976 |
| 419 | Ga0495669_0000179 | 3300046684 | Bacteria | 39746 |
| 420 | Ga0495669_0006848 | 3300046684 | Bacteria | 4769 |
| 421 | Ga0495669_0012371 | 3300046684 | Bacteria | 3632 |
| 422 | Ga0495669_0024586 | 3300046684 | Bacteria | 2623 |
| 423 | Ga0495670_0000037 | 3300046691 | Bacteria | 77395 |
| 424 | Ga0495670_0003180 | 3300046691 | Bacteria | 8087 |
| 425 | Ga0495670_0003777 | 3300046691 | Bacteria | 7438 |
| 426 | Ga0495670_0006231 | 3300046691 | Bacteria | 5856 |
| 427 | Ga0495671_0000012 | 3300046692 | Bacteria | 358632 |
| 428 | Ga0495671_0000039 | 3300046692 | Bacteria | 170879 |
| 429 | Ga0495600_0007940 | 3300046809 | Bacteria | 6504 |
| 430 | Ga0495660_0087819 | 3300046810 | Bacteria | 1621 |
| 431 | Ga0495683_0015848 | 3300047323 | Bacteria | 3914 |
| 432 | Ga0495683_0151672 | 3300047323 | Bacteria | 1078 |
| 433 | Ga0495687_000838 | 3300047443 | Bacteria | 32810 |
| 434 | Ga0495677_0008582 | 3300047445 | Bacteria | 3793 |
| 435 | Ga0495673_0000029 | 3300047469 | Bacteria | 471019 |
| 436 | Ga0495673_0027126 | 3300047469 | Bacteria | 2730 |
| 437 | Ga0495681_0016351 | 3300047470 | Bacteria | 4161 |
| 438 | Ga0495686_0000366 | 3300047472 | Bacteria | 73243 |
| 439 | Ga0495686_0000430 | 3300047472 | Bacteria | 65300 |
| 440 | Ga0495686_0039352 | 3300047472 | Bacteria | 3020 |
| 441 | Ga0496102_0000630 | 3300048905 | Bacteria | 35909 |
| 442 | Ga0496103_0000463 | 3300048906 | Bacteria | 34406 |
| 443 | Ga0496104_0035400 | 3300048907 | Bacteria | 4661 |
| 444 | Ga0496104_0061491 | 3300048907 | Bacteria | 3561 |
| 445 | Ga0496105_0004827 | 3300048908 | Bacteria | 10186 |
| 446 | Ga0496105_0014062 | 3300048908 | Bacteria | 6369 |
| 447 | Ga0496107_0320023 | 3300048910 | Bacteria | 1154 |
| 448 | Ga0496108_0000302 | 3300048911 | Bacteria | 42284 |
| 449 | Ga0496108_0043425 | 3300048911 | Bacteria | 3755 |
| 450 | Ga0496109_0104635 | 3300048912 | Bacteria | 2628 |
| 451 | Ga0496110_0045014 | 3300048913 | Bacteria | 3855 |
| 452 | Ga0496113_0166502 | 3300048916 | Bacteria | 1744 |
| 453 | Ga0496114_0004797 | 3300048917 | Bacteria | 10530 |
| 454 | Ga0496114_0051844 | 3300048917 | Bacteria | 3417 |
| 455 | Ga0496115_0000286 | 3300048918 | Bacteria | 43642 |
| 456 | Ga0496115_0000392 | 3300048918 | Bacteria | 35987 |
| 457 | Ga0496115_0002651 | 3300048918 | Bacteria | 12843 |
| 458 | Ga0496116_0011350 | 3300048919 | Bacteria | 7389 |
| 459 | Ga0496117_0000142 | 3300048920 | Bacteria | 157953 |
| 460 | Ga0496117_0012434 | 3300048920 | Bacteria | 7499 |
| 461 | Ga0496117_0201157 | 3300048920 | Bacteria | 1125 |
| 462 | Ga0496118_0001428 | 3300048921 | Bacteria | 35960 |
| 463 | Ga0496118_0004623 | 3300048921 | Bacteria | 16165 |
| 464 | Ga0496118_0127967 | 3300048921 | Bacteria | 1637 |
| 465 | Ga0496119_0003295 | 3300048922 | Bacteria | 16869 |
| 466 | Ga0496119_0092626 | 3300048922 | Bacteria | 1714 |
| 467 | Ga0496120_0010755 | 3300048923 | Bacteria | 6345 |
| 468 | Ga0496120_0078302 | 3300048923 | Bacteria | 1797 |
| 469 | Ga0496120_0150982 | 3300048923 | Bacteria | 1168 |
| 470 | Ga0496121_0002043 | 3300048924 | Bacteria | 31958 |
| 471 | Ga0496121_0009605 | 3300048924 | Bacteria | 11083 |
| 472 | Ga0496121_0028750 | 3300048924 | Bacteria | 5166 |
| 473 | Ga0496121_0041132 | 3300048924 | Bacteria | 4045 |
| 474 | Ga0496121_0289995 | 3300048924 | Bacteria | 1115 |
| 475 | Ga0496122_0000858 | 3300048925 | Bacteria | 57235 |
| 476 | Ga0496122_0004170 | 3300048925 | Bacteria | 18218 |
| 477 | Ga0496122_0033624 | 3300048925 | Bacteria | 4213 |
| 478 | Ga0496122_0102775 | 3300048925 | Bacteria | 1904 |
| 479 | Ga0496122_0184281 | 3300048925 | Bacteria | 1241 |
| 480 | Ga0496123_0001920 | 3300048926 | Bacteria | 27131 |
| 481 | Ga0496123_0017787 | 3300048926 | Bacteria | 5695 |
| 482 | Ga0496123_0034710 | 3300048926 | Bacteria | 3607 |
| 483 | Ga0496123_0110137 | 3300048926 | Bacteria | 1576 |
| 484 | Ga0496124_0000041 | 3300048927 | Bacteria | 303887 |
| 485 | Ga0496124_0000907 | 3300048927 | Bacteria | 47809 |
| 486 | Ga0496124_0004898 | 3300048927 | Bacteria | 15390 |
| 487 | Ga0496124_0008532 | 3300048927 | Bacteria | 10696 |
| 488 | Ga0496124_0022693 | 3300048927 | Bacteria | 5747 |
| 489 | Ga0496124_0043808 | 3300048927 | Bacteria | 3844 |
| 490 | Ga0496124_0068891 | 3300048927 | Bacteria | 2939 |
| 491 | Ga0496124_0374694 | 3300048927 | Bacteria | 998 |
| 492 | Ga0496125_0000238 | 3300048928 | Bacteria | 113252 |
| 493 | Ga0496125_0009979 | 3300048928 | Bacteria | 9652 |
| 494 | Ga0496125_0015219 | 3300048928 | Bacteria | 7449 |
| 495 | Ga0496125_0063100 | 3300048928 | Bacteria | 2957 |
| 496 | Ga0496125_0070073 | 3300048928 | Bacteria | 2747 |
| 497 | Ga0496125_0071993 | 3300048928 | Bacteria | 2697 |
| 498 | Ga0496126_0001472 | 3300048929 | Bacteria | 36627 |
| 499 | Ga0501033_0022441 | 3300049570 | Bacteria | 4762 |
| 500 | Ga0501042_0666707 | 3300049578 | Bacteria | 756 |
| 501 | Ga0501046_0069641 | 3300049580 | Bacteria | 2737 |
| 502 | Ga0501047_0003460 | 3300049581 | Bacteria | 14916 |
| 503 | Ga0501067_0154404 | 3300049583 | Unclassified | 1279 |
| 504 | Ga0501068_0128713 | 3300049584 | Bacteria | 1582 |
| 505 | Ga0501071_0499264 | 3300049587 | Bacteria | 933 |
| 506 | Ga0501222_000846 | 3300049662 | Bacteria | 4415 |
| 507 | Ga0501223_000039 | 3300049663 | Bacteria | 45537 |
| 508 | Ga0501223_005328 | 3300049663 | Bacteria | 2707 |
| 509 | Ga0501224_002810 | 3300049664 | Bacteria | 2398 |
| 510 | Ga0501257_000007 | 3300049686 | Bacteria | 54757 |
| 511 | Ga0501259_001381 | 3300049688 | Bacteria | 4061 |
| 512 | Ga0501261_000011 | 3300049690 | Bacteria | 48296 |
| 513 | Ga0501225_0000010 | 3300049705 | Bacteria | 82395 |
| 514 | Ga0501225_0022505 | 3300049705 | Bacteria | 1740 |
| 515 | Ga0501225_0045145 | 3300049705 | Bacteria | 1220 |
| 516 | Ga0501279_000010 | 3300049775 | Bacteria | 103375 |
| 517 | Ga0501280_000099 | 3300049776 | Bacteria | 22972 |
| 518 | Ga0501280_003711 | 3300049776 | Bacteria | 2314 |
| 519 | Ga0501281_00413 | 3300049777 | Bacteria | 4227 |
| 520 | Ga0501035_0147740 | 3300049822 | Bacteria | 2041 |
| 521 | Ga0501044_0050810 | 3300049823 | Bacteria | 4277 |
| 522 | Ga0501044_0329206 | 3300049823 | Bacteria | 1451 |
| 523 | nmdc:mga09592_352823_c1 | 3300050508 | Bacteria | 1273 |
| 524 | Ga0495612_0081780 | 3300053078 | Bacteria | 1358 |
| 525 | Ga0500610_0000299 | 3300053079 | Bacteria | 14964 |
| 526 | Ga0500643_001133 | 3300053087 | Bacteria | 15906 |
| 527 | Ga0500643_002728 | 3300053087 | Bacteria | 8858 |
| 528 | Ga0500643_005562 | 3300053087 | Bacteria | 5408 |
| 529 | Ga0500643_005761 | 3300053087 | Bacteria | 5285 |
| 530 | Ga0500643_075769 | 3300053087 | Bacteria | 929 |
| 531 | Ga0500644_0042932 | 3300053088 | Bacteria | 1510 |
| 532 | Ga0500583_0080149 | 3300053092 | Bacteria | 1576 |
| 533 | Ga0500651_0014272 | 3300053093 | Bacteria | 4859 |
| 534 | Ga0500651_0240211 | 3300053093 | Bacteria | 1057 |
| 535 | Ga0500641_0025271 | 3300053096 | Bacteria | 2297 |
| 536 | Ga0500562_013822 | 3300053108 | Bacteria | 2065 |
| 537 | Ga0500592_000445 | 3300053116 | Bacteria | 6908 |
| 538 | Ga0500592_001313 | 3300053116 | Bacteria | 4045 |
| 539 | Ga0500592_001693 | 3300053116 | Bacteria | 3574 |
| 540 | Ga0500595_023151 | 3300053119 | Bacteria | 2187 |
| 541 | Ga0500618_012199 | 3300053125 | Bacteria | 2255 |
| 542 | Ga0500642_0003941 | 3300053130 | Bacteria | 4576 |
| 543 | Ga0500642_0007123 | 3300053130 | Bacteria | 3738 |
| 544 | Ga0500655_000094 | 3300053133 | Bacteria | 23193 |
| 545 | Ga0500559_0010893 | 3300053136 | Bacteria | 3897 |
| 546 | Ga0500559_0063063 | 3300053136 | Bacteria | 1656 |
| 547 | Ga0500568_0047100 | 3300053139 | Bacteria | 1709 |
| 548 | Ga0500590_006053 | 3300053148 | Bacteria | 5865 |
| 549 | Ga0500619_014363 | 3300053154 | Bacteria | 2126 |
| 550 | Ga0500624_000002 | 3300053157 | Bacteria | 257900 |
| 551 | Ga0500627_0000851 | 3300053158 | Bacteria | 8159 |
| 552 | Ga0500627_0001031 | 3300053158 | Bacteria | 7597 |
| 553 | Ga0500636_0003715 | 3300053177 | Bacteria | 8614 |
| 554 | Ga0500636_0026939 | 3300053177 | Bacteria | 3394 |
| 555 | Ga0500570_000135 | 3300053724 | Bacteria | 21948 |
| 556 | Ga0500645_000132 | 3300053730 | Bacteria | 58716 |
| 557 | Ga0500645_026699 | 3300053730 | Bacteria | 1756 |
| 558 | Ga0500661_000742 | 3300055283 | Bacteria | 6126 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025933 | Ga0207706_10010249 | Ga0207706_100102495 | 207 |
| 2 | 3300026116 | Ga0207674_10025014 | Ga0207674_100250145 | 207 |
| 3 | 3300032002 | Ga0307416_100062443 | Ga0307416_1000624434 | 207 |
| 4 | 3300049578 | Ga0501042_0666707 | Ga0501042_0666707_13_741 | 218 |
| 5 | 3300045976 | Ga0466967_0079802 | Ga0466967_0079802_1453_2286 | 231 |
| 6 | 3300037418 | Ga0395900_0007250 | Ga0395900_0007250_10480_11313 | 232 |
| 7 | 3300005577 | Ga0068857_100084926 | Ga0068857_1000849264 | 234 |
| 8 | 3300026116 | Ga0207674_10512697 | Ga0207674_105126972 | 234 |
| 9 | 3300037471 | Ga0395905_0074027 | Ga0395905_0074027_1805_2701 | 234 |
| 10 | 3300044684 | Ga0466966_0130795 | Ga0466966_0130795_643_1476 | 234 |
| 11 | 3300044693 | Ga0466961_0058770 | Ga0466961_0058770_1044_1877 | 234 |
| 12 | 3300045049 | Ga0466959_0096352 | Ga0466959_0096352_132_965 | 234 |
| 13 | 3300045836 | Ga0466958_0121513 | Ga0466958_0121513_425_1258 | 234 |
| 14 | 3300046537 | Ga0495598_0000719 | Ga0495598_0000719_1193_2053 | 235 |
| 15 | 3300046684 | Ga0495669_0012371 | Ga0495669_0012371_585_1445 | 235 |
| 16 | 3300046691 | Ga0495670_0006231 | Ga0495670_0006231_3507_4367 | 235 |
| 17 | 3300038443 | Ga0395901_0000241 | Ga0395901_0000241_17272_18105 | 238 |
| 18 | 3300025261 | Ga0209233_1011300 | Ga0209233_10113002 | 241 |
| 19 | 3300044694 | Ga0466963_0023290 | Ga0466963_0023290_1451_2284 | 244 |
| 20 | 3300046684 | Ga0495669_0006848 | Ga0495669_0006848_2254_3078 | 245 |
| 21 | 3300005338 | Ga0068868_100227642 | Ga0068868_1002276422 | 246 |
| 22 | 3300046506 | Ga0495583_0106066 | Ga0495583_0106066_69_887 | 246 |
| 23 | 3300053079 | Ga0500610_0000299 | Ga0500610_0000299_12760_13578 | 246 |
| 24 | 3300053730 | Ga0500645_000132 | Ga0500645_000132_48602_49420 | 246 |
| 25 | 3300005842 | Ga0068858_100584775 | Ga0068858_1005847752 | 247 |
| 26 | 3300025923 | Ga0207681_10448003 | Ga0207681_104480031 | 247 |
| 27 | 3300031731 | Ga0307405_10189704 | Ga0307405_101897042 | 247 |
| 28 | 3300031824 | Ga0307413_10010036 | Ga0307413_100100362 | 247 |
| 29 | 3300031995 | Ga0307409_100238632 | Ga0307409_1002386322 | 247 |
| 30 | 3300032004 | Ga0307414_10000420 | Ga0307414_1000042018 | 247 |
| 31 | 3300032126 | Ga0307415_100409527 | Ga0307415_1004095272 | 247 |
| 32 | 3300045051 | Ga0451576_0008370 | Ga0451576_0008370_6054_6902 | 247 |
| 33 | 3300049587 | Ga0501071_0499264 | Ga0501071_0499264_16_849 | 247 |
| 34 | 3300053116 | Ga0500592_001313 | Ga0500592_001313_123_1004 | 247 |
| 35 | 3300025949 | Ga0207667_10047515 | Ga0207667_100475155 | 248 |
| 36 | 3300026116 | Ga0207674_10037637 | Ga0207674_100376372 | 248 |
| 37 | 3300047445 | Ga0495677_0008582 | Ga0495677_0008582_1349_2173 | 248 |
| 38 | 3300005344 | Ga0070661_100216754 | Ga0070661_1002167542 | 249 |
| 39 | 3300009551 | Ga0105238_10188370 | Ga0105238_101883703 | 249 |
| 40 | 3300013307 | Ga0157372_10213884 | Ga0157372_102138843 | 249 |
| 41 | 3300025920 | Ga0207649_10093736 | Ga0207649_100937363 | 249 |
| 42 | 3300026041 | Ga0207639_10067025 | Ga0207639_100670253 | 249 |
| 43 | 3300037418 | Ga0395900_0220584 | Ga0395900_0220584_855_1691 | 249 |
| 44 | 3300044842 | Ga0466957_0166316 | Ga0466957_0166316_164_1027 | 249 |
| 45 | 3300001989 | JGI24739J22299_10003988 | JGI24739J22299_100039882 | 250 |
| 46 | 3300002075 | JGI24738J21930_10007207 | JGI24738J21930_100072072 | 250 |
| 47 | 3300005457 | Ga0070662_100010572 | Ga0070662_1000105726 | 250 |
| 48 | 3300005539 | Ga0068853_100018116 | Ga0068853_1000181163 | 250 |
| 49 | 3300021358 | Ga0213873_10000007 | Ga0213873_10000007153 | 250 |
| 50 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005189 | 250 |
| 51 | 3300025933 | Ga0207706_10024099 | Ga0207706_100240995 | 250 |
| 52 | 3300025949 | Ga0207667_10179290 | Ga0207667_101792902 | 250 |
| 53 | 3300025981 | Ga0207640_10019501 | Ga0207640_100195014 | 250 |
| 54 | 3300025981 | Ga0207640_10114024 | Ga0207640_101140242 | 250 |
| 55 | 3300026041 | Ga0207639_10006688 | Ga0207639_100066886 | 250 |
| 56 | 3300026116 | Ga0207674_10020781 | Ga0207674_100207813 | 250 |
| 57 | 3300031731 | Ga0307405_10031119 | Ga0307405_100311193 | 250 |
| 58 | 3300031731 | Ga0307405_10032751 | Ga0307405_100327512 | 250 |
| 59 | 3300031911 | Ga0307412_10124580 | Ga0307412_101245801 | 250 |
| 60 | 3300053087 | Ga0500643_002728 | Ga0500643_002728_3502_4335 | 250 |
| 61 | 3300005344 | Ga0070661_100049038 | Ga0070661_1000490382 | 251 |
| 62 | 3300005563 | Ga0068855_100056357 | Ga0068855_1000563574 | 251 |
| 63 | 3300005614 | Ga0068856_100046685 | Ga0068856_1000466854 | 251 |
| 64 | 3300006846 | Ga0075430_100121363 | Ga0075430_1001213632 | 251 |
| 65 | 3300013105 | Ga0157369_10129064 | Ga0157369_101290642 | 251 |
| 66 | 3300025949 | Ga0207667_10136055 | Ga0207667_101360552 | 251 |
| 67 | 3300026078 | Ga0207702_10033026 | Ga0207702_100330264 | 251 |
| 68 | 3300026142 | Ga0207698_10018012 | Ga0207698_100180123 | 251 |
| 69 | 3300044684 | Ga0466966_0000007 | Ga0466966_0000007_82484_83320 | 251 |
| 70 | 3300044693 | Ga0466961_0181099 | Ga0466961_0181099_452_1285 | 251 |
| 71 | 3300046660 | Ga0495625_0039551 | Ga0495625_0039551_54_887 | 251 |
| 72 | 3300047443 | Ga0495687_000838 | Ga0495687_000838_12124_12957 | 251 |
| 73 | 3300001915 | JGI24741J21665_1000724 | JGI24741J21665_10007243 | 252 |
| 74 | 3300001990 | JGI24737J22298_10002224 | JGI24737J22298_100022248 | 252 |
| 75 | 3300005327 | Ga0070658_10000281 | Ga0070658_1000028120 | 252 |
| 76 | 3300005339 | Ga0070660_100129524 | Ga0070660_1001295242 | 252 |
| 77 | 3300005344 | Ga0070661_100001799 | Ga0070661_1000017993 | 252 |
| 78 | 3300005344 | Ga0070661_100185058 | Ga0070661_1001850581 | 252 |
| 79 | 3300005353 | Ga0070669_100362367 | Ga0070669_1003623672 | 252 |
| 80 | 3300005366 | Ga0070659_100015172 | Ga0070659_1000151725 | 252 |
| 81 | 3300005367 | Ga0070667_100000302 | Ga0070667_10000030230 | 252 |
| 82 | 3300005455 | Ga0070663_100006789 | Ga0070663_1000067892 | 252 |
| 83 | 3300005458 | Ga0070681_10060953 | Ga0070681_100609533 | 252 |
| 84 | 3300005563 | Ga0068855_100084253 | Ga0068855_1000842533 | 252 |
| 85 | 3300005614 | Ga0068856_100062368 | Ga0068856_1000623683 | 252 |
| 86 | 3300005834 | Ga0068851_10064305 | Ga0068851_100643052 | 252 |
| 87 | 3300005843 | Ga0068860_100000416 | Ga0068860_10000041630 | 252 |
| 88 | 3300009174 | Ga0105241_10016301 | Ga0105241_100163016 | 252 |
| 89 | 3300009177 | Ga0105248_10210064 | Ga0105248_102100641 | 252 |
| 90 | 3300013100 | Ga0157373_10195237 | Ga0157373_101952372 | 252 |
| 91 | 3300013102 | Ga0157371_10000747 | Ga0157371_1000074723 | 252 |
| 92 | 3300025321 | Ga0207656_10014475 | Ga0207656_100144753 | 252 |
| 93 | 3300025909 | Ga0207705_10000319 | Ga0207705_1000031922 | 252 |
| 94 | 3300025911 | Ga0207654_10001234 | Ga0207654_1000123413 | 252 |
| 95 | 3300025913 | Ga0207695_10048566 | Ga0207695_100485665 | 252 |
| 96 | 3300025919 | Ga0207657_10002244 | Ga0207657_1000224422 | 252 |
| 97 | 3300025920 | Ga0207649_10001413 | Ga0207649_1000141316 | 252 |
| 98 | 3300025920 | Ga0207649_10074293 | Ga0207649_100742932 | 252 |
| 99 | 3300025932 | Ga0207690_10000511 | Ga0207690_1000051121 | 252 |
| 100 | 3300025933 | Ga0207706_10010971 | Ga0207706_100109718 | 252 |
| 101 | 3300025949 | Ga0207667_10000006 | Ga0207667_10000006572 | 252 |
| 102 | 3300025981 | Ga0207640_10019101 | Ga0207640_100191013 | 252 |
| 103 | 3300025986 | Ga0207658_10000263 | Ga0207658_1000026329 | 252 |
| 104 | 3300026041 | Ga0207639_10001496 | Ga0207639_100014967 | 252 |
| 105 | 3300026067 | Ga0207678_10008946 | Ga0207678_100089463 | 252 |
| 106 | 3300026078 | Ga0207702_10002982 | Ga0207702_1000298211 | 252 |
| 107 | 3300026078 | Ga0207702_10034073 | Ga0207702_100340732 | 252 |
| 108 | 3300026078 | Ga0207702_10777493 | Ga0207702_107774931 | 252 |
| 109 | 3300026088 | Ga0207641_10004428 | Ga0207641_100044281 | 252 |
| 110 | 3300026116 | Ga0207674_10014177 | Ga0207674_100141773 | 252 |
| 111 | 3300026142 | Ga0207698_10160685 | Ga0207698_101606852 | 252 |
| 112 | 3300028381 | Ga0268264_10000184 | Ga0268264_1000018429 | 252 |
| 113 | 3300031731 | Ga0307405_10005258 | Ga0307405_100052584 | 252 |
| 114 | 3300044901 | Ga0466960_0304674 | Ga0466960_0304674_19_855 | 252 |
| 115 | 3300046616 | Ga0495668_0050130 | Ga0495668_0050130_878_1687 | 252 |
| 116 | 3300047323 | Ga0495683_0151672 | Ga0495683_0151672_55_873 | 252 |
| 117 | 3300001990 | JGI24737J22298_10052684 | JGI24737J22298_100526841 | 253 |
| 118 | 3300003911 | JGI25405J52794_10007325 | JGI25405J52794_100073251 | 253 |
| 119 | 3300005455 | Ga0070663_100100815 | Ga0070663_1001008151 | 253 |
| 120 | 3300005577 | Ga0068857_100066462 | Ga0068857_1000664623 | 253 |
| 121 | 3300005937 | Ga0081455_10000215 | Ga0081455_1000021536 | 253 |
| 122 | 3300013104 | Ga0157370_10255949 | Ga0157370_102559492 | 253 |
| 123 | 3300026067 | Ga0207678_10027339 | Ga0207678_100273394 | 253 |
| 124 | 3300044694 | Ga0466963_0019639 | Ga0466963_0019639_3280_4113 | 253 |
| 125 | 3300046512 | Ga0495610_0161439 | Ga0495610_0161439_86_904 | 253 |
| 126 | 3300046525 | Ga0495663_0002929 | Ga0495663_0002929_3422_4276 | 253 |
| 127 | 3300046530 | Ga0495654_0001135 | Ga0495654_0001135_9179_10033 | 253 |
| 128 | 3300046616 | Ga0495668_0003385 | Ga0495668_0003385_4798_5652 | 253 |
| 129 | 3300048918 | Ga0496115_0000286 | Ga0496115_0000286_23379_24212 | 253 |
| 130 | 3300053158 | Ga0500627_0000851 | Ga0500627_0000851_5261_6115 | 253 |
| 131 | 3300005262 | Ga0065165_1047593 | Ga0065165_10475932 | 254 |
| 132 | 3300025304 | Ga0209257_1005932 | Ga0209257_10059327 | 254 |
| 133 | 3300045976 | Ga0466967_0207440 | Ga0466967_0207440_41_904 | 254 |
| 134 | 3300046691 | Ga0495670_0000037 | Ga0495670_0000037_34902_35735 | 254 |
| 135 | 3300048925 | Ga0496122_0184281 | Ga0496122_0184281_58_891 | 254 |
| 136 | 3300049664 | Ga0501224_002810 | Ga0501224_002810_645_1481 | 254 |
| 137 | 3300049705 | Ga0501225_0045145 | Ga0501225_0045145_159_995 | 254 |
| 138 | 3300049777 | Ga0501281_00413 | Ga0501281_00413_1599_2435 | 254 |
| 139 | 3300053078 | Ga0495612_0081780 | Ga0495612_0081780_498_1337 | 254 |
| 140 | iso_pu_bacteria | 2852680915 | 2852684037 | 254 |
| 141 | 3300005564 | Ga0070664_100027450 | Ga0070664_1000274506 | 255 |
| 142 | 3300009545 | Ga0105237_10017495 | Ga0105237_100174954 | 255 |
| 143 | 3300025914 | Ga0207671_10009474 | Ga0207671_100094749 | 255 |
| 144 | 3300025919 | Ga0207657_10009148 | Ga0207657_1000914810 | 255 |
| 145 | 3300025932 | Ga0207690_10112872 | Ga0207690_101128723 | 255 |
| 146 | 3300025945 | Ga0207679_10333986 | Ga0207679_103339862 | 255 |
| 147 | 3300026142 | Ga0207698_10255564 | Ga0207698_102555642 | 255 |
| 148 | 3300031456 | Ga0307513_10161811 | Ga0307513_101618111 | 255 |
| 149 | 3300031731 | Ga0307405_10044668 | Ga0307405_100446683 | 255 |
| 150 | 3300032002 | Ga0307416_100013238 | Ga0307416_1000132386 | 255 |
| 151 | 3300039437 | Ga0436365_0352550 | Ga0436365_0352550_15529_16374 | 255 |
| 152 | 3300039453 | Ga0436362_0451893 | Ga0436362_0451893_145512_146357 | 255 |
| 153 | 3300048924 | Ga0496121_0009605 | Ga0496121_0009605_6399_7232 | 255 |
| 154 | 3300053093 | Ga0500651_0240211 | Ga0500651_0240211_34_906 | 255 |
| 155 | 3300053177 | Ga0500636_0026939 | Ga0500636_0026939_2271_3104 | 255 |
| 156 | 3300003215 | JGI25153J46596_10000070 | JGI25153J46596_1000007096 | 256 |
| 157 | 3300005347 | Ga0070668_100025389 | Ga0070668_1000253895 | 256 |
| 158 | 3300005617 | Ga0068859_100057802 | Ga0068859_1000578024 | 256 |
| 159 | 3300005841 | Ga0068863_100002334 | Ga0068863_10000233418 | 256 |
| 160 | 3300005844 | Ga0068862_100000085 | Ga0068862_10000008560 | 256 |
| 161 | 3300005844 | Ga0068862_100007732 | Ga0068862_1000077325 | 256 |
| 162 | 3300006931 | Ga0097620_100057801 | Ga0097620_1000578014 | 256 |
| 163 | 3300009553 | Ga0105249_10000038 | Ga0105249_10000038138 | 256 |
| 164 | 3300025245 | Ga0207425_1035154 | Ga0207425_10351541 | 256 |
| 165 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023474 | 256 |
| 166 | 3300025297 | Ga0209758_1023592 | Ga0209758_10235924 | 256 |
| 167 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002138 | 256 |
| 168 | 3300025972 | Ga0207668_10004682 | Ga0207668_100046822 | 256 |
| 169 | 3300026088 | Ga0207641_10000944 | Ga0207641_1000094422 | 256 |
| 170 | 3300028380 | Ga0268265_10000104 | Ga0268265_1000010447 | 256 |
| 171 | 3300028380 | Ga0268265_10024259 | Ga0268265_100242594 | 256 |
| 172 | 3300028381 | Ga0268264_10001970 | Ga0268264_1000197016 | 256 |
| 173 | 3300041413 | Ga0439465_0004583 | Ga0439465_0004583_2318_3154 | 256 |
| 174 | 3300042004 | Ga0439445_0045670 | Ga0439445_0045670_197_1033 | 256 |
| 175 | 3300042156 | Ga0439446_0010748 | Ga0439446_0010748_1280_2116 | 256 |
| 176 | 3300046460 | Ga0495638_0000011 | Ga0495638_0000011_316619_317452 | 256 |
| 177 | 3300046524 | Ga0495648_0000023 | Ga0495648_0000023_114339_115172 | 256 |
| 178 | 3300048911 | Ga0496108_0000302 | Ga0496108_0000302_32746_33582 | 256 |
| 179 | 3300048920 | Ga0496117_0012434 | Ga0496117_0012434_5202_6050 | 256 |
| 180 | 3300048921 | Ga0496118_0004623 | Ga0496118_0004623_14630_15478 | 256 |
| 181 | 3300048924 | Ga0496121_0041132 | Ga0496121_0041132_2699_3541 | 256 |
| 182 | 3300048924 | Ga0496121_0289995 | Ga0496121_0289995_195_1043 | 256 |
| 183 | 3300048925 | Ga0496122_0004170 | Ga0496122_0004170_10322_11164 | 256 |
| 184 | 3300048927 | Ga0496124_0008532 | Ga0496124_0008532_2145_2987 | 256 |
| 185 | 3300048928 | Ga0496125_0009979 | Ga0496125_0009979_461_1303 | 256 |
| 186 | 3300049662 | Ga0501222_000846 | Ga0501222_000846_327_1172 | 256 |
| 187 | 3300049663 | Ga0501223_005328 | Ga0501223_005328_126_971 | 256 |
| 188 | 3300049688 | Ga0501259_001381 | Ga0501259_001381_2889_3734 | 256 |
| 189 | 3300049690 | Ga0501261_000011 | Ga0501261_000011_31759_32604 | 256 |
| 190 | 3300049775 | Ga0501279_000010 | Ga0501279_000010_53872_54717 | 256 |
| 191 | 3300049776 | Ga0501280_000099 | Ga0501280_000099_6487_7332 | 256 |
| 192 | 3300053087 | Ga0500643_075769 | Ga0500643_075769_29_865 | 256 |
| 193 | 3300002076 | JGI24749J21850_1000934 | JGI24749J21850_10009344 | 257 |
| 194 | 3300002459 | JGI24751J29686_10000055 | JGI24751J29686_1000005511 | 257 |
| 195 | 3300005295 | Ga0065707_10086768 | Ga0065707_100867682 | 257 |
| 196 | 3300005327 | Ga0070658_10002876 | Ga0070658_1000287610 | 257 |
| 197 | 3300005331 | Ga0070670_100000082 | Ga0070670_10000008258 | 257 |
| 198 | 3300005331 | Ga0070670_100006073 | Ga0070670_1000060733 | 257 |
| 199 | 3300005347 | Ga0070668_100000239 | Ga0070668_10000023921 | 257 |
| 200 | 3300005353 | Ga0070669_100000015 | Ga0070669_10000001558 | 257 |
| 201 | 3300005355 | Ga0070671_100001987 | Ga0070671_1000019872 | 257 |
| 202 | 3300005367 | Ga0070667_100000003 | Ga0070667_1000000037 | 257 |
| 203 | 3300005367 | Ga0070667_100013773 | Ga0070667_1000137735 | 257 |
| 204 | 3300005617 | Ga0068859_100039142 | Ga0068859_1000391423 | 257 |
| 205 | 3300005618 | Ga0068864_100000177 | Ga0068864_10000017734 | 257 |
| 206 | 3300005719 | Ga0068861_100001270 | Ga0068861_10000127015 | 257 |
| 207 | 3300005843 | Ga0068860_100000068 | Ga0068860_100000068179 | 257 |
| 208 | 3300005844 | Ga0068862_100000006 | Ga0068862_100000006108 | 257 |
| 209 | 3300005844 | Ga0068862_100001068 | Ga0068862_1000010686 | 257 |
| 210 | 3300006931 | Ga0097620_100039143 | Ga0097620_1000391433 | 257 |
| 211 | 3300009177 | Ga0105248_10000066 | Ga0105248_1000006624 | 257 |
| 212 | 3300009545 | Ga0105237_10097523 | Ga0105237_100975233 | 257 |
| 213 | 3300014326 | Ga0157380_10000114 | Ga0157380_100001144 | 257 |
| 214 | 3300025909 | Ga0207705_10000022 | Ga0207705_1000002298 | 257 |
| 215 | 3300025914 | Ga0207671_10015329 | Ga0207671_100153293 | 257 |
| 216 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001782 | 257 |
| 217 | 3300025925 | Ga0207650_10000050 | Ga0207650_10000050125 | 257 |
| 218 | 3300025931 | Ga0207644_10000836 | Ga0207644_1000083620 | 257 |
| 219 | 3300025941 | Ga0207711_10000317 | Ga0207711_100003175 | 257 |
| 220 | 3300025972 | Ga0207668_10000045 | Ga0207668_1000004521 | 257 |
| 221 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002909 | 257 |
| 222 | 3300025986 | Ga0207658_10008852 | Ga0207658_100088525 | 257 |
| 223 | 3300026088 | Ga0207641_10004405 | Ga0207641_100044052 | 257 |
| 224 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004218 | 257 |
| 225 | 3300026116 | Ga0207674_10011507 | Ga0207674_100115077 | 257 |
| 226 | 3300026118 | Ga0207675_100001609 | Ga0207675_1000016097 | 257 |
| 227 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002835 | 257 |
| 228 | 3300028380 | Ga0268265_10000946 | Ga0268265_1000094624 | 257 |
| 229 | 3300028381 | Ga0268264_10000103 | Ga0268264_10000103223 | 257 |
| 230 | 3300046506 | Ga0495583_0062278 | Ga0495583_0062278_816_1634 | 257 |
| 231 | 3300046530 | Ga0495654_0011421 | Ga0495654_0011421_3900_4751 | 257 |
| 232 | 3300048925 | Ga0496122_0000858 | Ga0496122_0000858_54619_55464 | 257 |
| 233 | 3300048926 | Ga0496123_0001920 | Ga0496123_0001920_8298_9143 | 257 |
| 234 | 3300048926 | Ga0496123_0017787 | Ga0496123_0017787_2572_3405 | 257 |
| 235 | 3300048926 | Ga0496123_0110137 | Ga0496123_0110137_80_913 | 257 |
| 236 | 3300048927 | Ga0496124_0004898 | Ga0496124_0004898_13964_14797 | 257 |
| 237 | 3300048927 | Ga0496124_0022693 | Ga0496124_0022693_3670_4503 | 257 |
| 238 | 3300048927 | Ga0496124_0068891 | Ga0496124_0068891_596_1429 | 257 |
| 239 | 3300048928 | Ga0496125_0071993 | Ga0496125_0071993_880_1713 | 257 |
| 240 | 3300049686 | Ga0501257_000007 | Ga0501257_000007_48827_49678 | 257 |
| 241 | 3300049776 | Ga0501280_003711 | Ga0501280_003711_716_1567 | 257 |
| 242 | 3300053087 | Ga0500643_005761 | Ga0500643_005761_1391_2272 | 257 |
| 243 | 3300053116 | Ga0500592_000445 | Ga0500592_000445_5424_6275 | 257 |
| 244 | 3300053136 | Ga0500559_0010893 | Ga0500559_0010893_2878_3723 | 257 |
| 245 | 3300053158 | Ga0500627_0001031 | Ga0500627_0001031_6733_7584 | 257 |
| 246 | 3300003320 | rootH2_10095765 | rootH2_100957654 | 258 |
| 247 | 3300003762 | Ga0055542_1000040 | Ga0055542_1000040183 | 258 |
| 248 | 3300003763 | Ga0055529_1000037 | Ga0055529_100003738 | 258 |
| 249 | 3300005331 | Ga0070670_100192447 | Ga0070670_1001924472 | 258 |
| 250 | 3300005347 | Ga0070668_100017003 | Ga0070668_1000170036 | 258 |
| 251 | 3300005456 | Ga0070678_100000147 | Ga0070678_10000014716 | 258 |
| 252 | 3300005578 | Ga0068854_100010580 | Ga0068854_1000105805 | 258 |
| 253 | 3300006186 | Ga0075369_10060962 | Ga0075369_100609623 | 258 |
| 254 | 3300006195 | Ga0075366_10068079 | Ga0075366_100680792 | 258 |
| 255 | 3300006880 | Ga0075429_100075740 | Ga0075429_1000757402 | 258 |
| 256 | 3300009148 | Ga0105243_10000990 | Ga0105243_1000099012 | 258 |
| 257 | 3300025254 | Ga0209148_1000011 | Ga0209148_10000111080 | 258 |
| 258 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006112 | 258 |
| 259 | 3300025925 | Ga0207650_10198717 | Ga0207650_101987171 | 258 |
| 260 | 3300025933 | Ga0207706_10115900 | Ga0207706_101159002 | 258 |
| 261 | 3300025935 | Ga0207709_10000039 | Ga0207709_10000039111 | 258 |
| 262 | 3300025937 | Ga0207669_10000076 | Ga0207669_1000007619 | 258 |
| 263 | 3300025972 | Ga0207668_10190457 | Ga0207668_101904571 | 258 |
| 264 | 3300025981 | Ga0207640_10006816 | Ga0207640_100068163 | 258 |
| 265 | 3300025986 | Ga0207658_10046286 | Ga0207658_100462862 | 258 |
| 266 | 3300026121 | Ga0207683_10000715 | Ga0207683_100007157 | 258 |
| 267 | 3300028786 | Ga0307517_10035942 | Ga0307517_100359421 | 258 |
| 268 | 3300031456 | Ga0307513_10076622 | Ga0307513_100766224 | 258 |
| 269 | 3300031911 | Ga0307412_10012894 | Ga0307412_100128942 | 258 |
| 270 | 3300033180 | Ga0307510_10134865 | Ga0307510_101348652 | 258 |
| 271 | 3300044659 | Ga0466973_0105572 | Ga0466973_0105572_407_1288 | 258 |
| 272 | 3300046460 | Ga0495638_0235608 | Ga0495638_0235608_86_904 | 258 |
| 273 | 3300046471 | Ga0495650_0001636 | Ga0495650_0001636_17632_18450 | 258 |
| 274 | 3300046492 | Ga0495585_0053683 | Ga0495585_0053683_1383_2201 | 258 |
| 275 | 3300046500 | Ga0495596_0127034 | Ga0495596_0127034_35_853 | 258 |
| 276 | 3300046506 | Ga0495583_0001079 | Ga0495583_0001079_14336_15154 | 258 |
| 277 | 3300046506 | Ga0495583_0131394 | Ga0495583_0131394_161_979 | 258 |
| 278 | 3300046507 | Ga0495606_0003229 | Ga0495606_0003229_12736_13554 | 258 |
| 279 | 3300046507 | Ga0495606_0072771 | Ga0495606_0072771_578_1396 | 258 |
| 280 | 3300046518 | Ga0495631_0166167 | Ga0495631_0166167_73_891 | 258 |
| 281 | 3300046522 | Ga0495643_0003013 | Ga0495643_0003013_6905_7723 | 258 |
| 282 | 3300046522 | Ga0495643_0010574 | Ga0495643_0010574_3252_4070 | 258 |
| 283 | 3300046522 | Ga0495643_0147394 | Ga0495643_0147394_147_965 | 258 |
| 284 | 3300046524 | Ga0495648_0000146 | Ga0495648_0000146_16438_17256 | 258 |
| 285 | 3300046525 | Ga0495663_0004752 | Ga0495663_0004752_805_1623 | 258 |
| 286 | 3300046528 | Ga0495642_0015477 | Ga0495642_0015477_1203_2021 | 258 |
| 287 | 3300046557 | Ga0495622_0013278 | Ga0495622_0013278_107_925 | 258 |
| 288 | 3300046558 | Ga0495633_0001524 | Ga0495633_0001524_8850_9668 | 258 |
| 289 | 3300046558 | Ga0495633_0147860 | Ga0495633_0147860_80_898 | 258 |
| 290 | 3300046616 | Ga0495668_0000181 | Ga0495668_0000181_81359_82177 | 258 |
| 291 | 3300046648 | Ga0495611_0141468 | Ga0495611_0141468_211_1029 | 258 |
| 292 | 3300046660 | Ga0495625_0000312 | Ga0495625_0000312_56529_57347 | 258 |
| 293 | 3300046660 | Ga0495625_0054819 | Ga0495625_0054819_1370_2188 | 258 |
| 294 | 3300046665 | Ga0495661_0222849 | Ga0495661_0222849_138_956 | 258 |
| 295 | 3300046684 | Ga0495669_0000179 | Ga0495669_0000179_13147_13965 | 258 |
| 296 | 3300046691 | Ga0495670_0003180 | Ga0495670_0003180_3402_4220 | 258 |
| 297 | 3300046810 | Ga0495660_0087819 | Ga0495660_0087819_372_1190 | 258 |
| 298 | 3300047323 | Ga0495683_0015848 | Ga0495683_0015848_112_930 | 258 |
| 299 | 3300048905 | Ga0496102_0000630 | Ga0496102_0000630_17186_18004 | 258 |
| 300 | 3300048906 | Ga0496103_0000463 | Ga0496103_0000463_17973_18791 | 258 |
| 301 | 3300048907 | Ga0496104_0061491 | Ga0496104_0061491_394_1212 | 258 |
| 302 | 3300048908 | Ga0496105_0014062 | Ga0496105_0014062_2233_3051 | 258 |
| 303 | 3300048913 | Ga0496110_0045014 | Ga0496110_0045014_1775_2593 | 258 |
| 304 | 3300048917 | Ga0496114_0051844 | Ga0496114_0051844_2518_3336 | 258 |
| 305 | 3300048918 | Ga0496115_0000392 | Ga0496115_0000392_17156_17974 | 258 |
| 306 | 3300048919 | Ga0496116_0011350 | Ga0496116_0011350_5492_6310 | 258 |
| 307 | 3300048920 | Ga0496117_0000142 | Ga0496117_0000142_139188_140006 | 258 |
| 308 | 3300048921 | Ga0496118_0001428 | Ga0496118_0001428_17912_18730 | 258 |
| 309 | 3300048922 | Ga0496119_0003295 | Ga0496119_0003295_1290_2108 | 258 |
| 310 | 3300048923 | Ga0496120_0010755 | Ga0496120_0010755_4515_5333 | 258 |
| 311 | 3300048924 | Ga0496121_0002043 | Ga0496121_0002043_16973_17791 | 258 |
| 312 | 3300048925 | Ga0496122_0033624 | Ga0496122_0033624_1273_2091 | 258 |
| 313 | 3300048926 | Ga0496123_0034710 | Ga0496123_0034710_1575_2393 | 258 |
| 314 | 3300048927 | Ga0496124_0000041 | Ga0496124_0000041_177197_178015 | 258 |
| 315 | 3300048928 | Ga0496125_0000238 | Ga0496125_0000238_94458_95276 | 258 |
| 316 | 3300048929 | Ga0496126_0001472 | Ga0496126_0001472_18560_19378 | 258 |
| 317 | 3300049580 | Ga0501046_0069641 | Ga0501046_0069641_545_1426 | 258 |
| 318 | 3300049581 | Ga0501047_0003460 | Ga0501047_0003460_9437_10318 | 258 |
| 319 | 3300050508 | nmdc:mga09592_352823_c1 | nmdc:mga09592_352823_c1_403_1236 | 258 |
| 320 | 3300053130 | Ga0500642_0007123 | Ga0500642_0007123_1498_2316 | 258 |
| 321 | 3300053154 | Ga0500619_014363 | Ga0500619_014363_1221_2039 | 258 |
| 322 | iso_pu_bacteria | 2830075706 | 2830078277 | 258 |
| 323 | iso_pu_bacteria | 2882806704 | 2882807792 | 258 |
| 324 | iso_pu_bacteria | 2990265787 | 2990266136 | 258 |
| 325 | iso_pu_bacteria | 2993693658 | 2993696070 | 258 |
| 326 | 3300003322 | rootL2_10377998 | rootL2_103779982 | 259 |
| 327 | 3300005328 | Ga0070676_10024614 | Ga0070676_100246144 | 259 |
| 328 | 3300005338 | Ga0068868_100018436 | Ga0068868_1000184363 | 259 |
| 329 | 3300005339 | Ga0070660_100110087 | Ga0070660_1001100872 | 259 |
| 330 | 3300005344 | Ga0070661_100051672 | Ga0070661_1000516724 | 259 |
| 331 | 3300005366 | Ga0070659_100149661 | Ga0070659_1001496612 | 259 |
| 332 | 3300005367 | Ga0070667_100087970 | Ga0070667_1000879703 | 259 |
| 333 | 3300005455 | Ga0070663_100279726 | Ga0070663_1002797262 | 259 |
| 334 | 3300005456 | Ga0070678_100567895 | Ga0070678_1005678951 | 259 |
| 335 | 3300005564 | Ga0070664_100267051 | Ga0070664_1002670512 | 259 |
| 336 | 3300005578 | Ga0068854_100044961 | Ga0068854_1000449613 | 259 |
| 337 | 3300005617 | Ga0068859_100722376 | Ga0068859_1007223761 | 259 |
| 338 | 3300005834 | Ga0068851_10001318 | Ga0068851_100013183 | 259 |
| 339 | 3300005842 | Ga0068858_100000897 | Ga0068858_10000089713 | 259 |
| 340 | 3300006931 | Ga0097620_100722312 | Ga0097620_1007223121 | 259 |
| 341 | 3300009551 | Ga0105238_10012734 | Ga0105238_100127343 | 259 |
| 342 | 3300013100 | Ga0157373_10175635 | Ga0157373_101756353 | 259 |
| 343 | 3300013296 | Ga0157374_10033403 | Ga0157374_100334033 | 259 |
| 344 | 3300013296 | Ga0157374_10181585 | Ga0157374_101815852 | 259 |
| 345 | 3300013296 | Ga0157374_10819410 | Ga0157374_108194101 | 259 |
| 346 | 3300013297 | Ga0157378_10028808 | Ga0157378_100288083 | 259 |
| 347 | 3300025272 | Ga0209455_1006523 | Ga0209455_10065233 | 259 |
| 348 | 3300025321 | Ga0207656_10017108 | Ga0207656_100171083 | 259 |
| 349 | 3300025907 | Ga0207645_10031970 | Ga0207645_100319704 | 259 |
| 350 | 3300025919 | Ga0207657_10012074 | Ga0207657_100120742 | 259 |
| 351 | 3300025920 | Ga0207649_10017406 | Ga0207649_100174066 | 259 |
| 352 | 3300025920 | Ga0207649_10058862 | Ga0207649_100588623 | 259 |
| 353 | 3300025924 | Ga0207694_10013185 | Ga0207694_100131855 | 259 |
| 354 | 3300025932 | Ga0207690_10101618 | Ga0207690_101016182 | 259 |
| 355 | 3300025986 | Ga0207658_10212603 | Ga0207658_102126032 | 259 |
| 356 | 3300026023 | Ga0207677_10077077 | Ga0207677_100770773 | 259 |
| 357 | 3300026035 | Ga0207703_10000483 | Ga0207703_1000048320 | 259 |
| 358 | 3300026041 | Ga0207639_10216638 | Ga0207639_102166383 | 259 |
| 359 | 3300026067 | Ga0207678_10004587 | Ga0207678_1000458710 | 259 |
| 360 | 3300026142 | Ga0207698_10420011 | Ga0207698_104200112 | 259 |
| 361 | 3300031616 | Ga0307508_10003330 | Ga0307508_1000333015 | 259 |
| 362 | 3300046506 | Ga0495583_0000242 | Ga0495583_0000242_68903_69736 | 259 |
| 363 | 3300046519 | Ga0495632_0000638 | Ga0495632_0000638_11464_12297 | 259 |
| 364 | 3300046558 | Ga0495633_0014470 | Ga0495633_0014470_2579_3412 | 259 |
| 365 | 3300046692 | Ga0495671_0000012 | Ga0495671_0000012_117058_117891 | 259 |
| 366 | 3300047469 | Ga0495673_0000029 | Ga0495673_0000029_240742_241575 | 259 |
| 367 | 3300049584 | Ga0501068_0128713 | Ga0501068_0128713_441_1298 | 259 |
| 368 | 3300053088 | Ga0500644_0042932 | Ga0500644_0042932_253_1086 | 259 |
| 369 | iso_pu_bacteria | 2599185354 | 2600203025 | 259 |
| 370 | iso_pu_bacteria | 2599185359 | 2600228335 | 259 |
| 371 | iso_pu_bacteria | 2751185897 | 2753767392 | 259 |
| 372 | iso_pu_bacteria | 2818991466 | 2819716069 | 259 |
| 373 | iso_pu_bacteria | 2879163058 | 2879163344 | 259 |
| 374 | iso_pu_bacteria | 2885427238 | 2885427889 | 259 |
| 375 | iso_pu_bacteria | 2885429604 | 2885430235 | 259 |
| 376 | iso_pu_bacteria | 2928526807 | 2928528129 | 259 |
| 377 | iso_pu_bacteria | 2928968154 | 2928971364 | 259 |
| 378 | 3300005548 | Ga0070665_100037912 | Ga0070665_1000379123 | 260 |
| 379 | 3300005618 | Ga0068864_100017243 | Ga0068864_1000172433 | 260 |
| 380 | 3300012513 | Ga0157326_1000962 | Ga0157326_10009624 | 260 |
| 381 | 3300025923 | Ga0207681_10230780 | Ga0207681_102307802 | 260 |
| 382 | 3300026088 | Ga0207641_10001679 | Ga0207641_1000167920 | 260 |
| 383 | 3300026095 | Ga0207676_10000895 | Ga0207676_1000089514 | 260 |
| 384 | 3300028379 | Ga0268266_10038407 | Ga0268266_100384075 | 260 |
| 385 | 3300031911 | Ga0307412_10000220 | Ga0307412_1000022017 | 260 |
| 386 | 3300042876 | Ga0451577_0082626 | Ga0451577_0082626_679_1572 | 260 |
| 387 | 3300044673 | Ga0453683_0031873 | Ga0453683_0031873_2340_3233 | 260 |
| 388 | 3300046453 | Ga0495627_038549 | Ga0495627_038549_162_995 | 260 |
| 389 | 3300046558 | Ga0495633_0025117 | Ga0495633_0025117_2074_2907 | 260 |
| 390 | 3300048907 | Ga0496104_0035400 | Ga0496104_0035400_719_1582 | 260 |
| 391 | 3300048908 | Ga0496105_0004827 | Ga0496105_0004827_2337_3200 | 260 |
| 392 | 3300048910 | Ga0496107_0320023 | Ga0496107_0320023_36_899 | 260 |
| 393 | 3300048917 | Ga0496114_0004797 | Ga0496114_0004797_7246_8109 | 260 |
| 394 | 3300048918 | Ga0496115_0002651 | Ga0496115_0002651_7825_8688 | 260 |
| 395 | 3300048922 | Ga0496119_0092626 | Ga0496119_0092626_534_1373 | 260 |
| 396 | 3300048923 | Ga0496120_0078302 | Ga0496120_0078302_391_1230 | 260 |
| 397 | 3300048927 | Ga0496124_0000907 | Ga0496124_0000907_27885_28718 | 260 |
| 398 | 3300049823 | Ga0501044_0329206 | Ga0501044_0329206_403_1275 | 260 |
| 399 | 3300053157 | Ga0500624_000002 | Ga0500624_000002_33861_34694 | 260 |
| 400 | iso_pu_bacteria | 2643221622 | 2644128216 | 260 |
| 401 | iso_pu_bacteria | 3000865235 | 3000866092 | 260 |
| 402 | 3300003791 | Ga0055530_10000131 | Ga0055530_1000013136 | 261 |
| 403 | 3300003794 | Ga0055531_10000514 | Ga0055531_1000051420 | 261 |
| 404 | 3300005356 | Ga0070674_100415816 | Ga0070674_1004158161 | 261 |
| 405 | 3300025298 | Ga0209050_1000347 | Ga0209050_100034754 | 261 |
| 406 | 3300025304 | Ga0209257_1000371 | Ga0209257_100037154 | 261 |
| 407 | 3300025937 | Ga0207669_10318539 | Ga0207669_103185392 | 261 |
| 408 | 3300030878 | Ga0265770_1001694 | Ga0265770_10016942 | 261 |
| 409 | 3300031090 | Ga0265760_10001598 | Ga0265760_100015981 | 261 |
| 410 | 3300031456 | Ga0307513_10066112 | Ga0307513_100661122 | 261 |
| 411 | 3300033180 | Ga0307510_10007125 | Ga0307510_100071259 | 261 |
| 412 | 3300042005 | Ga0439448_0000532 | Ga0439448_0000532_7197_8060 | 261 |
| 413 | 3300046460 | Ga0495638_0297704 | Ga0495638_0297704_10_843 | 261 |
| 414 | 3300046524 | Ga0495648_0024880 | Ga0495648_0024880_1522_2355 | 261 |
| 415 | 3300046616 | Ga0495668_0009501 | Ga0495668_0009501_4453_5286 | 261 |
| 416 | 3300046660 | Ga0495625_0021310 | Ga0495625_0021310_191_1024 | 261 |
| 417 | 3300048928 | Ga0496125_0070073 | Ga0496125_0070073_445_1326 | 261 |
| 418 | 3300053087 | Ga0500643_001133 | Ga0500643_001133_1295_2128 | 261 |
| 419 | 3300053177 | Ga0500636_0003715 | Ga0500636_0003715_3832_4698 | 261 |
| 420 | 3300002067 | JGI24735J21928_10006905 | JGI24735J21928_100069053 | 262 |
| 421 | 3300002067 | JGI24735J21928_10016675 | JGI24735J21928_100166752 | 262 |
| 422 | 3300005327 | Ga0070658_10005279 | Ga0070658_100052792 | 262 |
| 423 | 3300006358 | Ga0068871_100281337 | Ga0068871_1002813372 | 262 |
| 424 | 3300013297 | Ga0157378_10318207 | Ga0157378_103182072 | 262 |
| 425 | 3300025254 | Ga0209148_1004174 | Ga0209148_10041742 | 262 |
| 426 | 3300025904 | Ga0207647_10092176 | Ga0207647_100921762 | 262 |
| 427 | 3300037418 | Ga0395900_0062831 | Ga0395900_0062831_39_905 | 262 |
| 428 | 3300037418 | Ga0395900_0096292 | Ga0395900_0096292_177_1010 | 262 |
| 429 | 3300038443 | Ga0395901_0200988 | Ga0395901_0200988_225_1058 | 262 |
| 430 | 3300046519 | Ga0495632_0000007 | Ga0495632_0000007_272451_273293 | 262 |
| 431 | 3300046520 | Ga0495637_0010641 | Ga0495637_0010641_2210_3067 | 262 |
| 432 | 3300046522 | Ga0495643_0000070 | Ga0495643_0000070_168598_169455 | 262 |
| 433 | 3300046524 | Ga0495648_0063847 | Ga0495648_0063847_675_1532 | 262 |
| 434 | 3300046525 | Ga0495663_0000005 | Ga0495663_0000005_271470_272312 | 262 |
| 435 | 3300046558 | Ga0495633_0002794 | Ga0495633_0002794_4647_5504 | 262 |
| 436 | 3300046691 | Ga0495670_0003777 | Ga0495670_0003777_5742_6575 | 262 |
| 437 | 3300046692 | Ga0495671_0000039 | Ga0495671_0000039_1425_2282 | 262 |
| 438 | 3300047470 | Ga0495681_0016351 | Ga0495681_0016351_2314_3171 | 262 |
| 439 | 3300047472 | Ga0495686_0039352 | Ga0495686_0039352_848_1690 | 262 |
| 440 | 3300048925 | Ga0496122_0102775 | Ga0496122_0102775_604_1446 | 262 |
| 441 | 3300048927 | Ga0496124_0043808 | Ga0496124_0043808_2381_3232 | 262 |
| 442 | 3300053730 | Ga0500645_026699 | Ga0500645_026699_795_1676 | 262 |
| 443 | 3300055283 | Ga0500661_000742 | Ga0500661_000742_2135_2968 | 262 |
| 444 | iso_pu_bacteria | 2512564014 | 2512645470 | 262 |
| 445 | iso_pu_bacteria | 2582581305 | 2585263050 | 262 |
| 446 | iso_pu_bacteria | 2643221541 | 2643727545 | 262 |
| 447 | iso_pu_bacteria | 2643221605 | 2644037435 | 262 |
| 448 | iso_pu_bacteria | 2643221606 | 2644041295 | 262 |
| 449 | iso_pu_bacteria | 2643221671 | 2644394835 | 262 |
| 450 | iso_pu_bacteria | 2808606401 | 2809062566 | 262 |
| 451 | iso_pu_bacteria | 2808606404 | 2809078750 | 262 |
| 452 | iso_pu_bacteria | 2808606405 | 2809082955 | 262 |
| 453 | iso_pu_bacteria | 2880518877 | 2880521629 | 262 |
| 454 | iso_pu_bacteria | 2919709256 | 2919712115 | 262 |
| 455 | iso_pu_bacteria | 2928027323 | 2928028572 | 262 |
| 456 | iso_pu_bacteria | 2984555340 | 2984555851 | 262 |
| 457 | iso_pu_bacteria | 2984564862 | 2984566040 | 262 |
| 458 | iso_pu_bacteria | 2993356040 | 2993357051 | 262 |
| 459 | iso_pu_bacteria | 8057101203 | 8057105408 | 262 |
| 460 | 3300005327 | Ga0070658_10021879 | Ga0070658_100218793 | 263 |
| 461 | 3300005336 | Ga0070680_100159289 | Ga0070680_1001592893 | 263 |
| 462 | 3300005337 | Ga0070682_100182143 | Ga0070682_1001821432 | 263 |
| 463 | 3300005455 | Ga0070663_100045051 | Ga0070663_1000450513 | 263 |
| 464 | 3300005457 | Ga0070662_100023112 | Ga0070662_1000231125 | 263 |
| 465 | 3300005458 | Ga0070681_10178316 | Ga0070681_101783162 | 263 |
| 466 | 3300005548 | Ga0070665_100000023 | Ga0070665_100000023372 | 263 |
| 467 | 3300005564 | Ga0070664_100010146 | Ga0070664_1000101466 | 263 |
| 468 | 3300005618 | Ga0068864_100000114 | Ga0068864_10000011417 | 263 |
| 469 | 3300005719 | Ga0068861_100273468 | Ga0068861_1002734682 | 263 |
| 470 | 3300005834 | Ga0068851_10039195 | Ga0068851_100391953 | 263 |
| 471 | 3300005842 | Ga0068858_100006035 | Ga0068858_1000060357 | 263 |
| 472 | 3300005844 | Ga0068862_100031816 | Ga0068862_1000318163 | 263 |
| 473 | 3300009093 | Ga0105240_10004567 | Ga0105240_1000456714 | 263 |
| 474 | 3300009177 | Ga0105248_10073612 | Ga0105248_100736124 | 263 |
| 475 | 3300009553 | Ga0105249_10125010 | Ga0105249_101250102 | 263 |
| 476 | 3300010375 | Ga0105239_10000461 | Ga0105239_1000046155 | 263 |
| 477 | 3300013102 | Ga0157371_10018089 | Ga0157371_100180894 | 263 |
| 478 | 3300013102 | Ga0157371_10039485 | Ga0157371_100394853 | 263 |
| 479 | 3300013105 | Ga0157369_10418832 | Ga0157369_104188322 | 263 |
| 480 | 3300013306 | Ga0163162_10151422 | Ga0163162_101514223 | 263 |
| 481 | 3300025909 | Ga0207705_10061000 | Ga0207705_100610002 | 263 |
| 482 | 3300025913 | Ga0207695_10001501 | Ga0207695_1000150118 | 263 |
| 483 | 3300025919 | Ga0207657_10005304 | Ga0207657_100053048 | 263 |
| 484 | 3300025919 | Ga0207657_10074431 | Ga0207657_100744313 | 263 |
| 485 | 3300025921 | Ga0207652_10369282 | Ga0207652_103692822 | 263 |
| 486 | 3300025932 | Ga0207690_10029358 | Ga0207690_100293584 | 263 |
| 487 | 3300025933 | Ga0207706_10036429 | Ga0207706_100364293 | 263 |
| 488 | 3300025941 | Ga0207711_10024879 | Ga0207711_100248794 | 263 |
| 489 | 3300025961 | Ga0207712_10103597 | Ga0207712_101035972 | 263 |
| 490 | 3300026035 | Ga0207703_10003498 | Ga0207703_100034987 | 263 |
| 491 | 3300026067 | Ga0207678_10015794 | Ga0207678_100157947 | 263 |
| 492 | 3300026095 | Ga0207676_10000723 | Ga0207676_1000072310 | 263 |
| 493 | 3300026118 | Ga0207675_100294562 | Ga0207675_1002945622 | 263 |
| 494 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021109 | 263 |
| 495 | 3300028380 | Ga0268265_10005705 | Ga0268265_100057059 | 263 |
| 496 | 3300031911 | Ga0307412_10001641 | Ga0307412_100016418 | 263 |
| 497 | 3300031911 | Ga0307412_10031478 | Ga0307412_100314781 | 263 |
| 498 | 3300032002 | Ga0307416_100144544 | Ga0307416_1001445442 | 263 |
| 499 | 3300037312 | Ga0395899_0029626 | Ga0395899_0029626_2043_2879 | 263 |
| 500 | 3300037312 | Ga0395899_0392378 | Ga0395899_0392378_26_859 | 263 |
| 501 | 3300037418 | Ga0395900_0012204 | Ga0395900_0012204_2381_3217 | 263 |
| 502 | 3300037418 | Ga0395900_0105344 | Ga0395900_0105344_1434_2285 | 263 |
| 503 | 3300037418 | Ga0395900_0109005 | Ga0395900_0109005_1044_1880 | 263 |
| 504 | 3300037418 | Ga0395900_0371191 | Ga0395900_0371191_78_914 | 263 |
| 505 | 3300037466 | Ga0395898_0034211 | Ga0395898_0034211_1056_1892 | 263 |
| 506 | 3300037466 | Ga0395898_0155038 | Ga0395898_0155038_760_1611 | 263 |
| 507 | 3300037466 | Ga0395898_0192783 | Ga0395898_0192783_56_892 | 263 |
| 508 | 3300037471 | Ga0395905_0045374 | Ga0395905_0045374_2025_2867 | 263 |
| 509 | 3300037471 | Ga0395905_0075641 | Ga0395905_0075641_1518_2354 | 263 |
| 510 | 3300038443 | Ga0395901_0065395 | Ga0395901_0065395_1185_2021 | 263 |
| 511 | 3300038443 | Ga0395901_0181149 | Ga0395901_0181149_619_1470 | 263 |
| 512 | 3300038443 | Ga0395901_0403970 | Ga0395901_0403970_83_925 | 263 |
| 513 | 3300042006 | Ga0439432_048699 | Ga0439432_048699_470_1306 | 263 |
| 514 | 3300046809 | Ga0495600_0007940 | Ga0495600_0007940_1249_2082 | 263 |
| 515 | 3300047469 | Ga0495673_0027126 | Ga0495673_0027126_1068_1907 | 263 |
| 516 | 3300047472 | Ga0495686_0000366 | Ga0495686_0000366_12052_12891 | 263 |
| 517 | 3300047472 | Ga0495686_0000430 | Ga0495686_0000430_63353_64186 | 263 |
| 518 | 3300048921 | Ga0496118_0127967 | Ga0496118_0127967_95_928 | 263 |
| 519 | 3300048924 | Ga0496121_0028750 | Ga0496121_0028750_1468_2301 | 263 |
| 520 | 3300049570 | Ga0501033_0022441 | Ga0501033_0022441_1037_1876 | 263 |
| 521 | 3300049583 | Ga0501067_0154404 | Ga0501067_0154404_56_916 | 263 |
| 522 | 3300049663 | Ga0501223_000039 | Ga0501223_000039_31627_32469 | 263 |
| 523 | 3300049705 | Ga0501225_0000010 | Ga0501225_0000010_59388_60230 | 263 |
| 524 | 3300049705 | Ga0501225_0022505 | Ga0501225_0022505_203_1045 | 263 |
| 525 | 3300049823 | Ga0501044_0050810 | Ga0501044_0050810_2500_3339 | 263 |
| 526 | 3300053108 | Ga0500562_013822 | Ga0500562_013822_1110_1949 | 263 |
| 527 | 3300053119 | Ga0500595_023151 | Ga0500595_023151_116_949 | 263 |
| 528 | 3300053136 | Ga0500559_0063063 | Ga0500559_0063063_14_847 | 263 |
| 529 | iso_pu_bacteria | 2643221560 | 2643822192 | 263 |
| 530 | iso_pu_bacteria | 2643221563 | 2643833348 | 263 |
| 531 | iso_pu_bacteria | 2643221608 | 2644054275 | 263 |
| 532 | 3300001990 | JGI24737J22298_10006518 | JGI24737J22298_100065183 | 264 |
| 533 | 3300002067 | JGI24735J21928_10001457 | JGI24735J21928_100014577 | 264 |
| 534 | 3300005355 | Ga0070671_100121806 | Ga0070671_1001218063 | 264 |
| 535 | 3300005364 | Ga0070673_100043642 | Ga0070673_1000436424 | 264 |
| 536 | 3300025931 | Ga0207644_10027862 | Ga0207644_100278624 | 264 |
| 537 | 3300035725 | Ga0373947_0053772 | Ga0373947_0053772_500_1381 | 264 |
| 538 | 3300046520 | Ga0495637_0061206 | Ga0495637_0061206_550_1431 | 264 |
| 539 | 3300046542 | Ga0495597_0010652 | Ga0495597_0010652_2170_3051 | 264 |
| 540 | 3300046684 | Ga0495669_0024586 | Ga0495669_0024586_929_1810 | 264 |
| 541 | 3300048911 | Ga0496108_0043425 | Ga0496108_0043425_2103_2945 | 264 |
| 542 | 3300048912 | Ga0496109_0104635 | Ga0496109_0104635_1045_1887 | 264 |
| 543 | 3300048916 | Ga0496113_0166502 | Ga0496113_0166502_129_971 | 264 |
| 544 | 3300048920 | Ga0496117_0201157 | Ga0496117_0201157_14_877 | 264 |
| 545 | 3300048923 | Ga0496120_0150982 | Ga0496120_0150982_250_1113 | 264 |
| 546 | 3300048927 | Ga0496124_0374694 | Ga0496124_0374694_53_916 | 264 |
| 547 | 3300048928 | Ga0496125_0015219 | Ga0496125_0015219_4472_5314 | 264 |
| 548 | 3300048928 | Ga0496125_0063100 | Ga0496125_0063100_1480_2328 | 264 |
| 549 | 3300053087 | Ga0500643_005562 | Ga0500643_005562_3240_4091 | 264 |
| 550 | 3300053092 | Ga0500583_0080149 | Ga0500583_0080149_200_1081 | 264 |
| 551 | 3300053093 | Ga0500651_0014272 | Ga0500651_0014272_2861_3742 | 264 |
| 552 | 3300053096 | Ga0500641_0025271 | Ga0500641_0025271_103_984 | 264 |
| 553 | 3300053125 | Ga0500618_012199 | Ga0500618_012199_1130_2011 | 264 |
| 554 | 3300053130 | Ga0500642_0003941 | Ga0500642_0003941_2624_3505 | 264 |
| 555 | 3300053133 | Ga0500655_000094 | Ga0500655_000094_6771_7652 | 264 |
| 556 | 3300053148 | Ga0500590_006053 | Ga0500590_006053_417_1298 | 264 |
| 557 | 3300005618 | Ga0068864_100289156 | Ga0068864_1002891562 | 265 |
| 558 | 3300026095 | Ga0207676_10142017 | Ga0207676_101420173 | 265 |
| 559 | 3300041460 | Ga0451802_1408326 | Ga0451802_1408326_788_1639 | 265 |
| 560 | 3300053116 | Ga0500592_001693 | Ga0500592_001693_1756_2610 | 265 |
| 561 | 3300053139 | Ga0500568_0047100 | Ga0500568_0047100_173_1027 | 265 |
| 562 | iso_pu_bacteria | 2946787523 | 2946789583 | 265 |
| 563 | iso_pu_bacteria | 2775507255 | 2778125128 | 266 |
| 564 | 3300025904 | Ga0207647_10091795 | Ga0207647_100917953 | 268 |
| 565 | 3300049822 | Ga0501035_0147740 | Ga0501035_0147740_799_1662 | 268 |
| 566 | 3300001904 | JGI24736J21556_1000173 | JGI24736J21556_10001737 | 270 |
| 567 | 3300001915 | JGI24741J21665_1000026 | JGI24741J21665_100002613 | 270 |
| 568 | 3300001979 | JGI24740J21852_10001292 | JGI24740J21852_100012925 | 270 |
| 569 | 3300001989 | JGI24739J22299_10001495 | JGI24739J22299_100014956 | 270 |
| 570 | 3300002067 | JGI24735J21928_10001790 | JGI24735J21928_100017907 | 270 |
| 571 | 3300002075 | JGI24738J21930_10001463 | JGI24738J21930_100014634 | 270 |
| 572 | 3300005327 | Ga0070658_10033836 | Ga0070658_100338362 | 270 |
| 573 | 3300005455 | Ga0070663_100004887 | Ga0070663_1000048879 | 270 |
| 574 | 3300005457 | Ga0070662_100446875 | Ga0070662_1004468751 | 270 |
| 575 | 3300005563 | Ga0068855_100147492 | Ga0068855_1001474922 | 270 |
| 576 | 3300005614 | Ga0068856_100023313 | Ga0068856_1000233132 | 270 |
| 577 | 3300009174 | Ga0105241_10001330 | Ga0105241_1000133010 | 270 |
| 578 | 3300009545 | Ga0105237_10005899 | Ga0105237_100058992 | 270 |
| 579 | 3300010375 | Ga0105239_10138533 | Ga0105239_101385334 | 270 |
| 580 | 3300013100 | Ga0157373_10151575 | Ga0157373_101515752 | 270 |
| 581 | 3300013104 | Ga0157370_10018262 | Ga0157370_100182622 | 270 |
| 582 | 3300013105 | Ga0157369_10480859 | Ga0157369_104808592 | 270 |
| 583 | 3300025321 | Ga0207656_10007853 | Ga0207656_100078534 | 270 |
| 584 | 3300025904 | Ga0207647_10001988 | Ga0207647_1000198816 | 270 |
| 585 | 3300025909 | Ga0207705_10208736 | Ga0207705_102087362 | 270 |
| 586 | 3300025913 | Ga0207695_10046884 | Ga0207695_100468845 | 270 |
| 587 | 3300025914 | Ga0207671_10029820 | Ga0207671_100298205 | 270 |
| 588 | 3300025924 | Ga0207694_10037902 | Ga0207694_100379022 | 270 |
| 589 | 3300025932 | Ga0207690_10013320 | Ga0207690_100133202 | 270 |
| 590 | 3300025945 | Ga0207679_10139324 | Ga0207679_101393242 | 270 |
| 591 | 3300026041 | Ga0207639_10000252 | Ga0207639_1000025235 | 270 |
| 592 | 3300026067 | Ga0207678_10000857 | Ga0207678_100008576 | 270 |
| 593 | 3300026078 | Ga0207702_10005818 | Ga0207702_1000581811 | 270 |
| 594 | 3300031824 | Ga0307413_10262998 | Ga0307413_102629982 | 270 |
| 595 | 3300053724 | Ga0500570_000135 | Ga0500570_000135_11191_12135 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fq6-assembly1.cif.gz_A | the crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi | 0.915 | 111 | 221 |
| 3ffy-assembly1.cif.gz_A-2 | putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis. | 0.9125 | 111 | 219 |
| 3fq6-assembly1.cif.gz_A | the crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi | 0.8847 | 111 | 221 |
| 3ffy-assembly1.cif.gz_A-2 | putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis. | 0.8818 | 111 | 219 |
| 3kwp-assembly1.cif.gz_A-2 | crystal structure of putative methyltransferase from lactobacillus brevis | 0.8803 | 16 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q338C6_169_282_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9609 | 109 | 219 | 3.30.950.10 |
| 3kwpA02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9542 | 108 | 221 | 3.30.950.10 |
| 5hw4C02 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9414 | 108 | 218 | 3.30.950.10 |
| af_Q338C6_169_282_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9285 | 109 | 219 | 3.30.950.10 |
| af_P9WGW7_115_230_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9254 | 108 | 226 | 3.30.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K2DCQ5-F1-model_v4 | Tetrapyrrole methylase family protein | 0.9596 | 117 | 221 |
GO:0008168
GO:0032259 |
| AF-A0A258BUN3-F1-model_v4 | rRNA (Cytidine-2'-O-)-methyltransferase | 0.9528 | 8 | 95 |
GO:0008168
GO:0032259 |
| AF-X1SAQ7-F1-model_v4 | Tetrapyrrole methylase domain-containing protein | 0.9492 | 102 | 222 |
GO:0005737
GO:0006364 GO:0008168 |
| AF-A0A2M7E8N8-F1-model_v4 | 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase | 0.9446 | 120 | 221 |
GO:0005737
GO:0006364 GO:0008168 GO:0032259 |
| AF-A0A258BUN3-F1-model_v4 | rRNA (Cytidine-2'-O-)-methyltransferase | 0.9423 | 8 | 95 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar