F467452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 595 | 346 | 1190 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10122254|Ga0265327_101222542 |
| Length | 145 |
| Sequence | MSTYFPKAQDQIDRKWFVVDATGLPVGRLSTVVADVLSGKSKPTWTPFLDMGDHVVVINAAKAVFTGKKATQKFYRRTSTQPGSMVEVRADVMKITFPGRIIESAVKGMLPKGPLGRAMYRKLKVYDGGEHQQQSQKPETLAIKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 149 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 150 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 169 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 170 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 171 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 172 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 173 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 174 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 177 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 178 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 179 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 180 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 181 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 182 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 183 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 213 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 214 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 215 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 216 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 217 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 218 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 230 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 231 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 232 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 233 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 234 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 251 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 252 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 253 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 254 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 255 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 259 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 260 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 261 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 262 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 263 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 266 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 267 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 268 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 270 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 295 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 296 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 297 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 298 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 299 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 300 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 301 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 302 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 303 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 304 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 305 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 306 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 307 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 308 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 309 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 310 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 311 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 312 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 313 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 314 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 315 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 316 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 317 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 318 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 319 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 320 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 321 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 322 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 323 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 324 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 325 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 326 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 327 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 328 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 329 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 330 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 331 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 332 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 333 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 334 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 335 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 336 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 337 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 338 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 339 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 340 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 341 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 342 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 343 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 344 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 345 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
| 346 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.81 |
| Metatranscriptomes | 14.29 |
| Isolates | 8.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.34 |
| Bulb | 0 |
| Endosphere | 2.35 |
| Nodule | 0 |
| Rhizoplane | 1.68 |
| Rhizosphere | 85.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265327_10122254 | 3300031251 | Bacteria | 1232 |
| 2 | JGI25151J46595_10030742 | 3300003187 | Bacteria | 2107 |
| 3 | JGI25151J46595_10088366 | 3300003187 | Bacteria | 871 |
| 4 | JGI25407J50210_10001798 | 3300003373 | Bacteria | 4941 |
| 5 | Ga0007417J51691_1092551 | 3300003544 | Bacteria | 897 |
| 6 | Ga0007410J51695_1030879 | 3300003574 | Bacteria | 986 |
| 7 | Ga0007409J51694_1018080 | 3300003575 | Bacteria | 993 |
| 8 | Ga0007416J51690_1080628 | 3300003577 | Bacteria | 944 |
| 9 | Ga0006562J51391_1000361 | 3300003578 | Bacteria | 31803 |
| 10 | JGI25404J52841_10074932 | 3300003659 | Unclassified | 707 |
| 11 | Ga0055538_1000286 | 3300003751 | Bacteria | 25743 |
| 12 | Ga0055535_1000913 | 3300003761 | Bacteria | 19960 |
| 13 | Ga0055536_1038168 | 3300003781 | Bacteria | 1167 |
| 14 | Ga0055541_1000319 | 3300003841 | Bacteria | 15656 |
| 15 | Ga0065704_10225729 | 3300005289 | Unclassified | 1059 |
| 16 | Ga0065704_10322577 | 3300005289 | Bacteria | 850 |
| 17 | Ga0065712_10084153 | 3300005290 | Bacteria | 2786 |
| 18 | Ga0065712_10260472 | 3300005290 | Bacteria | 938 |
| 19 | Ga0065715_10120348 | 3300005293 | Bacteria | 2260 |
| 20 | Ga0065715_10446411 | 3300005293 | Bacteria | 830 |
| 21 | Ga0065715_10515378 | 3300005293 | Bacteria | 768 |
| 22 | Ga0065715_10609574 | 3300005293 | Bacteria | 702 |
| 23 | Ga0065715_11113185 | 3300005293 | Unclassified | 513 |
| 24 | Ga0065707_10020267 | 3300005295 | Unclassified | 1484 |
| 25 | Ga0065707_10279810 | 3300005295 | Bacteria | 1050 |
| 26 | Ga0065707_10570932 | 3300005295 | Bacteria | 708 |
| 27 | Ga0070690_100001592 | 3300005330 | Bacteria | 11918 |
| 28 | Ga0070690_100009058 | 3300005330 | Bacteria | 5755 |
| 29 | Ga0070690_100268012 | 3300005330 | Bacteria | 1214 |
| 30 | Ga0070670_100005446 | 3300005331 | Bacteria | 10735 |
| 31 | Ga0070670_100098512 | 3300005331 | Bacteria | 2516 |
| 32 | Ga0070670_100293758 | 3300005331 | Bacteria | 1421 |
| 33 | Ga0070670_100521739 | 3300005331 | Bacteria | 1058 |
| 34 | Ga0068869_100033509 | 3300005334 | Bacteria | 3626 |
| 35 | Ga0068869_100115605 | 3300005334 | Bacteria | 2046 |
| 36 | Ga0068869_101050827 | 3300005334 | Unclassified | 711 |
| 37 | Ga0068869_102051561 | 3300005334 | Bacteria | 513 |
| 38 | Ga0070682_100000027 | 3300005337 | Bacteria | 188799 |
| 39 | Ga0070682_101131009 | 3300005337 | Unclassified | 657 |
| 40 | Ga0068868_100019896 | 3300005338 | Bacteria | 5034 |
| 41 | Ga0070689_100919858 | 3300005340 | Unclassified | 775 |
| 42 | Ga0070689_101009509 | 3300005340 | Bacteria | 740 |
| 43 | Ga0070691_10315051 | 3300005341 | Bacteria | 859 |
| 44 | Ga0070687_100055679 | 3300005343 | Bacteria | 2066 |
| 45 | Ga0070661_101064997 | 3300005344 | Bacteria | 673 |
| 46 | Ga0070692_10138160 | 3300005345 | Bacteria | 1376 |
| 47 | Ga0070668_100118318 | 3300005347 | Bacteria | 2115 |
| 48 | Ga0070668_100208197 | 3300005347 | Bacteria | 1608 |
| 49 | Ga0070668_100463075 | 3300005347 | Unclassified | 1092 |
| 50 | Ga0070668_100517537 | 3300005347 | Bacteria | 1035 |
| 51 | Ga0070669_100003065 | 3300005353 | Bacteria | 12018 |
| 52 | Ga0070669_100038319 | 3300005353 | Bacteria | 3480 |
| 53 | Ga0070669_100480699 | 3300005353 | Bacteria | 1028 |
| 54 | Ga0070675_100615428 | 3300005354 | Bacteria | 986 |
| 55 | Ga0070674_100373437 | 3300005356 | Bacteria | 1158 |
| 56 | Ga0070673_100203272 | 3300005364 | Bacteria | 1707 |
| 57 | Ga0070673_100206553 | 3300005364 | Bacteria | 1694 |
| 58 | Ga0070688_101065587 | 3300005365 | Unclassified | 645 |
| 59 | Ga0070659_100847858 | 3300005366 | Bacteria | 796 |
| 60 | Ga0070659_100987780 | 3300005366 | Bacteria | 738 |
| 61 | Ga0070667_100095317 | 3300005367 | Bacteria | 2565 |
| 62 | Ga0070703_10101526 | 3300005406 | Bacteria | 1015 |
| 63 | Ga0070701_10008882 | 3300005438 | Bacteria | 4372 |
| 64 | Ga0070701_10893957 | 3300005438 | Bacteria | 612 |
| 65 | Ga0070705_100189144 | 3300005440 | Bacteria | 1401 |
| 66 | Ga0070705_100251844 | 3300005440 | Bacteria | 1240 |
| 67 | Ga0070705_100687571 | 3300005440 | Bacteria | 802 |
| 68 | Ga0070705_100726790 | 3300005440 | Bacteria | 782 |
| 69 | Ga0070705_101193732 | 3300005440 | Unclassified | 626 |
| 70 | Ga0070700_100646403 | 3300005441 | Bacteria | 835 |
| 71 | Ga0070694_100200293 | 3300005444 | Bacteria | 1488 |
| 72 | Ga0070694_100271651 | 3300005444 | Bacteria | 1289 |
| 73 | Ga0070694_100589998 | 3300005444 | Bacteria | 894 |
| 74 | Ga0070694_100705002 | 3300005444 | Bacteria | 821 |
| 75 | Ga0070694_101687716 | 3300005444 | Unclassified | 539 |
| 76 | Ga0070708_100000279 | 3300005445 | Bacteria | 38354 |
| 77 | Ga0070708_100089869 | 3300005445 | Bacteria | 2795 |
| 78 | Ga0070708_102276582 | 3300005445 | Bacteria | 500 |
| 79 | Ga0070662_100226505 | 3300005457 | Bacteria | 1494 |
| 80 | Ga0070662_100293750 | 3300005457 | Bacteria | 1318 |
| 81 | Ga0070662_101103706 | 3300005457 | Bacteria | 681 |
| 82 | Ga0068867_100228145 | 3300005459 | Bacteria | 1504 |
| 83 | Ga0068867_100487661 | 3300005459 | Bacteria | 1057 |
| 84 | Ga0068867_101040130 | 3300005459 | Bacteria | 744 |
| 85 | Ga0070706_100024957 | 3300005467 | Bacteria | 5502 |
| 86 | Ga0070706_100223731 | 3300005467 | Bacteria | 1757 |
| 87 | Ga0070707_100274265 | 3300005468 | Bacteria | 1640 |
| 88 | Ga0070707_100381291 | 3300005468 | Bacteria | 1369 |
| 89 | Ga0070707_100920774 | 3300005468 | Bacteria | 839 |
| 90 | Ga0070698_100019977 | 3300005471 | Bacteria | 7024 |
| 91 | Ga0070698_100036168 | 3300005471 | Bacteria | 5103 |
| 92 | Ga0070698_100047996 | 3300005471 | Bacteria | 4363 |
| 93 | Ga0070699_100004091 | 3300005518 | Bacteria | 12894 |
| 94 | Ga0070699_100022702 | 3300005518 | Bacteria | 5408 |
| 95 | Ga0070699_100410921 | 3300005518 | Bacteria | 1224 |
| 96 | Ga0070699_101502472 | 3300005518 | Bacteria | 618 |
| 97 | Ga0070699_101724264 | 3300005518 | Bacteria | 574 |
| 98 | Ga0070697_100000164 | 3300005536 | Bacteria | 54325 |
| 99 | Ga0070697_100000628 | 3300005536 | Bacteria | 26764 |
| 100 | Ga0070697_100010020 | 3300005536 | Bacteria | 7394 |
| 101 | Ga0070697_100042670 | 3300005536 | Bacteria | 3671 |
| 102 | Ga0068853_101215768 | 3300005539 | Bacteria | 728 |
| 103 | Ga0070672_100298493 | 3300005543 | Bacteria | 1365 |
| 104 | Ga0070672_101583885 | 3300005543 | Bacteria | 587 |
| 105 | Ga0070686_100007160 | 3300005544 | Bacteria | 6216 |
| 106 | Ga0070686_100025604 | 3300005544 | Bacteria | 3552 |
| 107 | Ga0070686_100225128 | 3300005544 | Unclassified | 1357 |
| 108 | Ga0070695_100193165 | 3300005545 | Bacteria | 1450 |
| 109 | Ga0070695_101067121 | 3300005545 | Bacteria | 660 |
| 110 | Ga0070696_100103330 | 3300005546 | Bacteria | 2044 |
| 111 | Ga0070696_100124110 | 3300005546 | Bacteria | 1872 |
| 112 | Ga0070696_100338867 | 3300005546 | Bacteria | 1162 |
| 113 | Ga0070696_100378450 | 3300005546 | Bacteria | 1103 |
| 114 | Ga0070693_100356525 | 3300005547 | Bacteria | 1002 |
| 115 | Ga0070665_101822049 | 3300005548 | Unclassified | 615 |
| 116 | Ga0070704_100104465 | 3300005549 | Bacteria | 2142 |
| 117 | Ga0070704_100112472 | 3300005549 | Bacteria | 2075 |
| 118 | Ga0070704_100189166 | 3300005549 | Bacteria | 1653 |
| 119 | Ga0070704_100472128 | 3300005549 | Bacteria | 1084 |
| 120 | Ga0068857_100321633 | 3300005577 | Bacteria | 1429 |
| 121 | Ga0068857_100346148 | 3300005577 | Bacteria | 1376 |
| 122 | Ga0070702_100126916 | 3300005615 | Bacteria | 1606 |
| 123 | Ga0068859_100290653 | 3300005617 | Bacteria | 1727 |
| 124 | Ga0068859_102529009 | 3300005617 | Bacteria | 565 |
| 125 | Ga0068864_100073142 | 3300005618 | Bacteria | 2988 |
| 126 | Ga0068864_100241574 | 3300005618 | Bacteria | 1673 |
| 127 | Ga0068864_100271418 | 3300005618 | Bacteria | 1581 |
| 128 | Ga0068864_100411734 | 3300005618 | Unclassified | 1286 |
| 129 | Ga0068864_100816114 | 3300005618 | Bacteria | 917 |
| 130 | Ga0068864_100978083 | 3300005618 | Bacteria | 838 |
| 131 | Ga0068864_101073373 | 3300005618 | Unclassified | 801 |
| 132 | Ga0068866_10267019 | 3300005718 | Bacteria | 1054 |
| 133 | Ga0068861_100001094 | 3300005719 | Bacteria | 16773 |
| 134 | Ga0068861_100023094 | 3300005719 | Bacteria | 4484 |
| 135 | Ga0068861_100069112 | 3300005719 | Unclassified | 2731 |
| 136 | Ga0068861_100117186 | 3300005719 | Bacteria | 2143 |
| 137 | Ga0068861_100593071 | 3300005719 | Bacteria | 1016 |
| 138 | Ga0068858_100075792 | 3300005842 | Bacteria | 3125 |
| 139 | Ga0068858_101838163 | 3300005842 | Unclassified | 598 |
| 140 | Ga0068858_102077205 | 3300005842 | Bacteria | 562 |
| 141 | Ga0068860_100317615 | 3300005843 | Bacteria | 1528 |
| 142 | Ga0068860_101830467 | 3300005843 | Bacteria | 629 |
| 143 | Ga0068862_100012881 | 3300005844 | Bacteria | 6917 |
| 144 | Ga0068862_100149958 | 3300005844 | Bacteria | 2075 |
| 145 | Ga0068862_100193364 | 3300005844 | Bacteria | 1832 |
| 146 | Ga0068862_100614775 | 3300005844 | Bacteria | 1045 |
| 147 | Ga0081455_10002928 | 3300005937 | Bacteria | 20018 |
| 148 | Ga0081538_10001072 | 3300005981 | Bacteria | 29085 |
| 149 | Ga0081540_1043210 | 3300005983 | Bacteria | 2315 |
| 150 | Ga0081539_10003050 | 3300005985 | Bacteria | 21639 |
| 151 | Ga0081539_10020392 | 3300005985 | Bacteria | 4483 |
| 152 | Ga0097621_100696783 | 3300006237 | Bacteria | 935 |
| 153 | Ga0068871_100512026 | 3300006358 | Bacteria | 1083 |
| 154 | Ga0075433_10069529 | 3300006852 | Bacteria | 3092 |
| 155 | Ga0075433_10512413 | 3300006852 | Bacteria | 1055 |
| 156 | Ga0075434_100067226 | 3300006871 | Bacteria | 3571 |
| 157 | Ga0075434_100302305 | 3300006871 | Bacteria | 1620 |
| 158 | Ga0068865_100842925 | 3300006881 | Bacteria | 794 |
| 159 | Ga0068865_101540037 | 3300006881 | Unclassified | 596 |
| 160 | Ga0097620_100290634 | 3300006931 | Bacteria | 1727 |
| 161 | Ga0097620_102529499 | 3300006931 | Bacteria | 565 |
| 162 | Ga0075435_100116759 | 3300007076 | Bacteria | 2223 |
| 163 | Ga0099794_10183839 | 3300007265 | Bacteria | 1067 |
| 164 | Ga0105251_10006798 | 3300009011 | Bacteria | 7212 |
| 165 | Ga0105250_10231480 | 3300009092 | Unclassified | 786 |
| 166 | Ga0105240_11123278 | 3300009093 | Bacteria | 835 |
| 167 | Ga0111539_12816828 | 3300009094 | Bacteria | 563 |
| 168 | Ga0105245_10271943 | 3300009098 | Bacteria | 1653 |
| 169 | Ga0105245_10586228 | 3300009098 | Bacteria | 1140 |
| 170 | Ga0105247_10005646 | 3300009101 | Bacteria | 7840 |
| 171 | Ga0105247_10494270 | 3300009101 | Bacteria | 890 |
| 172 | Ga0105247_11164824 | 3300009101 | Bacteria | 612 |
| 173 | Ga0114129_10565859 | 3300009147 | Bacteria | 1476 |
| 174 | Ga0105243_10043067 | 3300009148 | Bacteria | 3537 |
| 175 | Ga0105243_10500887 | 3300009148 | Bacteria | 1151 |
| 176 | Ga0105243_11076214 | 3300009148 | Unclassified | 811 |
| 177 | Ga0105241_10130360 | 3300009174 | Bacteria | 2035 |
| 178 | Ga0105241_10702136 | 3300009174 | Unclassified | 923 |
| 179 | Ga0105242_10871105 | 3300009176 | Bacteria | 898 |
| 180 | Ga0105242_11377576 | 3300009176 | Bacteria | 732 |
| 181 | Ga0105248_11387876 | 3300009177 | Unclassified | 795 |
| 182 | Ga0105249_10000463 | 3300009553 | Bacteria | 37844 |
| 183 | Ga0105249_10196158 | 3300009553 | Bacteria | 1973 |
| 184 | Ga0105249_10687960 | 3300009553 | Bacteria | 1082 |
| 185 | Ga0105239_11683732 | 3300010375 | Unclassified | 734 |
| 186 | Ga0105246_10000488 | 3300011119 | Bacteria | 21462 |
| 187 | Ga0105246_10118387 | 3300011119 | Bacteria | 1958 |
| 188 | Ga0157378_10239809 | 3300013297 | Bacteria | 1731 |
| 189 | Ga0157378_10464736 | 3300013297 | Bacteria | 1258 |
| 190 | Ga0157378_10856339 | 3300013297 | Bacteria | 938 |
| 191 | Ga0157378_10894516 | 3300013297 | Unclassified | 918 |
| 192 | Ga0157378_11992148 | 3300013297 | Bacteria | 630 |
| 193 | Ga0163162_10000452 | 3300013306 | Bacteria | 37968 |
| 194 | Ga0163162_11022739 | 3300013306 | Unclassified | 935 |
| 195 | Ga0163162_11653798 | 3300013306 | Bacteria | 731 |
| 196 | Ga0157375_10093332 | 3300013308 | Bacteria | 3075 |
| 197 | Ga0157375_10756725 | 3300013308 | Bacteria | 1122 |
| 198 | Ga0157375_10902769 | 3300013308 | Bacteria | 1027 |
| 199 | Ga0163163_10016843 | 3300014325 | Bacteria | 6803 |
| 200 | Ga0163163_10276543 | 3300014325 | Bacteria | 1730 |
| 201 | Ga0163163_10317414 | 3300014325 | Bacteria | 1612 |
| 202 | Ga0163163_10711922 | 3300014325 | Bacteria | 1068 |
| 203 | Ga0157380_10009263 | 3300014326 | Bacteria | 7045 |
| 204 | Ga0157380_10021381 | 3300014326 | Bacteria | 4853 |
| 205 | Ga0157380_10882126 | 3300014326 | Unclassified | 919 |
| 206 | Ga0157379_10712087 | 3300014968 | Bacteria | 943 |
| 207 | Ga0157379_10795890 | 3300014968 | Bacteria | 892 |
| 208 | Ga0206356_10440406 | 3300020070 | Unclassified | 619 |
| 209 | Ga0206350_10944546 | 3300020080 | Bacteria | 707 |
| 210 | Ga0224712_10157380 | 3300022467 | Bacteria | 1011 |
| 211 | Ga0209784_100141 | 3300025224 | Bacteria | 67045 |
| 212 | Ga0209566_100221 | 3300025225 | Bacteria | 56770 |
| 213 | Ga0209566_100512 | 3300025225 | Bacteria | 26820 |
| 214 | Ga0209258_104105 | 3300025242 | Bacteria | 2866 |
| 215 | Ga0209675_1008692 | 3300025291 | Bacteria | 3688 |
| 216 | Ga0209676_1010941 | 3300025292 | Bacteria | 3718 |
| 217 | Ga0209025_1000976 | 3300025294 | Bacteria | 42839 |
| 218 | Ga0209025_1033095 | 3300025294 | Bacteria | 2398 |
| 219 | Ga0207696_1144891 | 3300025711 | Unclassified | 635 |
| 220 | Ga0207682_10211187 | 3300025893 | Bacteria | 895 |
| 221 | Ga0207682_10278453 | 3300025893 | Bacteria | 782 |
| 222 | Ga0207682_10358980 | 3300025893 | Bacteria | 687 |
| 223 | Ga0207642_10166443 | 3300025899 | Bacteria | 1189 |
| 224 | Ga0207710_10001099 | 3300025900 | Bacteria | 13880 |
| 225 | Ga0207710_10013708 | 3300025900 | Bacteria | 3411 |
| 226 | Ga0207647_10118177 | 3300025904 | Bacteria | 1564 |
| 227 | Ga0207684_10040952 | 3300025910 | Bacteria | 3928 |
| 228 | Ga0207684_10249188 | 3300025910 | Bacteria | 1532 |
| 229 | Ga0207654_10367490 | 3300025911 | Bacteria | 994 |
| 230 | Ga0207654_10476181 | 3300025911 | Bacteria | 879 |
| 231 | Ga0207671_10377775 | 3300025914 | Bacteria | 1126 |
| 232 | Ga0207662_10006571 | 3300025918 | Bacteria | 6277 |
| 233 | Ga0207652_10085294 | 3300025921 | Bacteria | 2768 |
| 234 | Ga0207646_11188185 | 3300025922 | Unclassified | 669 |
| 235 | Ga0207681_10015195 | 3300025923 | Bacteria | 4800 |
| 236 | Ga0207681_10026245 | 3300025923 | Bacteria | 3755 |
| 237 | Ga0207681_10469016 | 3300025923 | Bacteria | 1027 |
| 238 | Ga0207650_10000891 | 3300025925 | Bacteria | 22578 |
| 239 | Ga0207650_10225893 | 3300025925 | Bacteria | 1508 |
| 240 | Ga0207659_10714644 | 3300025926 | Bacteria | 858 |
| 241 | Ga0207687_10239847 | 3300025927 | Bacteria | 1436 |
| 242 | Ga0207644_10376173 | 3300025931 | Bacteria | 1158 |
| 243 | Ga0207690_10395302 | 3300025932 | Bacteria | 1101 |
| 244 | Ga0207706_10172061 | 3300025933 | Bacteria | 1903 |
| 245 | Ga0207706_10248884 | 3300025933 | Bacteria | 1553 |
| 246 | Ga0207706_10356843 | 3300025933 | Bacteria | 1270 |
| 247 | Ga0207686_10659815 | 3300025934 | Bacteria | 828 |
| 248 | Ga0207686_11037504 | 3300025934 | Bacteria | 667 |
| 249 | Ga0207709_10083939 | 3300025935 | Bacteria | 2061 |
| 250 | Ga0207709_10452603 | 3300025935 | Bacteria | 993 |
| 251 | Ga0207670_10323950 | 3300025936 | Bacteria | 1213 |
| 252 | Ga0207670_10431431 | 3300025936 | Bacteria | 1059 |
| 253 | Ga0207704_10597483 | 3300025938 | Unclassified | 903 |
| 254 | Ga0207704_10782570 | 3300025938 | Bacteria | 796 |
| 255 | Ga0207689_10045053 | 3300025942 | Bacteria | 3648 |
| 256 | Ga0207689_10818194 | 3300025942 | Unclassified | 786 |
| 257 | Ga0207689_11708141 | 3300025942 | Bacteria | 521 |
| 258 | Ga0207679_10138149 | 3300025945 | Bacteria | 1966 |
| 259 | Ga0207651_10083170 | 3300025960 | Bacteria | 2314 |
| 260 | Ga0207651_10212503 | 3300025960 | Bacteria | 1558 |
| 261 | Ga0207712_10000128 | 3300025961 | Bacteria | 79324 |
| 262 | Ga0207712_10133170 | 3300025961 | Bacteria | 1897 |
| 263 | Ga0207712_10278696 | 3300025961 | Bacteria | 1364 |
| 264 | Ga0207712_11219029 | 3300025961 | Unclassified | 672 |
| 265 | Ga0207668_10019795 | 3300025972 | Bacteria | 4262 |
| 266 | Ga0207668_10097275 | 3300025972 | Bacteria | 2178 |
| 267 | Ga0207668_10480066 | 3300025972 | Unclassified | 1066 |
| 268 | Ga0207640_10034237 | 3300025981 | Bacteria | 3168 |
| 269 | Ga0207640_10398422 | 3300025981 | Bacteria | 1120 |
| 270 | Ga0207658_10661638 | 3300025986 | Bacteria | 942 |
| 271 | Ga0207703_10654038 | 3300026035 | Bacteria | 997 |
| 272 | Ga0207708_10310875 | 3300026075 | Bacteria | 1284 |
| 273 | Ga0207702_11455011 | 3300026078 | Bacteria | 679 |
| 274 | Ga0207641_10223821 | 3300026088 | Bacteria | 1746 |
| 275 | Ga0207641_11575699 | 3300026088 | Bacteria | 659 |
| 276 | Ga0207641_12269481 | 3300026088 | Bacteria | 542 |
| 277 | Ga0207648_10103048 | 3300026089 | Bacteria | 2502 |
| 278 | Ga0207648_10222577 | 3300026089 | Bacteria | 1677 |
| 279 | Ga0207648_10542303 | 3300026089 | Bacteria | 1068 |
| 280 | Ga0207676_10241455 | 3300026095 | Bacteria | 1621 |
| 281 | Ga0207676_10391328 | 3300026095 | Bacteria | 1296 |
| 282 | Ga0207676_10519449 | 3300026095 | Bacteria | 1133 |
| 283 | Ga0207674_10102470 | 3300026116 | Bacteria | 2842 |
| 284 | Ga0207674_10139924 | 3300026116 | Bacteria | 2380 |
| 285 | Ga0207674_11094070 | 3300026116 | Bacteria | 766 |
| 286 | Ga0207675_100013331 | 3300026118 | Bacteria | 7671 |
| 287 | Ga0207675_100018047 | 3300026118 | Bacteria | 6580 |
| 288 | Ga0207675_100022156 | 3300026118 | Bacteria | 5915 |
| 289 | Ga0207675_100162072 | 3300026118 | Bacteria | 2134 |
| 290 | Ga0207675_102358029 | 3300026118 | Unclassified | 545 |
| 291 | Ga0207698_10610586 | 3300026142 | Bacteria | 1076 |
| 292 | Ga0268266_10908003 | 3300028379 | Bacteria | 852 |
| 293 | Ga0268266_11718689 | 3300028379 | Unclassified | 603 |
| 294 | Ga0268265_10040491 | 3300028380 | Bacteria | 3442 |
| 295 | Ga0268265_10046861 | 3300028380 | Bacteria | 3234 |
| 296 | Ga0268265_10061860 | 3300028380 | Bacteria | 2874 |
| 297 | Ga0268265_10174484 | 3300028380 | Bacteria | 1841 |
| 298 | Ga0268265_11139341 | 3300028380 | Bacteria | 776 |
| 299 | Ga0268265_11648325 | 3300028380 | Unclassified | 647 |
| 300 | Ga0268264_10078905 | 3300028381 | Bacteria | 2808 |
| 301 | Ga0268264_10243507 | 3300028381 | Bacteria | 1667 |
| 302 | Ga0307511_10021467 | 3300030521 | Bacteria | 6081 |
| 303 | Ga0316183_1010449 | 3300030742 | Bacteria | 723 |
| 304 | Ga0307405_10060380 | 3300031731 | Bacteria | 2392 |
| 305 | Ga0307413_10002971 | 3300031824 | Bacteria | 7020 |
| 306 | Ga0307410_10007070 | 3300031852 | Bacteria | 6115 |
| 307 | Ga0307410_10147685 | 3300031852 | Bacteria | 1746 |
| 308 | Ga0307410_10817150 | 3300031852 | Bacteria | 794 |
| 309 | Ga0307406_10096672 | 3300031901 | Unclassified | 2002 |
| 310 | Ga0307407_10009766 | 3300031903 | Bacteria | 4488 |
| 311 | Ga0307407_10246061 | 3300031903 | Bacteria | 1223 |
| 312 | Ga0307407_10658726 | 3300031903 | Bacteria | 785 |
| 313 | Ga0307407_10728229 | 3300031903 | Bacteria | 749 |
| 314 | Ga0307407_10952776 | 3300031903 | Bacteria | 661 |
| 315 | Ga0307409_100050397 | 3300031995 | Bacteria | 3179 |
| 316 | Ga0307409_100205254 | 3300031995 | Bacteria | 1766 |
| 317 | Ga0307409_100397510 | 3300031995 | Bacteria | 1315 |
| 318 | Ga0307409_100477765 | 3300031995 | Bacteria | 1209 |
| 319 | Ga0307409_100519587 | 3300031995 | Bacteria | 1163 |
| 320 | Ga0307409_100659700 | 3300031995 | Unclassified | 1041 |
| 321 | Ga0307416_100381607 | 3300032002 | Bacteria | 1440 |
| 322 | Ga0307414_10683521 | 3300032004 | Bacteria | 928 |
| 323 | Ga0307414_11409254 | 3300032004 | Bacteria | 648 |
| 324 | Ga0307411_10004156 | 3300032005 | Bacteria | 6880 |
| 325 | Ga0307411_10026931 | 3300032005 | Bacteria | 3469 |
| 326 | Ga0307415_100024811 | 3300032126 | Bacteria | 3752 |
| 327 | Ga0307415_100077388 | 3300032126 | Bacteria | 2362 |
| 328 | Ga0307415_100621080 | 3300032126 | Bacteria | 965 |
| 329 | Ga0307415_101141288 | 3300032126 | Bacteria | 731 |
| 330 | Ga0316596_1076620 | 3300033541 | Bacteria | 897 |
| 331 | Ga0373930_0196902 | 3300034816 | Unclassified | 523 |
| 332 | Ga0373939_0320009 | 3300035114 | Unclassified | 623 |
| 333 | Ga0373960_0302684 | 3300035121 | Bacteria | 595 |
| 334 | Ga0395900_1617923 | 3300037418 | Unclassified | 559 |
| 335 | Ga0395898_0918479 | 3300037466 | Bacteria | 813 |
| 336 | Ga0395905_0356906 | 3300037471 | Bacteria | 1354 |
| 337 | Ga0395905_1276434 | 3300037471 | Unclassified | 638 |
| 338 | Ga0395901_0687753 | 3300038443 | Bacteria | 1022 |
| 339 | Ga0242422_04110 | 3300038699 | Bacteria | 927 |
| 340 | Ga0439436_0002823 | 3300041404 | Bacteria | 5262 |
| 341 | Ga0439438_120840 | 3300041405 | Unclassified | 630 |
| 342 | Ga0439439_0007382 | 3300041406 | Bacteria | 2569 |
| 343 | Ga0451792_18439 | 3300041445 | Bacteria | 676 |
| 344 | Ga0451805_119312 | 3300041461 | Bacteria | 734 |
| 345 | Ga0451843_0726711 | 3300041509 | Unclassified | 729 |
| 346 | Ga0451853_0525864 | 3300041512 | Unclassified | 662 |
| 347 | Ga0439433_0018955 | 3300041999 | Bacteria | 1532 |
| 348 | Ga0439433_0117183 | 3300041999 | Unclassified | 670 |
| 349 | Ga0439445_0236830 | 3300042004 | Unclassified | 544 |
| 350 | Ga0439432_089988 | 3300042006 | Unclassified | 924 |
| 351 | Ga0439432_171079 | 3300042006 | Unclassified | 634 |
| 352 | Ga0439449_0000074 | 3300042007 | Bacteria | 31794 |
| 353 | Ga0439449_0158547 | 3300042007 | Unclassified | 845 |
| 354 | Ga0439457_006395 | 3300042014 | Bacteria | 2890 |
| 355 | Ga0439462_0002581 | 3300042015 | Bacteria | 4228 |
| 356 | Ga0439462_0011797 | 3300042015 | Bacteria | 2228 |
| 357 | Ga0439434_0018670 | 3300042435 | Bacteria | 2077 |
| 358 | Ga0439434_0135374 | 3300042435 | Unclassified | 810 |
| 359 | Ga0439444_0118779 | 3300042437 | Bacteria | 615 |
| 360 | Ga0453684_0635899 | 3300044712 | Bacteria | 1166 |
| 361 | Ga0451576_0529434 | 3300045051 | Bacteria | 1238 |
| 362 | Ga0451576_0559850 | 3300045051 | Bacteria | 1201 |
| 363 | Ga0451576_0821537 | 3300045051 | Bacteria | 976 |
| 364 | Ga0451576_1901281 | 3300045051 | Bacteria | 614 |
| 365 | Ga0466967_0302641 | 3300045976 | Bacteria | 1539 |
| 366 | Ga0495627_060719 | 3300046453 | Bacteria | 1119 |
| 367 | Ga0495590_0036527 | 3300046457 | Bacteria | 1714 |
| 368 | Ga0495591_037803 | 3300046458 | Bacteria | 1394 |
| 369 | Ga0495596_0197265 | 3300046500 | Bacteria | 782 |
| 370 | Ga0495606_0043775 | 3300046507 | Bacteria | 2982 |
| 371 | Ga0495606_0150220 | 3300046507 | Bacteria | 1368 |
| 372 | Ga0495663_0000452 | 3300046525 | Bacteria | 15039 |
| 373 | Ga0495598_0009969 | 3300046537 | Bacteria | 2261 |
| 374 | Ga0495621_0000159 | 3300046539 | Bacteria | 15029 |
| 375 | Ga0495622_0268970 | 3300046557 | Bacteria | 747 |
| 376 | Ga0495656_0137702 | 3300046615 | Bacteria | 1168 |
| 377 | Ga0495656_0337847 | 3300046615 | Unclassified | 778 |
| 378 | Ga0495649_0179138 | 3300046694 | Bacteria | 1106 |
| 379 | Ga0495660_0028392 | 3300046810 | Bacteria | 3161 |
| 380 | Ga0495636_0075945 | 3300047318 | Bacteria | 1441 |
| 381 | Ga0495672_0142505 | 3300047320 | Unclassified | 1250 |
| 382 | Ga0495685_160993 | 3300047447 | Bacteria | 727 |
| 383 | Ga0495681_0205285 | 3300047470 | Bacteria | 797 |
| 384 | Ga0495626_0019091 | 3300048091 | Bacteria | 3431 |
| 385 | Ga0495626_0136327 | 3300048091 | Bacteria | 1044 |
| 386 | Ga0496106_0019234 | 3300048909 | Bacteria | 5065 |
| 387 | Ga0496106_1134239 | 3300048909 | Bacteria | 612 |
| 388 | Ga0496108_0033874 | 3300048911 | Bacteria | 4243 |
| 389 | Ga0496109_1351344 | 3300048912 | Bacteria | 648 |
| 390 | Ga0496110_1622150 | 3300048913 | Unclassified | 557 |
| 391 | Ga0496111_0579033 | 3300048914 | Bacteria | 823 |
| 392 | Ga0496112_1580719 | 3300048915 | Bacteria | 569 |
| 393 | Ga0496116_0003008 | 3300048919 | Bacteria | 17086 |
| 394 | Ga0496116_0013016 | 3300048919 | Bacteria | 6746 |
| 395 | Ga0496116_0018736 | 3300048919 | Bacteria | 5321 |
| 396 | Ga0496116_0058376 | 3300048919 | Bacteria | 2516 |
| 397 | Ga0496116_0105130 | 3300048919 | Bacteria | 1675 |
| 398 | Ga0496116_0407427 | 3300048919 | Bacteria | 599 |
| 399 | Ga0496117_0011793 | 3300048920 | Bacteria | 7784 |
| 400 | Ga0496117_0020536 | 3300048920 | Bacteria | 5379 |
| 401 | Ga0496117_0227159 | 3300048920 | Bacteria | 1034 |
| 402 | Ga0496118_0010978 | 3300048921 | Bacteria | 8900 |
| 403 | Ga0496119_0000469 | 3300048922 | Bacteria | 54992 |
| 404 | Ga0496119_0018355 | 3300048922 | Bacteria | 5213 |
| 405 | Ga0496119_0361620 | 3300048922 | Bacteria | 700 |
| 406 | Ga0496120_0001942 | 3300048923 | Bacteria | 22686 |
| 407 | Ga0496120_0005342 | 3300048923 | Bacteria | 10287 |
| 408 | Ga0496120_0183298 | 3300048923 | Bacteria | 1026 |
| 409 | Ga0496121_0033713 | 3300048924 | Bacteria | 4627 |
| 410 | Ga0496121_0671296 | 3300048924 | Bacteria | 628 |
| 411 | Ga0496122_0004250 | 3300048925 | Bacteria | 17968 |
| 412 | Ga0496122_0055545 | 3300048925 | Bacteria | 2961 |
| 413 | Ga0496122_0113059 | 3300048925 | Bacteria | 1775 |
| 414 | Ga0496122_0125425 | 3300048925 | Bacteria | 1644 |
| 415 | Ga0496122_0206519 | 3300048925 | Bacteria | 1142 |
| 416 | Ga0496122_0219743 | 3300048925 | Bacteria | 1091 |
| 417 | Ga0496123_0009904 | 3300048926 | Bacteria | 8505 |
| 418 | Ga0496123_0022954 | 3300048926 | Bacteria | 4791 |
| 419 | Ga0496123_0087199 | 3300048926 | Bacteria | 1868 |
| 420 | Ga0496123_0208833 | 3300048926 | Bacteria | 994 |
| 421 | Ga0496123_0402577 | 3300048926 | Bacteria | 622 |
| 422 | Ga0496124_0000697 | 3300048927 | Bacteria | 55040 |
| 423 | Ga0496124_0006669 | 3300048927 | Bacteria | 12517 |
| 424 | Ga0496124_0107157 | 3300048927 | Bacteria | 2255 |
| 425 | Ga0496125_0001385 | 3300048928 | Bacteria | 35466 |
| 426 | Ga0496125_0006867 | 3300048928 | Bacteria | 12194 |
| 427 | Ga0496125_0064220 | 3300048928 | Bacteria | 2919 |
| 428 | Ga0496125_0251917 | 3300048928 | Bacteria | 1113 |
| 429 | Ga0496126_0004931 | 3300048929 | Bacteria | 15577 |
| 430 | Ga0496126_0077922 | 3300048929 | Bacteria | 2937 |
| 431 | Ga0501306_002875 | 3300049127 | Bacteria | 1807 |
| 432 | Ga0501306_007831 | 3300049127 | Bacteria | 1289 |
| 433 | Ga0501306_012517 | 3300049127 | Bacteria | 1094 |
| 434 | Ga0501306_022909 | 3300049127 | Bacteria | 884 |
| 435 | Ga0501306_029958 | 3300049127 | Bacteria | 804 |
| 436 | Ga0501306_044943 | 3300049127 | Unclassified | 694 |
| 437 | Ga0501306_098674 | 3300049127 | Unclassified | 520 |
| 438 | Ga0501308_016454 | 3300049128 | Bacteria | 886 |
| 439 | Ga0501309_001139 | 3300049129 | Bacteria | 2497 |
| 440 | Ga0501309_015650 | 3300049129 | Bacteria | 1028 |
| 441 | Ga0501309_025141 | 3300049129 | Bacteria | 855 |
| 442 | Ga0501310_017432 | 3300049130 | Bacteria | 869 |
| 443 | Ga0501310_029164 | 3300049130 | Bacteria | 726 |
| 444 | Ga0501304_010183 | 3300049160 | Bacteria | 818 |
| 445 | Ga0501305_008999 | 3300049161 | Bacteria | 1304 |
| 446 | Ga0501305_009999 | 3300049161 | Bacteria | 1258 |
| 447 | Ga0501307_005857 | 3300049162 | Bacteria | 1309 |
| 448 | Ga0501307_006027 | 3300049162 | Bacteria | 1296 |
| 449 | Ga0495678_072001 | 3300049459 | Bacteria | 1264 |
| 450 | Ga0501292_021489 | 3300049515 | Bacteria | 1045 |
| 451 | Ga0501293_005660 | 3300049516 | Bacteria | 1005 |
| 452 | Ga0501296_002825 | 3300049519 | Bacteria | 1838 |
| 453 | Ga0501298_003896 | 3300049521 | Bacteria | 2330 |
| 454 | Ga0501299_004790 | 3300049522 | Bacteria | 2046 |
| 455 | Ga0501311_009516 | 3300049527 | Bacteria | 1162 |
| 456 | Ga0501311_043227 | 3300049527 | Bacteria | 688 |
| 457 | Ga0501311_044677 | 3300049527 | Unclassified | 680 |
| 458 | Ga0501312_010059 | 3300049528 | Bacteria | 1259 |
| 459 | Ga0501312_022606 | 3300049528 | Bacteria | 943 |
| 460 | Ga0501312_029385 | 3300049528 | Bacteria | 856 |
| 461 | Ga0501312_031968 | 3300049528 | Bacteria | 829 |
| 462 | Ga0501313_009179 | 3300049529 | Bacteria | 1112 |
| 463 | Ga0501313_015011 | 3300049529 | Bacteria | 921 |
| 464 | Ga0501313_020363 | 3300049529 | Bacteria | 816 |
| 465 | Ga0501313_027049 | 3300049529 | Bacteria | 732 |
| 466 | Ga0501313_070309 | 3300049529 | Unclassified | 506 |
| 467 | Ga0501315_019492 | 3300049531 | Bacteria | 903 |
| 468 | Ga0501316_006875 | 3300049532 | Bacteria | 1222 |
| 469 | Ga0501316_014218 | 3300049532 | Bacteria | 948 |
| 470 | Ga0501317_008368 | 3300049533 | Bacteria | 1191 |
| 471 | Ga0501317_012184 | 3300049533 | Bacteria | 1058 |
| 472 | Ga0501318_030999 | 3300049534 | Bacteria | 727 |
| 473 | Ga0501319_007726 | 3300049535 | Bacteria | 817 |
| 474 | Ga0501320_029880 | 3300049536 | Bacteria | 674 |
| 475 | Ga0501321_015741 | 3300049537 | Bacteria | 894 |
| 476 | Ga0501321_019290 | 3300049537 | Bacteria | 835 |
| 477 | Ga0501323_013738 | 3300049539 | Bacteria | 1005 |
| 478 | Ga0501324_007387 | 3300049540 | Bacteria | 948 |
| 479 | Ga0501324_012030 | 3300049540 | Bacteria | 806 |
| 480 | Ga0501324_012530 | 3300049540 | Bacteria | 794 |
| 481 | Ga0501326_02279 | 3300049542 | Bacteria | 936 |
| 482 | Ga0501335_005754 | 3300049551 | Bacteria | 1115 |
| 483 | Ga0501335_011403 | 3300049551 | Bacteria | 868 |
| 484 | Ga0501338_04393 | 3300049554 | Bacteria | 854 |
| 485 | Ga0501038_0005686 | 3300049574 | Bacteria | 11567 |
| 486 | Ga0501202_004197 | 3300049652 | Bacteria | 2516 |
| 487 | Ga0501207_075118 | 3300049654 | Unclassified | 641 |
| 488 | Ga0501208_084498 | 3300049655 | Bacteria | 658 |
| 489 | Ga0501217_009713 | 3300049661 | Bacteria | 2097 |
| 490 | Ga0501217_059403 | 3300049661 | Bacteria | 1017 |
| 491 | Ga0501223_035817 | 3300049663 | Bacteria | 965 |
| 492 | Ga0501233_146174 | 3300049668 | Unclassified | 656 |
| 493 | Ga0501235_050542 | 3300049669 | Unclassified | 963 |
| 494 | Ga0501239_008750 | 3300049672 | Bacteria | 1087 |
| 495 | Ga0501243_038383 | 3300049675 | Unclassified | 835 |
| 496 | Ga0501249_033725 | 3300049679 | Bacteria | 1147 |
| 497 | Ga0501255_061306 | 3300049684 | Unclassified | 598 |
| 498 | Ga0501257_012972 | 3300049686 | Bacteria | 1909 |
| 499 | Ga0501221_113032 | 3300049704 | Unclassified | 686 |
| 500 | Ga0501225_0048972 | 3300049705 | Bacteria | 1174 |
| 501 | Ga0501262_038395 | 3300049759 | Unclassified | 709 |
| 502 | Ga0501263_035116 | 3300049760 | Unclassified | 720 |
| 503 | Ga0501264_010438 | 3300049761 | Bacteria | 894 |
| 504 | Ga0501267_004977 | 3300049764 | Bacteria | 1248 |
| 505 | Ga0501272_011394 | 3300049769 | Bacteria | 1001 |
| 506 | Ga0501279_017167 | 3300049775 | Bacteria | 1012 |
| 507 | Ga0501279_029773 | 3300049775 | Bacteria | 806 |
| 508 | Ga0501283_042275 | 3300049779 | Unclassified | 791 |
| 509 | nmdc:mga05p37_141231_c1 | 3300050507 | Bacteria | 1649 |
| 510 | nmdc:mga05p37_93723_c1 | 3300050507 | Bacteria | 3700 |
| 511 | nmdc:mga0n895_493097_c1 | 3300050512 | Bacteria | 1235 |
| 512 | nmdc:mga0n895_560157_c1 | 3300050512 | Bacteria | 1148 |
| 513 | nmdc:mga0rr50_265_c1 | 3300050513 | Bacteria | 28369 |
| 514 | nmdc:mga08x19_3_c1 | 3300050514 | Bacteria | 654433 |
| 515 | nmdc:mga0a205_42199_c1 | 3300050515 | Bacteria | 4395 |
| 516 | nmdc:mga0a205_873944_c1 | 3300050515 | Unclassified | 746 |
| 517 | Ga0587066_018373 | 3300059490 | Bacteria | 1125 |
| 518 | Ga0587070_019658 | 3300059491 | Bacteria | 1121 |
| 519 | Ga0587077_019559 | 3300059493 | Bacteria | 1180 |
| 520 | Ga0587080_014264 | 3300059503 | Bacteria | 1227 |
| 521 | Ga0587080_090210 | 3300059503 | Bacteria | 642 |
| 522 | Ga0587082_026371 | 3300059504 | Bacteria | 983 |
| 523 | Ga0587082_027557 | 3300059504 | Bacteria | 969 |
| 524 | Ga0587083_0002073 | 3300059505 | Bacteria | 2421 |
| 525 | Ga0587083_0041110 | 3300059505 | Bacteria | 969 |
| 526 | Ga0587088_017437 | 3300059508 | Bacteria | 1156 |
| 527 | Ga0587106_024053 | 3300059605 | Bacteria | 929 |
| 528 | Ga0587128_030847 | 3300059630 | Bacteria | 887 |
| 529 | Ga0587067_008422 | 3300059640 | Bacteria | 1506 |
| 530 | Ga0587067_018744 | 3300059640 | Bacteria | 1164 |
| 531 | Ga0587067_039871 | 3300059640 | Bacteria | 908 |
| 532 | Ga0587067_072301 | 3300059640 | Bacteria | 747 |
| 533 | Ga0587072_037420 | 3300059643 | Bacteria | 931 |
| 534 | Ga0587075_010803 | 3300059644 | Bacteria | 1214 |
| 535 | Ga0587076_018092 | 3300059645 | Bacteria | 1131 |
| 536 | Ga0587078_014225 | 3300059646 | Bacteria | 949 |
| 537 | Ga0587079_018339 | 3300059647 | Bacteria | 1226 |
| 538 | Ga0587079_021792 | 3300059647 | Bacteria | 1156 |
| 539 | Ga0587079_058241 | 3300059647 | Bacteria | 830 |
| 540 | Ga0587124_001812 | 3300059660 | Bacteria | 1438 |
| 541 | Ga0587060_004808 | 3300060243 | Bacteria | 1039 |
| 542 | Ga0587111_0098859 | 3300060346 | Bacteria | 724 |
| 543 | 2524190026 | 2524023129 | Bacteria | 6762600 |
| 544 | 2550903246 | 2548877040 | Bacteria | 7507281 |
| 545 | 2563930218 | 2563366752 | Bacteria | 4961801 |
| 546 | 2571530781 | 2571042143 | Bacteria | 6986194 |
| 547 | 2573041391 | 2571042588 | Bacteria | 5045676 |
| 548 | 2578338857 | 2576861424 | Bacteria | 5270569 |
| 549 | 2580935251 | 2579778775 | Bacteria | 5360914 |
| 550 | 2595320848 | 2593339198 | Bacteria | 7267884 |
| 551 | 2601641784 | 2600255286 | Bacteria | 5390125 |
| 552 | 2621273271 | 2619619294 | Bacteria | 5575484 |
| 553 | 2643738869 | 2643221543 | Bacteria | 6628015 |
| 554 | 2723606169 | 2721755693 | Bacteria | 6126117 |
| 555 | 2728529920 | 2728368933 | Bacteria | 7044283 |
| 556 | 2730136792 | 2728369359 | Bacteria | 5621728 |
| 557 | 2753813053 | 2751185905 | Bacteria | 6142767 |
| 558 | 2793182045 | 2791355222 | Bacteria | 5898266 |
| 559 | 2802440750 | 2802428803 | Bacteria | 5806948 |
| 560 | 2821118348 | 2821111986 | Bacteria | 6894338 |
| 561 | 2864738844 | 2864733723 | Bacteria | 6770668 |
| 562 | 2865007667 | 2865002811 | Bacteria | 6333767 |
| 563 | 2881639950 | 2881636855 | Bacteria | 5205297 |
| 564 | 2885529888 | 2885526491 | Bacteria | 7164189 |
| 565 | 2888584435 | 2888578766 | Bacteria | 6743310 |
| 566 | 2889047982 | 2889042446 | Bacteria | 7618936 |
| 567 | 2889053119 | 2889049205 | Bacteria | 7524325 |
| 568 | 2889276720 | 2889276214 | Bacteria | 5979355 |
| 569 | 2904168181 | 2904162308 | Bacteria | 7086713 |
| 570 | 2904496922 | 2904490793 | Bacteria | 7046938 |
| 571 | 2904600807 | 2904595352 | Bacteria | 6124848 |
| 572 | 2907208173 | 2907202186 | Bacteria | 6632024 |
| 573 | 2919166275 | 2919160200 | Bacteria | 6929020 |
| 574 | 2931385088 | 2931384279 | Bacteria | 7299545 |
| 575 | 2938653360 | 2938649242 | Bacteria | 7118381 |
| 576 | 2939685150 | 2939679117 | Bacteria | 6921672 |
| 577 | 2939707630 | 2939702853 | Bacteria | 5139229 |
| 578 | 2945996289 | 2945991243 | Bacteria | 7008369 |
| 579 | 2946058979 | 2946053406 | Bacteria | 6978655 |
| 580 | 2968562336 | 2968558590 | Bacteria | 6956864 |
| 581 | 2971406782 | 2971403814 | Bacteria | 7370929 |
| 582 | 2971513816 | 2971511577 | Bacteria | 5404012 |
| 583 | 2980128601 | 2980125574 | Bacteria | 5567337 |
| 584 | 2980179468 | 2980176882 | Bacteria | 5397533 |
| 585 | 2984531134 | 2984527788 | Bacteria | 5288478 |
| 586 | 2984537243 | 2984532647 | Bacteria | 5288506 |
| 587 | 2988229843 | 2988225383 | Bacteria | 7221625 |
| 588 | 2996636968 | 2996632988 | Bacteria | 6921523 |
| 589 | 2996709592 | 2996706504 | Bacteria | 5757485 |
| 590 | 648172160 | 648028048 | Bacteria | 5394884 |
| 591 | 8046991273 | 8046991243 | Bacteria | 8497463 |
| 592 | 8054471283 | 8054465665 | Bacteria | 7323556 |
| 593 | 8057473353 | 8057473075 | Bacteria | 5892720 |
| 594 | 8057735113 | 8057733483 | Bacteria | 6578323 |
| 595 | 8057979898 | 8057977335 | Bacteria | 5694872 |
| 596 | Ga0265327_10122254 | |||
| 597 | JGI25151J46595_10030742 | |||
| 598 | JGI25151J46595_10088366 | |||
| 599 | JGI25407J50210_10001798 | |||
| 600 | Ga0007417J51691_1092551 | |||
| 601 | Ga0007410J51695_1030879 | |||
| 602 | Ga0007409J51694_1018080 | |||
| 603 | Ga0007416J51690_1080628 | |||
| 604 | Ga0006562J51391_1000361 | |||
| 605 | JGI25404J52841_10074932 | |||
| 606 | Ga0055538_1000286 | |||
| 607 | Ga0055535_1000913 | |||
| 608 | Ga0055536_1038168 | |||
| 609 | Ga0055541_1000319 | |||
| 610 | Ga0065704_10225729 | |||
| 611 | Ga0065704_10322577 | |||
| 612 | Ga0065712_10084153 | |||
| 613 | Ga0065712_10260472 | |||
| 614 | Ga0065715_10120348 | |||
| 615 | Ga0065715_10446411 | |||
| 616 | Ga0065715_10515378 | |||
| 617 | Ga0065715_10609574 | |||
| 618 | Ga0065715_11113185 | |||
| 619 | Ga0065707_10020267 | |||
| 620 | Ga0065707_10279810 | |||
| 621 | Ga0065707_10570932 | |||
| 622 | Ga0070690_100001592 | |||
| 623 | Ga0070690_100009058 | |||
| 624 | Ga0070690_100268012 | |||
| 625 | Ga0070670_100005446 | |||
| 626 | Ga0070670_100098512 | |||
| 627 | Ga0070670_100293758 | |||
| 628 | Ga0070670_100521739 | |||
| 629 | Ga0068869_100033509 | |||
| 630 | Ga0068869_100115605 | |||
| 631 | Ga0068869_101050827 | |||
| 632 | Ga0068869_102051561 | |||
| 633 | Ga0070682_100000027 | |||
| 634 | Ga0070682_101131009 | |||
| 635 | Ga0068868_100019896 | |||
| 636 | Ga0070689_100919858 | |||
| 637 | Ga0070689_101009509 | |||
| 638 | Ga0070691_10315051 | |||
| 639 | Ga0070687_100055679 | |||
| 640 | Ga0070661_101064997 | |||
| 641 | Ga0070692_10138160 | |||
| 642 | Ga0070668_100118318 | |||
| 643 | Ga0070668_100208197 | |||
| 644 | Ga0070668_100463075 | |||
| 645 | Ga0070668_100517537 | |||
| 646 | Ga0070669_100003065 | |||
| 647 | Ga0070669_100038319 | |||
| 648 | Ga0070669_100480699 | |||
| 649 | Ga0070675_100615428 | |||
| 650 | Ga0070674_100373437 | |||
| 651 | Ga0070673_100203272 | |||
| 652 | Ga0070673_100206553 | |||
| 653 | Ga0070688_101065587 | |||
| 654 | Ga0070659_100847858 | |||
| 655 | Ga0070659_100987780 | |||
| 656 | Ga0070667_100095317 | |||
| 657 | Ga0070703_10101526 | |||
| 658 | Ga0070701_10008882 | |||
| 659 | Ga0070701_10893957 | |||
| 660 | Ga0070705_100189144 | |||
| 661 | Ga0070705_100251844 | |||
| 662 | Ga0070705_100687571 | |||
| 663 | Ga0070705_100726790 | |||
| 664 | Ga0070705_101193732 | |||
| 665 | Ga0070700_100646403 | |||
| 666 | Ga0070694_100200293 | |||
| 667 | Ga0070694_100271651 | |||
| 668 | Ga0070694_100589998 | |||
| 669 | Ga0070694_100705002 | |||
| 670 | Ga0070694_101687716 | |||
| 671 | Ga0070708_100000279 | |||
| 672 | Ga0070708_100089869 | |||
| 673 | Ga0070708_102276582 | |||
| 674 | Ga0070662_100226505 | |||
| 675 | Ga0070662_100293750 | |||
| 676 | Ga0070662_101103706 | |||
| 677 | Ga0068867_100228145 | |||
| 678 | Ga0068867_100487661 | |||
| 679 | Ga0068867_101040130 | |||
| 680 | Ga0070706_100024957 | |||
| 681 | Ga0070706_100223731 | |||
| 682 | Ga0070707_100274265 | |||
| 683 | Ga0070707_100381291 | |||
| 684 | Ga0070707_100920774 | |||
| 685 | Ga0070698_100019977 | |||
| 686 | Ga0070698_100036168 | |||
| 687 | Ga0070698_100047996 | |||
| 688 | Ga0070699_100004091 | |||
| 689 | Ga0070699_100022702 | |||
| 690 | Ga0070699_100410921 | |||
| 691 | Ga0070699_101502472 | |||
| 692 | Ga0070699_101724264 | |||
| 693 | Ga0070697_100000164 | |||
| 694 | Ga0070697_100000628 | |||
| 695 | Ga0070697_100010020 | |||
| 696 | Ga0070697_100042670 | |||
| 697 | Ga0068853_101215768 | |||
| 698 | Ga0070672_100298493 | |||
| 699 | Ga0070672_101583885 | |||
| 700 | Ga0070686_100007160 | |||
| 701 | Ga0070686_100025604 | |||
| 702 | Ga0070686_100225128 | |||
| 703 | Ga0070695_100193165 | |||
| 704 | Ga0070695_101067121 | |||
| 705 | Ga0070696_100103330 | |||
| 706 | Ga0070696_100124110 | |||
| 707 | Ga0070696_100338867 | |||
| 708 | Ga0070696_100378450 | |||
| 709 | Ga0070693_100356525 | |||
| 710 | Ga0070665_101822049 | |||
| 711 | Ga0070704_100104465 | |||
| 712 | Ga0070704_100112472 | |||
| 713 | Ga0070704_100189166 | |||
| 714 | Ga0070704_100472128 | |||
| 715 | Ga0068857_100321633 | |||
| 716 | Ga0068857_100346148 | |||
| 717 | Ga0070702_100126916 | |||
| 718 | Ga0068859_100290653 | |||
| 719 | Ga0068859_102529009 | |||
| 720 | Ga0068864_100073142 | |||
| 721 | Ga0068864_100241574 | |||
| 722 | Ga0068864_100271418 | |||
| 723 | Ga0068864_100411734 | |||
| 724 | Ga0068864_100816114 | |||
| 725 | Ga0068864_100978083 | |||
| 726 | Ga0068864_101073373 | |||
| 727 | Ga0068866_10267019 | |||
| 728 | Ga0068861_100001094 | |||
| 729 | Ga0068861_100023094 | |||
| 730 | Ga0068861_100069112 | |||
| 731 | Ga0068861_100117186 | |||
| 732 | Ga0068861_100593071 | |||
| 733 | Ga0068858_100075792 | |||
| 734 | Ga0068858_101838163 | |||
| 735 | Ga0068858_102077205 | |||
| 736 | Ga0068860_100317615 | |||
| 737 | Ga0068860_101830467 | |||
| 738 | Ga0068862_100012881 | |||
| 739 | Ga0068862_100149958 | |||
| 740 | Ga0068862_100193364 | |||
| 741 | Ga0068862_100614775 | |||
| 742 | Ga0081455_10002928 | |||
| 743 | Ga0081538_10001072 | |||
| 744 | Ga0081540_1043210 | |||
| 745 | Ga0081539_10003050 | |||
| 746 | Ga0081539_10020392 | |||
| 747 | Ga0097621_100696783 | |||
| 748 | Ga0068871_100512026 | |||
| 749 | Ga0075433_10069529 | |||
| 750 | Ga0075433_10512413 | |||
| 751 | Ga0075434_100067226 | |||
| 752 | Ga0075434_100302305 | |||
| 753 | Ga0068865_100842925 | |||
| 754 | Ga0068865_101540037 | |||
| 755 | Ga0097620_100290634 | |||
| 756 | Ga0097620_102529499 | |||
| 757 | Ga0075435_100116759 | |||
| 758 | Ga0099794_10183839 | |||
| 759 | Ga0105251_10006798 | |||
| 760 | Ga0105250_10231480 | |||
| 761 | Ga0105240_11123278 | |||
| 762 | Ga0111539_12816828 | |||
| 763 | Ga0105245_10271943 | |||
| 764 | Ga0105245_10586228 | |||
| 765 | Ga0105247_10005646 | |||
| 766 | Ga0105247_10494270 | |||
| 767 | Ga0105247_11164824 | |||
| 768 | Ga0114129_10565859 | |||
| 769 | Ga0105243_10043067 | |||
| 770 | Ga0105243_10500887 | |||
| 771 | Ga0105243_11076214 | |||
| 772 | Ga0105241_10130360 | |||
| 773 | Ga0105241_10702136 | |||
| 774 | Ga0105242_10871105 | |||
| 775 | Ga0105242_11377576 | |||
| 776 | Ga0105248_11387876 | |||
| 777 | Ga0105249_10000463 | |||
| 778 | Ga0105249_10196158 | |||
| 779 | Ga0105249_10687960 | |||
| 780 | Ga0105239_11683732 | |||
| 781 | Ga0105246_10000488 | |||
| 782 | Ga0105246_10118387 | |||
| 783 | Ga0157378_10239809 | |||
| 784 | Ga0157378_10464736 | |||
| 785 | Ga0157378_10856339 | |||
| 786 | Ga0157378_10894516 | |||
| 787 | Ga0157378_11992148 | |||
| 788 | Ga0163162_10000452 | |||
| 789 | Ga0163162_11022739 | |||
| 790 | Ga0163162_11653798 | |||
| 791 | Ga0157375_10093332 | |||
| 792 | Ga0157375_10756725 | |||
| 793 | Ga0157375_10902769 | |||
| 794 | Ga0163163_10016843 | |||
| 795 | Ga0163163_10276543 | |||
| 796 | Ga0163163_10317414 | |||
| 797 | Ga0163163_10711922 | |||
| 798 | Ga0157380_10009263 | |||
| 799 | Ga0157380_10021381 | |||
| 800 | Ga0157380_10882126 | |||
| 801 | Ga0157379_10712087 | |||
| 802 | Ga0157379_10795890 | |||
| 803 | Ga0206356_10440406 | |||
| 804 | Ga0206350_10944546 | |||
| 805 | Ga0224712_10157380 | |||
| 806 | Ga0209784_100141 | |||
| 807 | Ga0209566_100221 | |||
| 808 | Ga0209566_100512 | |||
| 809 | Ga0209258_104105 | |||
| 810 | Ga0209675_1008692 | |||
| 811 | Ga0209676_1010941 | |||
| 812 | Ga0209025_1000976 | |||
| 813 | Ga0209025_1033095 | |||
| 814 | Ga0207696_1144891 | |||
| 815 | Ga0207682_10211187 | |||
| 816 | Ga0207682_10278453 | |||
| 817 | Ga0207682_10358980 | |||
| 818 | Ga0207642_10166443 | |||
| 819 | Ga0207710_10001099 | |||
| 820 | Ga0207710_10013708 | |||
| 821 | Ga0207647_10118177 | |||
| 822 | Ga0207684_10040952 | |||
| 823 | Ga0207684_10249188 | |||
| 824 | Ga0207654_10367490 | |||
| 825 | Ga0207654_10476181 | |||
| 826 | Ga0207671_10377775 | |||
| 827 | Ga0207662_10006571 | |||
| 828 | Ga0207652_10085294 | |||
| 829 | Ga0207646_11188185 | |||
| 830 | Ga0207681_10015195 | |||
| 831 | Ga0207681_10026245 | |||
| 832 | Ga0207681_10469016 | |||
| 833 | Ga0207650_10000891 | |||
| 834 | Ga0207650_10225893 | |||
| 835 | Ga0207659_10714644 | |||
| 836 | Ga0207687_10239847 | |||
| 837 | Ga0207644_10376173 | |||
| 838 | Ga0207690_10395302 | |||
| 839 | Ga0207706_10172061 | |||
| 840 | Ga0207706_10248884 | |||
| 841 | Ga0207706_10356843 | |||
| 842 | Ga0207686_10659815 | |||
| 843 | Ga0207686_11037504 | |||
| 844 | Ga0207709_10083939 | |||
| 845 | Ga0207709_10452603 | |||
| 846 | Ga0207670_10323950 | |||
| 847 | Ga0207670_10431431 | |||
| 848 | Ga0207704_10597483 | |||
| 849 | Ga0207704_10782570 | |||
| 850 | Ga0207689_10045053 | |||
| 851 | Ga0207689_10818194 | |||
| 852 | Ga0207689_11708141 | |||
| 853 | Ga0207679_10138149 | |||
| 854 | Ga0207651_10083170 | |||
| 855 | Ga0207651_10212503 | |||
| 856 | Ga0207712_10000128 | |||
| 857 | Ga0207712_10133170 | |||
| 858 | Ga0207712_10278696 | |||
| 859 | Ga0207712_11219029 | |||
| 860 | Ga0207668_10019795 | |||
| 861 | Ga0207668_10097275 | |||
| 862 | Ga0207668_10480066 | |||
| 863 | Ga0207640_10034237 | |||
| 864 | Ga0207640_10398422 | |||
| 865 | Ga0207658_10661638 | |||
| 866 | Ga0207703_10654038 | |||
| 867 | Ga0207708_10310875 | |||
| 868 | Ga0207702_11455011 | |||
| 869 | Ga0207641_10223821 | |||
| 870 | Ga0207641_11575699 | |||
| 871 | Ga0207641_12269481 | |||
| 872 | Ga0207648_10103048 | |||
| 873 | Ga0207648_10222577 | |||
| 874 | Ga0207648_10542303 | |||
| 875 | Ga0207676_10241455 | |||
| 876 | Ga0207676_10391328 | |||
| 877 | Ga0207676_10519449 | |||
| 878 | Ga0207674_10102470 | |||
| 879 | Ga0207674_10139924 | |||
| 880 | Ga0207674_11094070 | |||
| 881 | Ga0207675_100013331 | |||
| 882 | Ga0207675_100018047 | |||
| 883 | Ga0207675_100022156 | |||
| 884 | Ga0207675_100162072 | |||
| 885 | Ga0207675_102358029 | |||
| 886 | Ga0207698_10610586 | |||
| 887 | Ga0268266_10908003 | |||
| 888 | Ga0268266_11718689 | |||
| 889 | Ga0268265_10040491 | |||
| 890 | Ga0268265_10046861 | |||
| 891 | Ga0268265_10061860 | |||
| 892 | Ga0268265_10174484 | |||
| 893 | Ga0268265_11139341 | |||
| 894 | Ga0268265_11648325 | |||
| 895 | Ga0268264_10078905 | |||
| 896 | Ga0268264_10243507 | |||
| 897 | Ga0307511_10021467 | |||
| 898 | Ga0316183_1010449 | |||
| 899 | Ga0307405_10060380 | |||
| 900 | Ga0307413_10002971 | |||
| 901 | Ga0307410_10007070 | |||
| 902 | Ga0307410_10147685 | |||
| 903 | Ga0307410_10817150 | |||
| 904 | Ga0307406_10096672 | |||
| 905 | Ga0307407_10009766 | |||
| 906 | Ga0307407_10246061 | |||
| 907 | Ga0307407_10658726 | |||
| 908 | Ga0307407_10728229 | |||
| 909 | Ga0307407_10952776 | |||
| 910 | Ga0307409_100050397 | |||
| 911 | Ga0307409_100205254 | |||
| 912 | Ga0307409_100397510 | |||
| 913 | Ga0307409_100477765 | |||
| 914 | Ga0307409_100519587 | |||
| 915 | Ga0307409_100659700 | |||
| 916 | Ga0307416_100381607 | |||
| 917 | Ga0307414_10683521 | |||
| 918 | Ga0307414_11409254 | |||
| 919 | Ga0307411_10004156 | |||
| 920 | Ga0307411_10026931 | |||
| 921 | Ga0307415_100024811 | |||
| 922 | Ga0307415_100077388 | |||
| 923 | Ga0307415_100621080 | |||
| 924 | Ga0307415_101141288 | |||
| 925 | Ga0316596_1076620 | |||
| 926 | Ga0373930_0196902 | |||
| 927 | Ga0373939_0320009 | |||
| 928 | Ga0373960_0302684 | |||
| 929 | Ga0395900_1617923 | |||
| 930 | Ga0395898_0918479 | |||
| 931 | Ga0395905_0356906 | |||
| 932 | Ga0395905_1276434 | |||
| 933 | Ga0395901_0687753 | |||
| 934 | Ga0242422_04110 | |||
| 935 | Ga0439436_0002823 | |||
| 936 | Ga0439438_120840 | |||
| 937 | Ga0439439_0007382 | |||
| 938 | Ga0451792_18439 | |||
| 939 | Ga0451805_119312 | |||
| 940 | Ga0451843_0726711 | |||
| 941 | Ga0451853_0525864 | |||
| 942 | Ga0439433_0018955 | |||
| 943 | Ga0439433_0117183 | |||
| 944 | Ga0439445_0236830 | |||
| 945 | Ga0439432_089988 | |||
| 946 | Ga0439432_171079 | |||
| 947 | Ga0439449_0000074 | |||
| 948 | Ga0439449_0158547 | |||
| 949 | Ga0439457_006395 | |||
| 950 | Ga0439462_0002581 | |||
| 951 | Ga0439462_0011797 | |||
| 952 | Ga0439434_0018670 | |||
| 953 | Ga0439434_0135374 | |||
| 954 | Ga0439444_0118779 | |||
| 955 | Ga0453684_0635899 | |||
| 956 | Ga0451576_0529434 | |||
| 957 | Ga0451576_0559850 | |||
| 958 | Ga0451576_0821537 | |||
| 959 | Ga0451576_1901281 | |||
| 960 | Ga0466967_0302641 | |||
| 961 | Ga0495627_060719 | |||
| 962 | Ga0495590_0036527 | |||
| 963 | Ga0495591_037803 | |||
| 964 | Ga0495596_0197265 | |||
| 965 | Ga0495606_0043775 | |||
| 966 | Ga0495606_0150220 | |||
| 967 | Ga0495663_0000452 | |||
| 968 | Ga0495598_0009969 | |||
| 969 | Ga0495621_0000159 | |||
| 970 | Ga0495622_0268970 | |||
| 971 | Ga0495656_0137702 | |||
| 972 | Ga0495656_0337847 | |||
| 973 | Ga0495649_0179138 | |||
| 974 | Ga0495660_0028392 | |||
| 975 | Ga0495636_0075945 | |||
| 976 | Ga0495672_0142505 | |||
| 977 | Ga0495685_160993 | |||
| 978 | Ga0495681_0205285 | |||
| 979 | Ga0495626_0019091 | |||
| 980 | Ga0495626_0136327 | |||
| 981 | Ga0496106_0019234 | |||
| 982 | Ga0496106_1134239 | |||
| 983 | Ga0496108_0033874 | |||
| 984 | Ga0496109_1351344 | |||
| 985 | Ga0496110_1622150 | |||
| 986 | Ga0496111_0579033 | |||
| 987 | Ga0496112_1580719 | |||
| 988 | Ga0496116_0003008 | |||
| 989 | Ga0496116_0013016 | |||
| 990 | Ga0496116_0018736 | |||
| 991 | Ga0496116_0058376 | |||
| 992 | Ga0496116_0105130 | |||
| 993 | Ga0496116_0407427 | |||
| 994 | Ga0496117_0011793 | |||
| 995 | Ga0496117_0020536 | |||
| 996 | Ga0496117_0227159 | |||
| 997 | Ga0496118_0010978 | |||
| 998 | Ga0496119_0000469 | |||
| 999 | Ga0496119_0018355 | |||
| 1000 | Ga0496119_0361620 | |||
| 1001 | Ga0496120_0001942 | |||
| 1002 | Ga0496120_0005342 | |||
| 1003 | Ga0496120_0183298 | |||
| 1004 | Ga0496121_0033713 | |||
| 1005 | Ga0496121_0671296 | |||
| 1006 | Ga0496122_0004250 | |||
| 1007 | Ga0496122_0055545 | |||
| 1008 | Ga0496122_0113059 | |||
| 1009 | Ga0496122_0125425 | |||
| 1010 | Ga0496122_0206519 | |||
| 1011 | Ga0496122_0219743 | |||
| 1012 | Ga0496123_0009904 | |||
| 1013 | Ga0496123_0022954 | |||
| 1014 | Ga0496123_0087199 | |||
| 1015 | Ga0496123_0208833 | |||
| 1016 | Ga0496123_0402577 | |||
| 1017 | Ga0496124_0000697 | |||
| 1018 | Ga0496124_0006669 | |||
| 1019 | Ga0496124_0107157 | |||
| 1020 | Ga0496125_0001385 | |||
| 1021 | Ga0496125_0006867 | |||
| 1022 | Ga0496125_0064220 | |||
| 1023 | Ga0496125_0251917 | |||
| 1024 | Ga0496126_0004931 | |||
| 1025 | Ga0496126_0077922 | |||
| 1026 | Ga0501306_002875 | |||
| 1027 | Ga0501306_007831 | |||
| 1028 | Ga0501306_012517 | |||
| 1029 | Ga0501306_022909 | |||
| 1030 | Ga0501306_029958 | |||
| 1031 | Ga0501306_044943 | |||
| 1032 | Ga0501306_098674 | |||
| 1033 | Ga0501308_016454 | |||
| 1034 | Ga0501309_001139 | |||
| 1035 | Ga0501309_015650 | |||
| 1036 | Ga0501309_025141 | |||
| 1037 | Ga0501310_017432 | |||
| 1038 | Ga0501310_029164 | |||
| 1039 | Ga0501304_010183 | |||
| 1040 | Ga0501305_008999 | |||
| 1041 | Ga0501305_009999 | |||
| 1042 | Ga0501307_005857 | |||
| 1043 | Ga0501307_006027 | |||
| 1044 | Ga0495678_072001 | |||
| 1045 | Ga0501292_021489 | |||
| 1046 | Ga0501293_005660 | |||
| 1047 | Ga0501296_002825 | |||
| 1048 | Ga0501298_003896 | |||
| 1049 | Ga0501299_004790 | |||
| 1050 | Ga0501311_009516 | |||
| 1051 | Ga0501311_043227 | |||
| 1052 | Ga0501311_044677 | |||
| 1053 | Ga0501312_010059 | |||
| 1054 | Ga0501312_022606 | |||
| 1055 | Ga0501312_029385 | |||
| 1056 | Ga0501312_031968 | |||
| 1057 | Ga0501313_009179 | |||
| 1058 | Ga0501313_015011 | |||
| 1059 | Ga0501313_020363 | |||
| 1060 | Ga0501313_027049 | |||
| 1061 | Ga0501313_070309 | |||
| 1062 | Ga0501315_019492 | |||
| 1063 | Ga0501316_006875 | |||
| 1064 | Ga0501316_014218 | |||
| 1065 | Ga0501317_008368 | |||
| 1066 | Ga0501317_012184 | |||
| 1067 | Ga0501318_030999 | |||
| 1068 | Ga0501319_007726 | |||
| 1069 | Ga0501320_029880 | |||
| 1070 | Ga0501321_015741 | |||
| 1071 | Ga0501321_019290 | |||
| 1072 | Ga0501323_013738 | |||
| 1073 | Ga0501324_007387 | |||
| 1074 | Ga0501324_012030 | |||
| 1075 | Ga0501324_012530 | |||
| 1076 | Ga0501326_02279 | |||
| 1077 | Ga0501335_005754 | |||
| 1078 | Ga0501335_011403 | |||
| 1079 | Ga0501338_04393 | |||
| 1080 | Ga0501038_0005686 | |||
| 1081 | Ga0501202_004197 | |||
| 1082 | Ga0501207_075118 | |||
| 1083 | Ga0501208_084498 | |||
| 1084 | Ga0501217_009713 | |||
| 1085 | Ga0501217_059403 | |||
| 1086 | Ga0501223_035817 | |||
| 1087 | Ga0501233_146174 | |||
| 1088 | Ga0501235_050542 | |||
| 1089 | Ga0501239_008750 | |||
| 1090 | Ga0501243_038383 | |||
| 1091 | Ga0501249_033725 | |||
| 1092 | Ga0501255_061306 | |||
| 1093 | Ga0501257_012972 | |||
| 1094 | Ga0501221_113032 | |||
| 1095 | Ga0501225_0048972 | |||
| 1096 | Ga0501262_038395 | |||
| 1097 | Ga0501263_035116 | |||
| 1098 | Ga0501264_010438 | |||
| 1099 | Ga0501267_004977 | |||
| 1100 | Ga0501272_011394 | |||
| 1101 | Ga0501279_017167 | |||
| 1102 | Ga0501279_029773 | |||
| 1103 | Ga0501283_042275 | |||
| 1104 | nmdc:mga05p37_141231_c1 | |||
| 1105 | nmdc:mga05p37_93723_c1 | |||
| 1106 | nmdc:mga0n895_493097_c1 | |||
| 1107 | nmdc:mga0n895_560157_c1 | |||
| 1108 | nmdc:mga0rr50_265_c1 | |||
| 1109 | nmdc:mga08x19_3_c1 | |||
| 1110 | nmdc:mga0a205_42199_c1 | |||
| 1111 | nmdc:mga0a205_873944_c1 | |||
| 1112 | Ga0587066_018373 | |||
| 1113 | Ga0587070_019658 | |||
| 1114 | Ga0587077_019559 | |||
| 1115 | Ga0587080_014264 | |||
| 1116 | Ga0587080_090210 | |||
| 1117 | Ga0587082_026371 | |||
| 1118 | Ga0587082_027557 | |||
| 1119 | Ga0587083_0002073 | |||
| 1120 | Ga0587083_0041110 | |||
| 1121 | Ga0587088_017437 | |||
| 1122 | Ga0587106_024053 | |||
| 1123 | Ga0587128_030847 | |||
| 1124 | Ga0587067_008422 | |||
| 1125 | Ga0587067_018744 | |||
| 1126 | Ga0587067_039871 | |||
| 1127 | Ga0587067_072301 | |||
| 1128 | Ga0587072_037420 | |||
| 1129 | Ga0587075_010803 | |||
| 1130 | Ga0587076_018092 | |||
| 1131 | Ga0587078_014225 | |||
| 1132 | Ga0587079_018339 | |||
| 1133 | Ga0587079_021792 | |||
| 1134 | Ga0587079_058241 | |||
| 1135 | Ga0587124_001812 | |||
| 1136 | Ga0587060_004808 | |||
| 1137 | Ga0587111_0098859 | |||
| 1138 | 2524190026 | |||
| 1139 | 2550903246 | |||
| 1140 | 2563930218 | |||
| 1141 | 2571530781 | |||
| 1142 | 2573041391 | |||
| 1143 | 2578338857 | |||
| 1144 | 2580935251 | |||
| 1145 | 2595320848 | |||
| 1146 | 2601641784 | |||
| 1147 | 2621273271 | |||
| 1148 | 2643738869 | |||
| 1149 | 2723606169 | |||
| 1150 | 2728529920 | |||
| 1151 | 2730136792 | |||
| 1152 | 2753813053 | |||
| 1153 | 2793182045 | |||
| 1154 | 2802440750 | |||
| 1155 | 2821118348 | |||
| 1156 | 2864738844 | |||
| 1157 | 2865007667 | |||
| 1158 | 2881639950 | |||
| 1159 | 2885529888 | |||
| 1160 | 2888584435 | |||
| 1161 | 2889047982 | |||
| 1162 | 2889053119 | |||
| 1163 | 2889276720 | |||
| 1164 | 2904168181 | |||
| 1165 | 2904496922 | |||
| 1166 | 2904600807 | |||
| 1167 | 2907208173 | |||
| 1168 | 2919166275 | |||
| 1169 | 2931385088 | |||
| 1170 | 2938653360 | |||
| 1171 | 2939685150 | |||
| 1172 | 2939707630 | |||
| 1173 | 2945996289 | |||
| 1174 | 2946058979 | |||
| 1175 | 2968562336 | |||
| 1176 | 2971406782 | |||
| 1177 | 2971513816 | |||
| 1178 | 2980128601 | |||
| 1179 | 2980179468 | |||
| 1180 | 2984531134 | |||
| 1181 | 2984537243 | |||
| 1182 | 2988229843 | |||
| 1183 | 2996636968 | |||
| 1184 | 2996709592 | |||
| 1185 | 648172160 | |||
| 1186 | 8046991273 | |||
| 1187 | 8054471283 | |||
| 1188 | 8057473353 | |||
| 1189 | 8057735113 | |||
| 1190 | 8057979898 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c99-assembly1.cif.gz_J | cryo-em captures early ribosome assembly in action | 0.8942 | 3 | 141 |
| 6ppk-assembly1.cif.gz_J | rbga+45srbga complex | 0.8938 | 6 | 144 |
| 6xyw-assembly1.cif.gz_Aj | structure of the plant mitochondrial ribosome | 0.8932 | 15 | 144 |
| 7m4w-assembly1.cif.gz_I | a. baumannii ribosome-eravacycline complex: empty 70s | 0.8917 | 4 | 141 |
| 7a5h-assembly1.cif.gz_K | structure of the split human mitoribosomal large subunit with rescue factors mtrf-r and mtres1 | 0.8906 | 14 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9329 | 13 | 145 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9309 | 13 | 145 | 3.90.1180.10 |
| af_Q554U7_3_170_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9129 | 9 | 136 | 3.90.1180.10 |
| af_Q5XFW4_1_178_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.8946 | 13 | 145 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.8934 | 3 | 142 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B4X4E0-F1-model_v4 | 50S ribosomal protein L13 | 0.9427 | 13 | 145 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A1F6LAI9-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9414 | 13 | 145 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A660VCC6-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9387 | 13 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A5D3CLX7-F1-model_v4 | Transcription termination factor MTERF5 | 0.9359 | 14 | 145 |
GO:0003690
GO:0003729 GO:0003735 GO:0005762 GO:0006353 GO:0006355 GO:0006412 GO:0017148 |
| AF-A0A836QTA4-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9354 | 13 | 142 |
GO:0003729
GO:0003735 GO:0005737 GO:0005840 GO:0006412 GO:0017148 GO:1990904 |