F467452

General Info

Members Datasets Scaffolds Average Seq Length
595 346 1190 148

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10122254|Ga0265327_101222542
Length 145
Sequence MSTYFPKAQDQIDRKWFVVDATGLPVGRLSTVVADVLSGKSKPTWTPFLDMGDHVVVINAAKAVFTGKKATQKFYRRTSTQPGSMVEVRADVMKITFPGRIIESAVKGMLPKGPLGRAMYRKLKVYDGGEHQQQSQKPETLAIKL

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
171 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
172 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
173 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
189 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
231 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
232 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
233 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
234 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
251 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
252 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
253 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
254 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
258 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
259 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
260 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
261 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
262 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
265 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
266 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
267 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
268 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
269 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
270 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
295 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
296 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
297 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
298 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
299 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
300 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
301 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
302 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
303 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
304 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
305 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
306 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
307 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
308 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
309 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
310 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
311 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
312 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
313 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
314 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
315 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
316 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
317 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
318 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
319 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
320 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
321 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
322 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
323 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
324 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
325 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
326 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
327 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
328 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
329 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
330 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
331 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
332 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
333 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
334 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
335 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
336 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
337 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
338 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
339 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
340 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
341 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
342 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
343 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
344 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
345 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
346 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.81
Metatranscriptomes 14.29
Isolates 8.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 1.68
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10122254 3300031251 Bacteria 1232
2 JGI25151J46595_10030742 3300003187 Bacteria 2107
3 JGI25151J46595_10088366 3300003187 Bacteria 871
4 JGI25407J50210_10001798 3300003373 Bacteria 4941
5 Ga0007417J51691_1092551 3300003544 Bacteria 897
6 Ga0007410J51695_1030879 3300003574 Bacteria 986
7 Ga0007409J51694_1018080 3300003575 Bacteria 993
8 Ga0007416J51690_1080628 3300003577 Bacteria 944
9 Ga0006562J51391_1000361 3300003578 Bacteria 31803
10 JGI25404J52841_10074932 3300003659 Unclassified 707
11 Ga0055538_1000286 3300003751 Bacteria 25743
12 Ga0055535_1000913 3300003761 Bacteria 19960
13 Ga0055536_1038168 3300003781 Bacteria 1167
14 Ga0055541_1000319 3300003841 Bacteria 15656
15 Ga0065704_10225729 3300005289 Unclassified 1059
16 Ga0065704_10322577 3300005289 Bacteria 850
17 Ga0065712_10084153 3300005290 Bacteria 2786
18 Ga0065712_10260472 3300005290 Bacteria 938
19 Ga0065715_10120348 3300005293 Bacteria 2260
20 Ga0065715_10446411 3300005293 Bacteria 830
21 Ga0065715_10515378 3300005293 Bacteria 768
22 Ga0065715_10609574 3300005293 Bacteria 702
23 Ga0065715_11113185 3300005293 Unclassified 513
24 Ga0065707_10020267 3300005295 Unclassified 1484
25 Ga0065707_10279810 3300005295 Bacteria 1050
26 Ga0065707_10570932 3300005295 Bacteria 708
27 Ga0070690_100001592 3300005330 Bacteria 11918
28 Ga0070690_100009058 3300005330 Bacteria 5755
29 Ga0070690_100268012 3300005330 Bacteria 1214
30 Ga0070670_100005446 3300005331 Bacteria 10735
31 Ga0070670_100098512 3300005331 Bacteria 2516
32 Ga0070670_100293758 3300005331 Bacteria 1421
33 Ga0070670_100521739 3300005331 Bacteria 1058
34 Ga0068869_100033509 3300005334 Bacteria 3626
35 Ga0068869_100115605 3300005334 Bacteria 2046
36 Ga0068869_101050827 3300005334 Unclassified 711
37 Ga0068869_102051561 3300005334 Bacteria 513
38 Ga0070682_100000027 3300005337 Bacteria 188799
39 Ga0070682_101131009 3300005337 Unclassified 657
40 Ga0068868_100019896 3300005338 Bacteria 5034
41 Ga0070689_100919858 3300005340 Unclassified 775
42 Ga0070689_101009509 3300005340 Bacteria 740
43 Ga0070691_10315051 3300005341 Bacteria 859
44 Ga0070687_100055679 3300005343 Bacteria 2066
45 Ga0070661_101064997 3300005344 Bacteria 673
46 Ga0070692_10138160 3300005345 Bacteria 1376
47 Ga0070668_100118318 3300005347 Bacteria 2115
48 Ga0070668_100208197 3300005347 Bacteria 1608
49 Ga0070668_100463075 3300005347 Unclassified 1092
50 Ga0070668_100517537 3300005347 Bacteria 1035
51 Ga0070669_100003065 3300005353 Bacteria 12018
52 Ga0070669_100038319 3300005353 Bacteria 3480
53 Ga0070669_100480699 3300005353 Bacteria 1028
54 Ga0070675_100615428 3300005354 Bacteria 986
55 Ga0070674_100373437 3300005356 Bacteria 1158
56 Ga0070673_100203272 3300005364 Bacteria 1707
57 Ga0070673_100206553 3300005364 Bacteria 1694
58 Ga0070688_101065587 3300005365 Unclassified 645
59 Ga0070659_100847858 3300005366 Bacteria 796
60 Ga0070659_100987780 3300005366 Bacteria 738
61 Ga0070667_100095317 3300005367 Bacteria 2565
62 Ga0070703_10101526 3300005406 Bacteria 1015
63 Ga0070701_10008882 3300005438 Bacteria 4372
64 Ga0070701_10893957 3300005438 Bacteria 612
65 Ga0070705_100189144 3300005440 Bacteria 1401
66 Ga0070705_100251844 3300005440 Bacteria 1240
67 Ga0070705_100687571 3300005440 Bacteria 802
68 Ga0070705_100726790 3300005440 Bacteria 782
69 Ga0070705_101193732 3300005440 Unclassified 626
70 Ga0070700_100646403 3300005441 Bacteria 835
71 Ga0070694_100200293 3300005444 Bacteria 1488
72 Ga0070694_100271651 3300005444 Bacteria 1289
73 Ga0070694_100589998 3300005444 Bacteria 894
74 Ga0070694_100705002 3300005444 Bacteria 821
75 Ga0070694_101687716 3300005444 Unclassified 539
76 Ga0070708_100000279 3300005445 Bacteria 38354
77 Ga0070708_100089869 3300005445 Bacteria 2795
78 Ga0070708_102276582 3300005445 Bacteria 500
79 Ga0070662_100226505 3300005457 Bacteria 1494
80 Ga0070662_100293750 3300005457 Bacteria 1318
81 Ga0070662_101103706 3300005457 Bacteria 681
82 Ga0068867_100228145 3300005459 Bacteria 1504
83 Ga0068867_100487661 3300005459 Bacteria 1057
84 Ga0068867_101040130 3300005459 Bacteria 744
85 Ga0070706_100024957 3300005467 Bacteria 5502
86 Ga0070706_100223731 3300005467 Bacteria 1757
87 Ga0070707_100274265 3300005468 Bacteria 1640
88 Ga0070707_100381291 3300005468 Bacteria 1369
89 Ga0070707_100920774 3300005468 Bacteria 839
90 Ga0070698_100019977 3300005471 Bacteria 7024
91 Ga0070698_100036168 3300005471 Bacteria 5103
92 Ga0070698_100047996 3300005471 Bacteria 4363
93 Ga0070699_100004091 3300005518 Bacteria 12894
94 Ga0070699_100022702 3300005518 Bacteria 5408
95 Ga0070699_100410921 3300005518 Bacteria 1224
96 Ga0070699_101502472 3300005518 Bacteria 618
97 Ga0070699_101724264 3300005518 Bacteria 574
98 Ga0070697_100000164 3300005536 Bacteria 54325
99 Ga0070697_100000628 3300005536 Bacteria 26764
100 Ga0070697_100010020 3300005536 Bacteria 7394
101 Ga0070697_100042670 3300005536 Bacteria 3671
102 Ga0068853_101215768 3300005539 Bacteria 728
103 Ga0070672_100298493 3300005543 Bacteria 1365
104 Ga0070672_101583885 3300005543 Bacteria 587
105 Ga0070686_100007160 3300005544 Bacteria 6216
106 Ga0070686_100025604 3300005544 Bacteria 3552
107 Ga0070686_100225128 3300005544 Unclassified 1357
108 Ga0070695_100193165 3300005545 Bacteria 1450
109 Ga0070695_101067121 3300005545 Bacteria 660
110 Ga0070696_100103330 3300005546 Bacteria 2044
111 Ga0070696_100124110 3300005546 Bacteria 1872
112 Ga0070696_100338867 3300005546 Bacteria 1162
113 Ga0070696_100378450 3300005546 Bacteria 1103
114 Ga0070693_100356525 3300005547 Bacteria 1002
115 Ga0070665_101822049 3300005548 Unclassified 615
116 Ga0070704_100104465 3300005549 Bacteria 2142
117 Ga0070704_100112472 3300005549 Bacteria 2075
118 Ga0070704_100189166 3300005549 Bacteria 1653
119 Ga0070704_100472128 3300005549 Bacteria 1084
120 Ga0068857_100321633 3300005577 Bacteria 1429
121 Ga0068857_100346148 3300005577 Bacteria 1376
122 Ga0070702_100126916 3300005615 Bacteria 1606
123 Ga0068859_100290653 3300005617 Bacteria 1727
124 Ga0068859_102529009 3300005617 Bacteria 565
125 Ga0068864_100073142 3300005618 Bacteria 2988
126 Ga0068864_100241574 3300005618 Bacteria 1673
127 Ga0068864_100271418 3300005618 Bacteria 1581
128 Ga0068864_100411734 3300005618 Unclassified 1286
129 Ga0068864_100816114 3300005618 Bacteria 917
130 Ga0068864_100978083 3300005618 Bacteria 838
131 Ga0068864_101073373 3300005618 Unclassified 801
132 Ga0068866_10267019 3300005718 Bacteria 1054
133 Ga0068861_100001094 3300005719 Bacteria 16773
134 Ga0068861_100023094 3300005719 Bacteria 4484
135 Ga0068861_100069112 3300005719 Unclassified 2731
136 Ga0068861_100117186 3300005719 Bacteria 2143
137 Ga0068861_100593071 3300005719 Bacteria 1016
138 Ga0068858_100075792 3300005842 Bacteria 3125
139 Ga0068858_101838163 3300005842 Unclassified 598
140 Ga0068858_102077205 3300005842 Bacteria 562
141 Ga0068860_100317615 3300005843 Bacteria 1528
142 Ga0068860_101830467 3300005843 Bacteria 629
143 Ga0068862_100012881 3300005844 Bacteria 6917
144 Ga0068862_100149958 3300005844 Bacteria 2075
145 Ga0068862_100193364 3300005844 Bacteria 1832
146 Ga0068862_100614775 3300005844 Bacteria 1045
147 Ga0081455_10002928 3300005937 Bacteria 20018
148 Ga0081538_10001072 3300005981 Bacteria 29085
149 Ga0081540_1043210 3300005983 Bacteria 2315
150 Ga0081539_10003050 3300005985 Bacteria 21639
151 Ga0081539_10020392 3300005985 Bacteria 4483
152 Ga0097621_100696783 3300006237 Bacteria 935
153 Ga0068871_100512026 3300006358 Bacteria 1083
154 Ga0075433_10069529 3300006852 Bacteria 3092
155 Ga0075433_10512413 3300006852 Bacteria 1055
156 Ga0075434_100067226 3300006871 Bacteria 3571
157 Ga0075434_100302305 3300006871 Bacteria 1620
158 Ga0068865_100842925 3300006881 Bacteria 794
159 Ga0068865_101540037 3300006881 Unclassified 596
160 Ga0097620_100290634 3300006931 Bacteria 1727
161 Ga0097620_102529499 3300006931 Bacteria 565
162 Ga0075435_100116759 3300007076 Bacteria 2223
163 Ga0099794_10183839 3300007265 Bacteria 1067
164 Ga0105251_10006798 3300009011 Bacteria 7212
165 Ga0105250_10231480 3300009092 Unclassified 786
166 Ga0105240_11123278 3300009093 Bacteria 835
167 Ga0111539_12816828 3300009094 Bacteria 563
168 Ga0105245_10271943 3300009098 Bacteria 1653
169 Ga0105245_10586228 3300009098 Bacteria 1140
170 Ga0105247_10005646 3300009101 Bacteria 7840
171 Ga0105247_10494270 3300009101 Bacteria 890
172 Ga0105247_11164824 3300009101 Bacteria 612
173 Ga0114129_10565859 3300009147 Bacteria 1476
174 Ga0105243_10043067 3300009148 Bacteria 3537
175 Ga0105243_10500887 3300009148 Bacteria 1151
176 Ga0105243_11076214 3300009148 Unclassified 811
177 Ga0105241_10130360 3300009174 Bacteria 2035
178 Ga0105241_10702136 3300009174 Unclassified 923
179 Ga0105242_10871105 3300009176 Bacteria 898
180 Ga0105242_11377576 3300009176 Bacteria 732
181 Ga0105248_11387876 3300009177 Unclassified 795
182 Ga0105249_10000463 3300009553 Bacteria 37844
183 Ga0105249_10196158 3300009553 Bacteria 1973
184 Ga0105249_10687960 3300009553 Bacteria 1082
185 Ga0105239_11683732 3300010375 Unclassified 734
186 Ga0105246_10000488 3300011119 Bacteria 21462
187 Ga0105246_10118387 3300011119 Bacteria 1958
188 Ga0157378_10239809 3300013297 Bacteria 1731
189 Ga0157378_10464736 3300013297 Bacteria 1258
190 Ga0157378_10856339 3300013297 Bacteria 938
191 Ga0157378_10894516 3300013297 Unclassified 918
192 Ga0157378_11992148 3300013297 Bacteria 630
193 Ga0163162_10000452 3300013306 Bacteria 37968
194 Ga0163162_11022739 3300013306 Unclassified 935
195 Ga0163162_11653798 3300013306 Bacteria 731
196 Ga0157375_10093332 3300013308 Bacteria 3075
197 Ga0157375_10756725 3300013308 Bacteria 1122
198 Ga0157375_10902769 3300013308 Bacteria 1027
199 Ga0163163_10016843 3300014325 Bacteria 6803
200 Ga0163163_10276543 3300014325 Bacteria 1730
201 Ga0163163_10317414 3300014325 Bacteria 1612
202 Ga0163163_10711922 3300014325 Bacteria 1068
203 Ga0157380_10009263 3300014326 Bacteria 7045
204 Ga0157380_10021381 3300014326 Bacteria 4853
205 Ga0157380_10882126 3300014326 Unclassified 919
206 Ga0157379_10712087 3300014968 Bacteria 943
207 Ga0157379_10795890 3300014968 Bacteria 892
208 Ga0206356_10440406 3300020070 Unclassified 619
209 Ga0206350_10944546 3300020080 Bacteria 707
210 Ga0224712_10157380 3300022467 Bacteria 1011
211 Ga0209784_100141 3300025224 Bacteria 67045
212 Ga0209566_100221 3300025225 Bacteria 56770
213 Ga0209566_100512 3300025225 Bacteria 26820
214 Ga0209258_104105 3300025242 Bacteria 2866
215 Ga0209675_1008692 3300025291 Bacteria 3688
216 Ga0209676_1010941 3300025292 Bacteria 3718
217 Ga0209025_1000976 3300025294 Bacteria 42839
218 Ga0209025_1033095 3300025294 Bacteria 2398
219 Ga0207696_1144891 3300025711 Unclassified 635
220 Ga0207682_10211187 3300025893 Bacteria 895
221 Ga0207682_10278453 3300025893 Bacteria 782
222 Ga0207682_10358980 3300025893 Bacteria 687
223 Ga0207642_10166443 3300025899 Bacteria 1189
224 Ga0207710_10001099 3300025900 Bacteria 13880
225 Ga0207710_10013708 3300025900 Bacteria 3411
226 Ga0207647_10118177 3300025904 Bacteria 1564
227 Ga0207684_10040952 3300025910 Bacteria 3928
228 Ga0207684_10249188 3300025910 Bacteria 1532
229 Ga0207654_10367490 3300025911 Bacteria 994
230 Ga0207654_10476181 3300025911 Bacteria 879
231 Ga0207671_10377775 3300025914 Bacteria 1126
232 Ga0207662_10006571 3300025918 Bacteria 6277
233 Ga0207652_10085294 3300025921 Bacteria 2768
234 Ga0207646_11188185 3300025922 Unclassified 669
235 Ga0207681_10015195 3300025923 Bacteria 4800
236 Ga0207681_10026245 3300025923 Bacteria 3755
237 Ga0207681_10469016 3300025923 Bacteria 1027
238 Ga0207650_10000891 3300025925 Bacteria 22578
239 Ga0207650_10225893 3300025925 Bacteria 1508
240 Ga0207659_10714644 3300025926 Bacteria 858
241 Ga0207687_10239847 3300025927 Bacteria 1436
242 Ga0207644_10376173 3300025931 Bacteria 1158
243 Ga0207690_10395302 3300025932 Bacteria 1101
244 Ga0207706_10172061 3300025933 Bacteria 1903
245 Ga0207706_10248884 3300025933 Bacteria 1553
246 Ga0207706_10356843 3300025933 Bacteria 1270
247 Ga0207686_10659815 3300025934 Bacteria 828
248 Ga0207686_11037504 3300025934 Bacteria 667
249 Ga0207709_10083939 3300025935 Bacteria 2061
250 Ga0207709_10452603 3300025935 Bacteria 993
251 Ga0207670_10323950 3300025936 Bacteria 1213
252 Ga0207670_10431431 3300025936 Bacteria 1059
253 Ga0207704_10597483 3300025938 Unclassified 903
254 Ga0207704_10782570 3300025938 Bacteria 796
255 Ga0207689_10045053 3300025942 Bacteria 3648
256 Ga0207689_10818194 3300025942 Unclassified 786
257 Ga0207689_11708141 3300025942 Bacteria 521
258 Ga0207679_10138149 3300025945 Bacteria 1966
259 Ga0207651_10083170 3300025960 Bacteria 2314
260 Ga0207651_10212503 3300025960 Bacteria 1558
261 Ga0207712_10000128 3300025961 Bacteria 79324
262 Ga0207712_10133170 3300025961 Bacteria 1897
263 Ga0207712_10278696 3300025961 Bacteria 1364
264 Ga0207712_11219029 3300025961 Unclassified 672
265 Ga0207668_10019795 3300025972 Bacteria 4262
266 Ga0207668_10097275 3300025972 Bacteria 2178
267 Ga0207668_10480066 3300025972 Unclassified 1066
268 Ga0207640_10034237 3300025981 Bacteria 3168
269 Ga0207640_10398422 3300025981 Bacteria 1120
270 Ga0207658_10661638 3300025986 Bacteria 942
271 Ga0207703_10654038 3300026035 Bacteria 997
272 Ga0207708_10310875 3300026075 Bacteria 1284
273 Ga0207702_11455011 3300026078 Bacteria 679
274 Ga0207641_10223821 3300026088 Bacteria 1746
275 Ga0207641_11575699 3300026088 Bacteria 659
276 Ga0207641_12269481 3300026088 Bacteria 542
277 Ga0207648_10103048 3300026089 Bacteria 2502
278 Ga0207648_10222577 3300026089 Bacteria 1677
279 Ga0207648_10542303 3300026089 Bacteria 1068
280 Ga0207676_10241455 3300026095 Bacteria 1621
281 Ga0207676_10391328 3300026095 Bacteria 1296
282 Ga0207676_10519449 3300026095 Bacteria 1133
283 Ga0207674_10102470 3300026116 Bacteria 2842
284 Ga0207674_10139924 3300026116 Bacteria 2380
285 Ga0207674_11094070 3300026116 Bacteria 766
286 Ga0207675_100013331 3300026118 Bacteria 7671
287 Ga0207675_100018047 3300026118 Bacteria 6580
288 Ga0207675_100022156 3300026118 Bacteria 5915
289 Ga0207675_100162072 3300026118 Bacteria 2134
290 Ga0207675_102358029 3300026118 Unclassified 545
291 Ga0207698_10610586 3300026142 Bacteria 1076
292 Ga0268266_10908003 3300028379 Bacteria 852
293 Ga0268266_11718689 3300028379 Unclassified 603
294 Ga0268265_10040491 3300028380 Bacteria 3442
295 Ga0268265_10046861 3300028380 Bacteria 3234
296 Ga0268265_10061860 3300028380 Bacteria 2874
297 Ga0268265_10174484 3300028380 Bacteria 1841
298 Ga0268265_11139341 3300028380 Bacteria 776
299 Ga0268265_11648325 3300028380 Unclassified 647
300 Ga0268264_10078905 3300028381 Bacteria 2808
301 Ga0268264_10243507 3300028381 Bacteria 1667
302 Ga0307511_10021467 3300030521 Bacteria 6081
303 Ga0316183_1010449 3300030742 Bacteria 723
304 Ga0307405_10060380 3300031731 Bacteria 2392
305 Ga0307413_10002971 3300031824 Bacteria 7020
306 Ga0307410_10007070 3300031852 Bacteria 6115
307 Ga0307410_10147685 3300031852 Bacteria 1746
308 Ga0307410_10817150 3300031852 Bacteria 794
309 Ga0307406_10096672 3300031901 Unclassified 2002
310 Ga0307407_10009766 3300031903 Bacteria 4488
311 Ga0307407_10246061 3300031903 Bacteria 1223
312 Ga0307407_10658726 3300031903 Bacteria 785
313 Ga0307407_10728229 3300031903 Bacteria 749
314 Ga0307407_10952776 3300031903 Bacteria 661
315 Ga0307409_100050397 3300031995 Bacteria 3179
316 Ga0307409_100205254 3300031995 Bacteria 1766
317 Ga0307409_100397510 3300031995 Bacteria 1315
318 Ga0307409_100477765 3300031995 Bacteria 1209
319 Ga0307409_100519587 3300031995 Bacteria 1163
320 Ga0307409_100659700 3300031995 Unclassified 1041
321 Ga0307416_100381607 3300032002 Bacteria 1440
322 Ga0307414_10683521 3300032004 Bacteria 928
323 Ga0307414_11409254 3300032004 Bacteria 648
324 Ga0307411_10004156 3300032005 Bacteria 6880
325 Ga0307411_10026931 3300032005 Bacteria 3469
326 Ga0307415_100024811 3300032126 Bacteria 3752
327 Ga0307415_100077388 3300032126 Bacteria 2362
328 Ga0307415_100621080 3300032126 Bacteria 965
329 Ga0307415_101141288 3300032126 Bacteria 731
330 Ga0316596_1076620 3300033541 Bacteria 897
331 Ga0373930_0196902 3300034816 Unclassified 523
332 Ga0373939_0320009 3300035114 Unclassified 623
333 Ga0373960_0302684 3300035121 Bacteria 595
334 Ga0395900_1617923 3300037418 Unclassified 559
335 Ga0395898_0918479 3300037466 Bacteria 813
336 Ga0395905_0356906 3300037471 Bacteria 1354
337 Ga0395905_1276434 3300037471 Unclassified 638
338 Ga0395901_0687753 3300038443 Bacteria 1022
339 Ga0242422_04110 3300038699 Bacteria 927
340 Ga0439436_0002823 3300041404 Bacteria 5262
341 Ga0439438_120840 3300041405 Unclassified 630
342 Ga0439439_0007382 3300041406 Bacteria 2569
343 Ga0451792_18439 3300041445 Bacteria 676
344 Ga0451805_119312 3300041461 Bacteria 734
345 Ga0451843_0726711 3300041509 Unclassified 729
346 Ga0451853_0525864 3300041512 Unclassified 662
347 Ga0439433_0018955 3300041999 Bacteria 1532
348 Ga0439433_0117183 3300041999 Unclassified 670
349 Ga0439445_0236830 3300042004 Unclassified 544
350 Ga0439432_089988 3300042006 Unclassified 924
351 Ga0439432_171079 3300042006 Unclassified 634
352 Ga0439449_0000074 3300042007 Bacteria 31794
353 Ga0439449_0158547 3300042007 Unclassified 845
354 Ga0439457_006395 3300042014 Bacteria 2890
355 Ga0439462_0002581 3300042015 Bacteria 4228
356 Ga0439462_0011797 3300042015 Bacteria 2228
357 Ga0439434_0018670 3300042435 Bacteria 2077
358 Ga0439434_0135374 3300042435 Unclassified 810
359 Ga0439444_0118779 3300042437 Bacteria 615
360 Ga0453684_0635899 3300044712 Bacteria 1166
361 Ga0451576_0529434 3300045051 Bacteria 1238
362 Ga0451576_0559850 3300045051 Bacteria 1201
363 Ga0451576_0821537 3300045051 Bacteria 976
364 Ga0451576_1901281 3300045051 Bacteria 614
365 Ga0466967_0302641 3300045976 Bacteria 1539
366 Ga0495627_060719 3300046453 Bacteria 1119
367 Ga0495590_0036527 3300046457 Bacteria 1714
368 Ga0495591_037803 3300046458 Bacteria 1394
369 Ga0495596_0197265 3300046500 Bacteria 782
370 Ga0495606_0043775 3300046507 Bacteria 2982
371 Ga0495606_0150220 3300046507 Bacteria 1368
372 Ga0495663_0000452 3300046525 Bacteria 15039
373 Ga0495598_0009969 3300046537 Bacteria 2261
374 Ga0495621_0000159 3300046539 Bacteria 15029
375 Ga0495622_0268970 3300046557 Bacteria 747
376 Ga0495656_0137702 3300046615 Bacteria 1168
377 Ga0495656_0337847 3300046615 Unclassified 778
378 Ga0495649_0179138 3300046694 Bacteria 1106
379 Ga0495660_0028392 3300046810 Bacteria 3161
380 Ga0495636_0075945 3300047318 Bacteria 1441
381 Ga0495672_0142505 3300047320 Unclassified 1250
382 Ga0495685_160993 3300047447 Bacteria 727
383 Ga0495681_0205285 3300047470 Bacteria 797
384 Ga0495626_0019091 3300048091 Bacteria 3431
385 Ga0495626_0136327 3300048091 Bacteria 1044
386 Ga0496106_0019234 3300048909 Bacteria 5065
387 Ga0496106_1134239 3300048909 Bacteria 612
388 Ga0496108_0033874 3300048911 Bacteria 4243
389 Ga0496109_1351344 3300048912 Bacteria 648
390 Ga0496110_1622150 3300048913 Unclassified 557
391 Ga0496111_0579033 3300048914 Bacteria 823
392 Ga0496112_1580719 3300048915 Bacteria 569
393 Ga0496116_0003008 3300048919 Bacteria 17086
394 Ga0496116_0013016 3300048919 Bacteria 6746
395 Ga0496116_0018736 3300048919 Bacteria 5321
396 Ga0496116_0058376 3300048919 Bacteria 2516
397 Ga0496116_0105130 3300048919 Bacteria 1675
398 Ga0496116_0407427 3300048919 Bacteria 599
399 Ga0496117_0011793 3300048920 Bacteria 7784
400 Ga0496117_0020536 3300048920 Bacteria 5379
401 Ga0496117_0227159 3300048920 Bacteria 1034
402 Ga0496118_0010978 3300048921 Bacteria 8900
403 Ga0496119_0000469 3300048922 Bacteria 54992
404 Ga0496119_0018355 3300048922 Bacteria 5213
405 Ga0496119_0361620 3300048922 Bacteria 700
406 Ga0496120_0001942 3300048923 Bacteria 22686
407 Ga0496120_0005342 3300048923 Bacteria 10287
408 Ga0496120_0183298 3300048923 Bacteria 1026
409 Ga0496121_0033713 3300048924 Bacteria 4627
410 Ga0496121_0671296 3300048924 Bacteria 628
411 Ga0496122_0004250 3300048925 Bacteria 17968
412 Ga0496122_0055545 3300048925 Bacteria 2961
413 Ga0496122_0113059 3300048925 Bacteria 1775
414 Ga0496122_0125425 3300048925 Bacteria 1644
415 Ga0496122_0206519 3300048925 Bacteria 1142
416 Ga0496122_0219743 3300048925 Bacteria 1091
417 Ga0496123_0009904 3300048926 Bacteria 8505
418 Ga0496123_0022954 3300048926 Bacteria 4791
419 Ga0496123_0087199 3300048926 Bacteria 1868
420 Ga0496123_0208833 3300048926 Bacteria 994
421 Ga0496123_0402577 3300048926 Bacteria 622
422 Ga0496124_0000697 3300048927 Bacteria 55040
423 Ga0496124_0006669 3300048927 Bacteria 12517
424 Ga0496124_0107157 3300048927 Bacteria 2255
425 Ga0496125_0001385 3300048928 Bacteria 35466
426 Ga0496125_0006867 3300048928 Bacteria 12194
427 Ga0496125_0064220 3300048928 Bacteria 2919
428 Ga0496125_0251917 3300048928 Bacteria 1113
429 Ga0496126_0004931 3300048929 Bacteria 15577
430 Ga0496126_0077922 3300048929 Bacteria 2937
431 Ga0501306_002875 3300049127 Bacteria 1807
432 Ga0501306_007831 3300049127 Bacteria 1289
433 Ga0501306_012517 3300049127 Bacteria 1094
434 Ga0501306_022909 3300049127 Bacteria 884
435 Ga0501306_029958 3300049127 Bacteria 804
436 Ga0501306_044943 3300049127 Unclassified 694
437 Ga0501306_098674 3300049127 Unclassified 520
438 Ga0501308_016454 3300049128 Bacteria 886
439 Ga0501309_001139 3300049129 Bacteria 2497
440 Ga0501309_015650 3300049129 Bacteria 1028
441 Ga0501309_025141 3300049129 Bacteria 855
442 Ga0501310_017432 3300049130 Bacteria 869
443 Ga0501310_029164 3300049130 Bacteria 726
444 Ga0501304_010183 3300049160 Bacteria 818
445 Ga0501305_008999 3300049161 Bacteria 1304
446 Ga0501305_009999 3300049161 Bacteria 1258
447 Ga0501307_005857 3300049162 Bacteria 1309
448 Ga0501307_006027 3300049162 Bacteria 1296
449 Ga0495678_072001 3300049459 Bacteria 1264
450 Ga0501292_021489 3300049515 Bacteria 1045
451 Ga0501293_005660 3300049516 Bacteria 1005
452 Ga0501296_002825 3300049519 Bacteria 1838
453 Ga0501298_003896 3300049521 Bacteria 2330
454 Ga0501299_004790 3300049522 Bacteria 2046
455 Ga0501311_009516 3300049527 Bacteria 1162
456 Ga0501311_043227 3300049527 Bacteria 688
457 Ga0501311_044677 3300049527 Unclassified 680
458 Ga0501312_010059 3300049528 Bacteria 1259
459 Ga0501312_022606 3300049528 Bacteria 943
460 Ga0501312_029385 3300049528 Bacteria 856
461 Ga0501312_031968 3300049528 Bacteria 829
462 Ga0501313_009179 3300049529 Bacteria 1112
463 Ga0501313_015011 3300049529 Bacteria 921
464 Ga0501313_020363 3300049529 Bacteria 816
465 Ga0501313_027049 3300049529 Bacteria 732
466 Ga0501313_070309 3300049529 Unclassified 506
467 Ga0501315_019492 3300049531 Bacteria 903
468 Ga0501316_006875 3300049532 Bacteria 1222
469 Ga0501316_014218 3300049532 Bacteria 948
470 Ga0501317_008368 3300049533 Bacteria 1191
471 Ga0501317_012184 3300049533 Bacteria 1058
472 Ga0501318_030999 3300049534 Bacteria 727
473 Ga0501319_007726 3300049535 Bacteria 817
474 Ga0501320_029880 3300049536 Bacteria 674
475 Ga0501321_015741 3300049537 Bacteria 894
476 Ga0501321_019290 3300049537 Bacteria 835
477 Ga0501323_013738 3300049539 Bacteria 1005
478 Ga0501324_007387 3300049540 Bacteria 948
479 Ga0501324_012030 3300049540 Bacteria 806
480 Ga0501324_012530 3300049540 Bacteria 794
481 Ga0501326_02279 3300049542 Bacteria 936
482 Ga0501335_005754 3300049551 Bacteria 1115
483 Ga0501335_011403 3300049551 Bacteria 868
484 Ga0501338_04393 3300049554 Bacteria 854
485 Ga0501038_0005686 3300049574 Bacteria 11567
486 Ga0501202_004197 3300049652 Bacteria 2516
487 Ga0501207_075118 3300049654 Unclassified 641
488 Ga0501208_084498 3300049655 Bacteria 658
489 Ga0501217_009713 3300049661 Bacteria 2097
490 Ga0501217_059403 3300049661 Bacteria 1017
491 Ga0501223_035817 3300049663 Bacteria 965
492 Ga0501233_146174 3300049668 Unclassified 656
493 Ga0501235_050542 3300049669 Unclassified 963
494 Ga0501239_008750 3300049672 Bacteria 1087
495 Ga0501243_038383 3300049675 Unclassified 835
496 Ga0501249_033725 3300049679 Bacteria 1147
497 Ga0501255_061306 3300049684 Unclassified 598
498 Ga0501257_012972 3300049686 Bacteria 1909
499 Ga0501221_113032 3300049704 Unclassified 686
500 Ga0501225_0048972 3300049705 Bacteria 1174
501 Ga0501262_038395 3300049759 Unclassified 709
502 Ga0501263_035116 3300049760 Unclassified 720
503 Ga0501264_010438 3300049761 Bacteria 894
504 Ga0501267_004977 3300049764 Bacteria 1248
505 Ga0501272_011394 3300049769 Bacteria 1001
506 Ga0501279_017167 3300049775 Bacteria 1012
507 Ga0501279_029773 3300049775 Bacteria 806
508 Ga0501283_042275 3300049779 Unclassified 791
509 nmdc:mga05p37_141231_c1 3300050507 Bacteria 1649
510 nmdc:mga05p37_93723_c1 3300050507 Bacteria 3700
511 nmdc:mga0n895_493097_c1 3300050512 Bacteria 1235
512 nmdc:mga0n895_560157_c1 3300050512 Bacteria 1148
513 nmdc:mga0rr50_265_c1 3300050513 Bacteria 28369
514 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
515 nmdc:mga0a205_42199_c1 3300050515 Bacteria 4395
516 nmdc:mga0a205_873944_c1 3300050515 Unclassified 746
517 Ga0587066_018373 3300059490 Bacteria 1125
518 Ga0587070_019658 3300059491 Bacteria 1121
519 Ga0587077_019559 3300059493 Bacteria 1180
520 Ga0587080_014264 3300059503 Bacteria 1227
521 Ga0587080_090210 3300059503 Bacteria 642
522 Ga0587082_026371 3300059504 Bacteria 983
523 Ga0587082_027557 3300059504 Bacteria 969
524 Ga0587083_0002073 3300059505 Bacteria 2421
525 Ga0587083_0041110 3300059505 Bacteria 969
526 Ga0587088_017437 3300059508 Bacteria 1156
527 Ga0587106_024053 3300059605 Bacteria 929
528 Ga0587128_030847 3300059630 Bacteria 887
529 Ga0587067_008422 3300059640 Bacteria 1506
530 Ga0587067_018744 3300059640 Bacteria 1164
531 Ga0587067_039871 3300059640 Bacteria 908
532 Ga0587067_072301 3300059640 Bacteria 747
533 Ga0587072_037420 3300059643 Bacteria 931
534 Ga0587075_010803 3300059644 Bacteria 1214
535 Ga0587076_018092 3300059645 Bacteria 1131
536 Ga0587078_014225 3300059646 Bacteria 949
537 Ga0587079_018339 3300059647 Bacteria 1226
538 Ga0587079_021792 3300059647 Bacteria 1156
539 Ga0587079_058241 3300059647 Bacteria 830
540 Ga0587124_001812 3300059660 Bacteria 1438
541 Ga0587060_004808 3300060243 Bacteria 1039
542 Ga0587111_0098859 3300060346 Bacteria 724
543 2524190026 2524023129 Bacteria 6762600
544 2550903246 2548877040 Bacteria 7507281
545 2563930218 2563366752 Bacteria 4961801
546 2571530781 2571042143 Bacteria 6986194
547 2573041391 2571042588 Bacteria 5045676
548 2578338857 2576861424 Bacteria 5270569
549 2580935251 2579778775 Bacteria 5360914
550 2595320848 2593339198 Bacteria 7267884
551 2601641784 2600255286 Bacteria 5390125
552 2621273271 2619619294 Bacteria 5575484
553 2643738869 2643221543 Bacteria 6628015
554 2723606169 2721755693 Bacteria 6126117
555 2728529920 2728368933 Bacteria 7044283
556 2730136792 2728369359 Bacteria 5621728
557 2753813053 2751185905 Bacteria 6142767
558 2793182045 2791355222 Bacteria 5898266
559 2802440750 2802428803 Bacteria 5806948
560 2821118348 2821111986 Bacteria 6894338
561 2864738844 2864733723 Bacteria 6770668
562 2865007667 2865002811 Bacteria 6333767
563 2881639950 2881636855 Bacteria 5205297
564 2885529888 2885526491 Bacteria 7164189
565 2888584435 2888578766 Bacteria 6743310
566 2889047982 2889042446 Bacteria 7618936
567 2889053119 2889049205 Bacteria 7524325
568 2889276720 2889276214 Bacteria 5979355
569 2904168181 2904162308 Bacteria 7086713
570 2904496922 2904490793 Bacteria 7046938
571 2904600807 2904595352 Bacteria 6124848
572 2907208173 2907202186 Bacteria 6632024
573 2919166275 2919160200 Bacteria 6929020
574 2931385088 2931384279 Bacteria 7299545
575 2938653360 2938649242 Bacteria 7118381
576 2939685150 2939679117 Bacteria 6921672
577 2939707630 2939702853 Bacteria 5139229
578 2945996289 2945991243 Bacteria 7008369
579 2946058979 2946053406 Bacteria 6978655
580 2968562336 2968558590 Bacteria 6956864
581 2971406782 2971403814 Bacteria 7370929
582 2971513816 2971511577 Bacteria 5404012
583 2980128601 2980125574 Bacteria 5567337
584 2980179468 2980176882 Bacteria 5397533
585 2984531134 2984527788 Bacteria 5288478
586 2984537243 2984532647 Bacteria 5288506
587 2988229843 2988225383 Bacteria 7221625
588 2996636968 2996632988 Bacteria 6921523
589 2996709592 2996706504 Bacteria 5757485
590 648172160 648028048 Bacteria 5394884
591 8046991273 8046991243 Bacteria 8497463
592 8054471283 8054465665 Bacteria 7323556
593 8057473353 8057473075 Bacteria 5892720
594 8057735113 8057733483 Bacteria 6578323
595 8057979898 8057977335 Bacteria 5694872
596 Ga0265327_10122254
597 JGI25151J46595_10030742
598 JGI25151J46595_10088366
599 JGI25407J50210_10001798
600 Ga0007417J51691_1092551
601 Ga0007410J51695_1030879
602 Ga0007409J51694_1018080
603 Ga0007416J51690_1080628
604 Ga0006562J51391_1000361
605 JGI25404J52841_10074932
606 Ga0055538_1000286
607 Ga0055535_1000913
608 Ga0055536_1038168
609 Ga0055541_1000319
610 Ga0065704_10225729
611 Ga0065704_10322577
612 Ga0065712_10084153
613 Ga0065712_10260472
614 Ga0065715_10120348
615 Ga0065715_10446411
616 Ga0065715_10515378
617 Ga0065715_10609574
618 Ga0065715_11113185
619 Ga0065707_10020267
620 Ga0065707_10279810
621 Ga0065707_10570932
622 Ga0070690_100001592
623 Ga0070690_100009058
624 Ga0070690_100268012
625 Ga0070670_100005446
626 Ga0070670_100098512
627 Ga0070670_100293758
628 Ga0070670_100521739
629 Ga0068869_100033509
630 Ga0068869_100115605
631 Ga0068869_101050827
632 Ga0068869_102051561
633 Ga0070682_100000027
634 Ga0070682_101131009
635 Ga0068868_100019896
636 Ga0070689_100919858
637 Ga0070689_101009509
638 Ga0070691_10315051
639 Ga0070687_100055679
640 Ga0070661_101064997
641 Ga0070692_10138160
642 Ga0070668_100118318
643 Ga0070668_100208197
644 Ga0070668_100463075
645 Ga0070668_100517537
646 Ga0070669_100003065
647 Ga0070669_100038319
648 Ga0070669_100480699
649 Ga0070675_100615428
650 Ga0070674_100373437
651 Ga0070673_100203272
652 Ga0070673_100206553
653 Ga0070688_101065587
654 Ga0070659_100847858
655 Ga0070659_100987780
656 Ga0070667_100095317
657 Ga0070703_10101526
658 Ga0070701_10008882
659 Ga0070701_10893957
660 Ga0070705_100189144
661 Ga0070705_100251844
662 Ga0070705_100687571
663 Ga0070705_100726790
664 Ga0070705_101193732
665 Ga0070700_100646403
666 Ga0070694_100200293
667 Ga0070694_100271651
668 Ga0070694_100589998
669 Ga0070694_100705002
670 Ga0070694_101687716
671 Ga0070708_100000279
672 Ga0070708_100089869
673 Ga0070708_102276582
674 Ga0070662_100226505
675 Ga0070662_100293750
676 Ga0070662_101103706
677 Ga0068867_100228145
678 Ga0068867_100487661
679 Ga0068867_101040130
680 Ga0070706_100024957
681 Ga0070706_100223731
682 Ga0070707_100274265
683 Ga0070707_100381291
684 Ga0070707_100920774
685 Ga0070698_100019977
686 Ga0070698_100036168
687 Ga0070698_100047996
688 Ga0070699_100004091
689 Ga0070699_100022702
690 Ga0070699_100410921
691 Ga0070699_101502472
692 Ga0070699_101724264
693 Ga0070697_100000164
694 Ga0070697_100000628
695 Ga0070697_100010020
696 Ga0070697_100042670
697 Ga0068853_101215768
698 Ga0070672_100298493
699 Ga0070672_101583885
700 Ga0070686_100007160
701 Ga0070686_100025604
702 Ga0070686_100225128
703 Ga0070695_100193165
704 Ga0070695_101067121
705 Ga0070696_100103330
706 Ga0070696_100124110
707 Ga0070696_100338867
708 Ga0070696_100378450
709 Ga0070693_100356525
710 Ga0070665_101822049
711 Ga0070704_100104465
712 Ga0070704_100112472
713 Ga0070704_100189166
714 Ga0070704_100472128
715 Ga0068857_100321633
716 Ga0068857_100346148
717 Ga0070702_100126916
718 Ga0068859_100290653
719 Ga0068859_102529009
720 Ga0068864_100073142
721 Ga0068864_100241574
722 Ga0068864_100271418
723 Ga0068864_100411734
724 Ga0068864_100816114
725 Ga0068864_100978083
726 Ga0068864_101073373
727 Ga0068866_10267019
728 Ga0068861_100001094
729 Ga0068861_100023094
730 Ga0068861_100069112
731 Ga0068861_100117186
732 Ga0068861_100593071
733 Ga0068858_100075792
734 Ga0068858_101838163
735 Ga0068858_102077205
736 Ga0068860_100317615
737 Ga0068860_101830467
738 Ga0068862_100012881
739 Ga0068862_100149958
740 Ga0068862_100193364
741 Ga0068862_100614775
742 Ga0081455_10002928
743 Ga0081538_10001072
744 Ga0081540_1043210
745 Ga0081539_10003050
746 Ga0081539_10020392
747 Ga0097621_100696783
748 Ga0068871_100512026
749 Ga0075433_10069529
750 Ga0075433_10512413
751 Ga0075434_100067226
752 Ga0075434_100302305
753 Ga0068865_100842925
754 Ga0068865_101540037
755 Ga0097620_100290634
756 Ga0097620_102529499
757 Ga0075435_100116759
758 Ga0099794_10183839
759 Ga0105251_10006798
760 Ga0105250_10231480
761 Ga0105240_11123278
762 Ga0111539_12816828
763 Ga0105245_10271943
764 Ga0105245_10586228
765 Ga0105247_10005646
766 Ga0105247_10494270
767 Ga0105247_11164824
768 Ga0114129_10565859
769 Ga0105243_10043067
770 Ga0105243_10500887
771 Ga0105243_11076214
772 Ga0105241_10130360
773 Ga0105241_10702136
774 Ga0105242_10871105
775 Ga0105242_11377576
776 Ga0105248_11387876
777 Ga0105249_10000463
778 Ga0105249_10196158
779 Ga0105249_10687960
780 Ga0105239_11683732
781 Ga0105246_10000488
782 Ga0105246_10118387
783 Ga0157378_10239809
784 Ga0157378_10464736
785 Ga0157378_10856339
786 Ga0157378_10894516
787 Ga0157378_11992148
788 Ga0163162_10000452
789 Ga0163162_11022739
790 Ga0163162_11653798
791 Ga0157375_10093332
792 Ga0157375_10756725
793 Ga0157375_10902769
794 Ga0163163_10016843
795 Ga0163163_10276543
796 Ga0163163_10317414
797 Ga0163163_10711922
798 Ga0157380_10009263
799 Ga0157380_10021381
800 Ga0157380_10882126
801 Ga0157379_10712087
802 Ga0157379_10795890
803 Ga0206356_10440406
804 Ga0206350_10944546
805 Ga0224712_10157380
806 Ga0209784_100141
807 Ga0209566_100221
808 Ga0209566_100512
809 Ga0209258_104105
810 Ga0209675_1008692
811 Ga0209676_1010941
812 Ga0209025_1000976
813 Ga0209025_1033095
814 Ga0207696_1144891
815 Ga0207682_10211187
816 Ga0207682_10278453
817 Ga0207682_10358980
818 Ga0207642_10166443
819 Ga0207710_10001099
820 Ga0207710_10013708
821 Ga0207647_10118177
822 Ga0207684_10040952
823 Ga0207684_10249188
824 Ga0207654_10367490
825 Ga0207654_10476181
826 Ga0207671_10377775
827 Ga0207662_10006571
828 Ga0207652_10085294
829 Ga0207646_11188185
830 Ga0207681_10015195
831 Ga0207681_10026245
832 Ga0207681_10469016
833 Ga0207650_10000891
834 Ga0207650_10225893
835 Ga0207659_10714644
836 Ga0207687_10239847
837 Ga0207644_10376173
838 Ga0207690_10395302
839 Ga0207706_10172061
840 Ga0207706_10248884
841 Ga0207706_10356843
842 Ga0207686_10659815
843 Ga0207686_11037504
844 Ga0207709_10083939
845 Ga0207709_10452603
846 Ga0207670_10323950
847 Ga0207670_10431431
848 Ga0207704_10597483
849 Ga0207704_10782570
850 Ga0207689_10045053
851 Ga0207689_10818194
852 Ga0207689_11708141
853 Ga0207679_10138149
854 Ga0207651_10083170
855 Ga0207651_10212503
856 Ga0207712_10000128
857 Ga0207712_10133170
858 Ga0207712_10278696
859 Ga0207712_11219029
860 Ga0207668_10019795
861 Ga0207668_10097275
862 Ga0207668_10480066
863 Ga0207640_10034237
864 Ga0207640_10398422
865 Ga0207658_10661638
866 Ga0207703_10654038
867 Ga0207708_10310875
868 Ga0207702_11455011
869 Ga0207641_10223821
870 Ga0207641_11575699
871 Ga0207641_12269481
872 Ga0207648_10103048
873 Ga0207648_10222577
874 Ga0207648_10542303
875 Ga0207676_10241455
876 Ga0207676_10391328
877 Ga0207676_10519449
878 Ga0207674_10102470
879 Ga0207674_10139924
880 Ga0207674_11094070
881 Ga0207675_100013331
882 Ga0207675_100018047
883 Ga0207675_100022156
884 Ga0207675_100162072
885 Ga0207675_102358029
886 Ga0207698_10610586
887 Ga0268266_10908003
888 Ga0268266_11718689
889 Ga0268265_10040491
890 Ga0268265_10046861
891 Ga0268265_10061860
892 Ga0268265_10174484
893 Ga0268265_11139341
894 Ga0268265_11648325
895 Ga0268264_10078905
896 Ga0268264_10243507
897 Ga0307511_10021467
898 Ga0316183_1010449
899 Ga0307405_10060380
900 Ga0307413_10002971
901 Ga0307410_10007070
902 Ga0307410_10147685
903 Ga0307410_10817150
904 Ga0307406_10096672
905 Ga0307407_10009766
906 Ga0307407_10246061
907 Ga0307407_10658726
908 Ga0307407_10728229
909 Ga0307407_10952776
910 Ga0307409_100050397
911 Ga0307409_100205254
912 Ga0307409_100397510
913 Ga0307409_100477765
914 Ga0307409_100519587
915 Ga0307409_100659700
916 Ga0307416_100381607
917 Ga0307414_10683521
918 Ga0307414_11409254
919 Ga0307411_10004156
920 Ga0307411_10026931
921 Ga0307415_100024811
922 Ga0307415_100077388
923 Ga0307415_100621080
924 Ga0307415_101141288
925 Ga0316596_1076620
926 Ga0373930_0196902
927 Ga0373939_0320009
928 Ga0373960_0302684
929 Ga0395900_1617923
930 Ga0395898_0918479
931 Ga0395905_0356906
932 Ga0395905_1276434
933 Ga0395901_0687753
934 Ga0242422_04110
935 Ga0439436_0002823
936 Ga0439438_120840
937 Ga0439439_0007382
938 Ga0451792_18439
939 Ga0451805_119312
940 Ga0451843_0726711
941 Ga0451853_0525864
942 Ga0439433_0018955
943 Ga0439433_0117183
944 Ga0439445_0236830
945 Ga0439432_089988
946 Ga0439432_171079
947 Ga0439449_0000074
948 Ga0439449_0158547
949 Ga0439457_006395
950 Ga0439462_0002581
951 Ga0439462_0011797
952 Ga0439434_0018670
953 Ga0439434_0135374
954 Ga0439444_0118779
955 Ga0453684_0635899
956 Ga0451576_0529434
957 Ga0451576_0559850
958 Ga0451576_0821537
959 Ga0451576_1901281
960 Ga0466967_0302641
961 Ga0495627_060719
962 Ga0495590_0036527
963 Ga0495591_037803
964 Ga0495596_0197265
965 Ga0495606_0043775
966 Ga0495606_0150220
967 Ga0495663_0000452
968 Ga0495598_0009969
969 Ga0495621_0000159
970 Ga0495622_0268970
971 Ga0495656_0137702
972 Ga0495656_0337847
973 Ga0495649_0179138
974 Ga0495660_0028392
975 Ga0495636_0075945
976 Ga0495672_0142505
977 Ga0495685_160993
978 Ga0495681_0205285
979 Ga0495626_0019091
980 Ga0495626_0136327
981 Ga0496106_0019234
982 Ga0496106_1134239
983 Ga0496108_0033874
984 Ga0496109_1351344
985 Ga0496110_1622150
986 Ga0496111_0579033
987 Ga0496112_1580719
988 Ga0496116_0003008
989 Ga0496116_0013016
990 Ga0496116_0018736
991 Ga0496116_0058376
992 Ga0496116_0105130
993 Ga0496116_0407427
994 Ga0496117_0011793
995 Ga0496117_0020536
996 Ga0496117_0227159
997 Ga0496118_0010978
998 Ga0496119_0000469
999 Ga0496119_0018355
1000 Ga0496119_0361620
1001 Ga0496120_0001942
1002 Ga0496120_0005342
1003 Ga0496120_0183298
1004 Ga0496121_0033713
1005 Ga0496121_0671296
1006 Ga0496122_0004250
1007 Ga0496122_0055545
1008 Ga0496122_0113059
1009 Ga0496122_0125425
1010 Ga0496122_0206519
1011 Ga0496122_0219743
1012 Ga0496123_0009904
1013 Ga0496123_0022954
1014 Ga0496123_0087199
1015 Ga0496123_0208833
1016 Ga0496123_0402577
1017 Ga0496124_0000697
1018 Ga0496124_0006669
1019 Ga0496124_0107157
1020 Ga0496125_0001385
1021 Ga0496125_0006867
1022 Ga0496125_0064220
1023 Ga0496125_0251917
1024 Ga0496126_0004931
1025 Ga0496126_0077922
1026 Ga0501306_002875
1027 Ga0501306_007831
1028 Ga0501306_012517
1029 Ga0501306_022909
1030 Ga0501306_029958
1031 Ga0501306_044943
1032 Ga0501306_098674
1033 Ga0501308_016454
1034 Ga0501309_001139
1035 Ga0501309_015650
1036 Ga0501309_025141
1037 Ga0501310_017432
1038 Ga0501310_029164
1039 Ga0501304_010183
1040 Ga0501305_008999
1041 Ga0501305_009999
1042 Ga0501307_005857
1043 Ga0501307_006027
1044 Ga0495678_072001
1045 Ga0501292_021489
1046 Ga0501293_005660
1047 Ga0501296_002825
1048 Ga0501298_003896
1049 Ga0501299_004790
1050 Ga0501311_009516
1051 Ga0501311_043227
1052 Ga0501311_044677
1053 Ga0501312_010059
1054 Ga0501312_022606
1055 Ga0501312_029385
1056 Ga0501312_031968
1057 Ga0501313_009179
1058 Ga0501313_015011
1059 Ga0501313_020363
1060 Ga0501313_027049
1061 Ga0501313_070309
1062 Ga0501315_019492
1063 Ga0501316_006875
1064 Ga0501316_014218
1065 Ga0501317_008368
1066 Ga0501317_012184
1067 Ga0501318_030999
1068 Ga0501319_007726
1069 Ga0501320_029880
1070 Ga0501321_015741
1071 Ga0501321_019290
1072 Ga0501323_013738
1073 Ga0501324_007387
1074 Ga0501324_012030
1075 Ga0501324_012530
1076 Ga0501326_02279
1077 Ga0501335_005754
1078 Ga0501335_011403
1079 Ga0501338_04393
1080 Ga0501038_0005686
1081 Ga0501202_004197
1082 Ga0501207_075118
1083 Ga0501208_084498
1084 Ga0501217_009713
1085 Ga0501217_059403
1086 Ga0501223_035817
1087 Ga0501233_146174
1088 Ga0501235_050542
1089 Ga0501239_008750
1090 Ga0501243_038383
1091 Ga0501249_033725
1092 Ga0501255_061306
1093 Ga0501257_012972
1094 Ga0501221_113032
1095 Ga0501225_0048972
1096 Ga0501262_038395
1097 Ga0501263_035116
1098 Ga0501264_010438
1099 Ga0501267_004977
1100 Ga0501272_011394
1101 Ga0501279_017167
1102 Ga0501279_029773
1103 Ga0501283_042275
1104 nmdc:mga05p37_141231_c1
1105 nmdc:mga05p37_93723_c1
1106 nmdc:mga0n895_493097_c1
1107 nmdc:mga0n895_560157_c1
1108 nmdc:mga0rr50_265_c1
1109 nmdc:mga08x19_3_c1
1110 nmdc:mga0a205_42199_c1
1111 nmdc:mga0a205_873944_c1
1112 Ga0587066_018373
1113 Ga0587070_019658
1114 Ga0587077_019559
1115 Ga0587080_014264
1116 Ga0587080_090210
1117 Ga0587082_026371
1118 Ga0587082_027557
1119 Ga0587083_0002073
1120 Ga0587083_0041110
1121 Ga0587088_017437
1122 Ga0587106_024053
1123 Ga0587128_030847
1124 Ga0587067_008422
1125 Ga0587067_018744
1126 Ga0587067_039871
1127 Ga0587067_072301
1128 Ga0587072_037420
1129 Ga0587075_010803
1130 Ga0587076_018092
1131 Ga0587078_014225
1132 Ga0587079_018339
1133 Ga0587079_021792
1134 Ga0587079_058241
1135 Ga0587124_001812
1136 Ga0587060_004808
1137 Ga0587111_0098859
1138 2524190026
1139 2550903246
1140 2563930218
1141 2571530781
1142 2573041391
1143 2578338857
1144 2580935251
1145 2595320848
1146 2601641784
1147 2621273271
1148 2643738869
1149 2723606169
1150 2728529920
1151 2730136792
1152 2753813053
1153 2793182045
1154 2802440750
1155 2821118348
1156 2864738844
1157 2865007667
1158 2881639950
1159 2885529888
1160 2888584435
1161 2889047982
1162 2889053119
1163 2889276720
1164 2904168181
1165 2904496922
1166 2904600807
1167 2907208173
1168 2919166275
1169 2931385088
1170 2938653360
1171 2939685150
1172 2939707630
1173 2945996289
1174 2946058979
1175 2968562336
1176 2971406782
1177 2971513816
1178 2980128601
1179 2980179468
1180 2984531134
1181 2984537243
1182 2988229843
1183 2996636968
1184 2996709592
1185 648172160
1186 8046991273
1187 8054471283
1188 8057473353
1189 8057735113
1190 8057979898

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

14

132

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c99-assembly1.cif.gz_J cryo-em captures early ribosome assembly in action 0.8942 3 141
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.8938 6 144
6xyw-assembly1.cif.gz_Aj structure of the plant mitochondrial ribosome 0.8932 15 144
7m4w-assembly1.cif.gz_I a. baumannii ribosome-eravacycline complex: empty 70s 0.8917 4 141
7a5h-assembly1.cif.gz_K structure of the split human mitoribosomal large subunit with rescue factors mtrf-r and mtres1 0.8906 14 145
ID Description Score Start End Superfamily
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9329 13 145 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9309 13 145 3.90.1180.10
af_Q554U7_3_170_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9129 9 136 3.90.1180.10
af_Q5XFW4_1_178_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.8946 13 145 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.8934 3 142 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A3B4X4E0-F1-model_v4 50S ribosomal protein L13 0.9427 13 145 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A1F6LAI9-F1-model_v4 Large ribosomal subunit protein uL13 0.9414 13 145 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A660VCC6-F1-model_v4 Large ribosomal subunit protein uL13 0.9387 13 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A5D3CLX7-F1-model_v4 Transcription termination factor MTERF5 0.9359 14 145 GO:0003690
GO:0003729
GO:0003735
GO:0005762
GO:0006353
GO:0006355
GO:0006412
GO:0017148
AF-A0A836QTA4-F1-model_v4 Large ribosomal subunit protein uL13 0.9354 13 142 GO:0003729
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0017148
GO:1990904

Map