F467349

General Info

Members Datasets Scaffolds Average Seq Length
594 396 532 385

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10027362|Ga0307513_100273625
Length 416
Sequence MRTREHSRLSPEAAAVLSALPPGQARLSGTTRRTVLRGLLAAGAFAATGGALTACGMPGTRQDPAACRAPDESASDKKLAISNWPLYIDVDENDETKRPSVEAFTKQTGIEVTYQEDINDNNEFFGKVRNQLSACQAIDRDIMVLTDWMAARMIRLGWVQPLQKDKLPNVDANLLDSLRGRSWDKNTEYAVPWQTGLSGIAFNGNVTKEVRTVDELLTRPDLKGKVTMLSEMRDTMGLMMLADGADPANFTEEQYDHALTRLQAAVDSGQIRRFTGNDYAQELAKGDIAACVAWSGDVIQLNFEDEKVQFVTPDAGVMLWSDNMQVPNEATHQENAEAFMNYYYEPSVAAELAAWVNYICPVKGAQAEMESIDPELAANPLIFPDQSVLSSAKVFMALNEAEERIYEQKFQQVIGA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
6 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
9 2643221714 Streptomyces sp. Root264 Isolate Unclassified
10 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
11 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
12 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
13 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
14 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
15 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
16 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
17 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
18 2808606448 Streptomyces sp. 193411 Isolate Unclassified
19 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
20 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
21 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
22 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
23 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
24 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
25 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
26 2862574272 Streptomyces sp. AcE210 Isolate Nodule
27 2867428634 Streptomyces sp. RP5T Isolate Unclassified
28 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
29 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
30 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
31 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
32 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
33 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
34 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
35 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
36 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
37 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
38 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
39 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
40 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
41 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
42 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
43 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
44 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
45 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
46 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
47 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
48 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
49 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
50 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
51 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
52 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
53 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
54 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
57 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
58 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
63 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
64 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
73 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
74 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
82 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
105 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
222 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
223 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
229 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
230 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
233 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
303 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
322 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
325 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
367 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
368 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
369 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
376 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
379 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
380 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
382 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
383 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
384 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
387 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
388 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
389 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
390 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
391 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
392 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
393 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
394 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
395 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
396 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.05
Metatranscriptomes 1.52
Isolates 10.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0.67
Rhizoplane 4.21
Rhizosphere 84.01
Stem 0
Stem Tuber 0
Unclassified 8.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10016582 3300001989 Bacteria 2666
2 JGI24735J21928_10021419 3300002067 Bacteria 1974
3 JGI24738J21930_10011357 3300002075 Bacteria 1960
4 JGI25406J46586_10001018 3300003203 Bacteria 13133
5 rootH1_10010547 3300003316 Bacteria 2607
6 rootH1_10033378 3300003316 Bacteria 2323
7 rootH2_10033896 3300003320 Bacteria 3275
8 rootL2_10071172 3300003322 Bacteria 1910
9 JGI25160J50197_1012981 3300003354 Bacteria 2860
10 Ga0058859_11190849 3300004798 Bacteria 1535
11 Ga0058860_12198597 3300004801 Bacteria 1382
12 Ga0070676_10091013 3300005328 Bacteria 1869
13 Ga0070683_100000288 3300005329 Bacteria 34747
14 Ga0070683_100000481 3300005329 Bacteria 28092
15 Ga0070683_100005284 3300005329 Bacteria 10753
16 Ga0070683_100013435 3300005329 Bacteria 7142
17 Ga0070683_100029574 3300005329 Bacteria 4962
18 Ga0070683_100036163 3300005329 Bacteria 4517
19 Ga0070683_100041185 3300005329 Bacteria 4248
20 Ga0070683_100062833 3300005329 Bacteria 3453
21 Ga0070670_100013950 3300005331 Bacteria 6891
22 Ga0068869_100124369 3300005334 Bacteria 1976
23 Ga0070666_10007530 3300005335 Bacteria 6712
24 Ga0070682_100000815 3300005337 Bacteria 18228
25 Ga0070660_100142946 3300005339 Bacteria 1921
26 Ga0070689_100247790 3300005340 Bacteria 1469
27 Ga0070691_10037210 3300005341 Bacteria 2296
28 Ga0070687_100052471 3300005343 Bacteria 2116
29 Ga0070661_100037882 3300005344 Bacteria 3509
30 Ga0070661_100107774 3300005344 Bacteria 2078
31 Ga0070692_10057853 3300005345 Bacteria 2034
32 Ga0070668_100002947 3300005347 Bacteria 12579
33 Ga0070668_100007037 3300005347 Bacteria 8335
34 Ga0070668_100060950 3300005347 Bacteria 2923
35 Ga0070667_100002992 3300005367 Bacteria 14517
36 Ga0070714_100114737 3300005435 Bacteria 2390
37 Ga0070713_100000076 3300005436 Bacteria 61668
38 Ga0070701_10051624 3300005438 Bacteria 2134
39 Ga0070711_100138059 3300005439 Bacteria 1824
40 Ga0070700_100000859 3300005441 Bacteria 14995
41 Ga0070678_100272445 3300005456 Bacteria 1428
42 Ga0070662_100118357 3300005457 Bacteria 2027
43 Ga0070685_10033933 3300005466 Bacteria 2871
44 Ga0070685_10065160 3300005466 Bacteria 2144
45 Ga0070685_10130444 3300005466 Bacteria 1571
46 Ga0070684_100001695 3300005535 Bacteria 16034
47 Ga0070684_100010251 3300005535 Bacteria 7419
48 Ga0070672_100070841 3300005543 Bacteria 2771
49 Ga0070686_100032182 3300005544 Bacteria 3213
50 Ga0070686_100105005 3300005544 Bacteria 1915
51 Ga0070693_100207352 3300005547 Bacteria 1277
52 Ga0070665_100007269 3300005548 Bacteria 11253
53 Ga0070665_100054350 3300005548 Bacteria 4016
54 Ga0070704_100072001 3300005549 Bacteria 2513
55 Ga0070664_100041141 3300005564 Bacteria 3899
56 Ga0070664_100161454 3300005564 Bacteria 1983
57 Ga0068857_100001044 3300005577 Bacteria 21432
58 Ga0068857_100004457 3300005577 Bacteria 11832
59 Ga0068854_100000115 3300005578 Bacteria 55089
60 Ga0068856_100000057 3300005614 Bacteria 102045
61 Ga0068856_100031605 3300005614 Bacteria 5181
62 Ga0070702_100024072 3300005615 Bacteria 3244
63 Ga0068859_100101456 3300005617 Bacteria 2935
64 Ga0068861_100159686 3300005719 Bacteria 1858
65 Ga0068851_10002118 3300005834 Bacteria 8726
66 Ga0068863_100015526 3300005841 Bacteria 7317
67 Ga0068858_100123240 3300005842 Bacteria 2425
68 Ga0068862_100000391 3300005844 Bacteria 47191
69 Ga0081455_10017265 3300005937 Bacteria 6926
70 Ga0081455_10096845 3300005937 Bacteria 2378
71 Ga0081538_10006851 3300005981 Bacteria 9927
72 Ga0081538_10051026 3300005981 Bacteria 2489
73 Ga0081539_10000204 3300005985 Bacteria 137351
74 Ga0081539_10000294 3300005985 Bacteria 112974
75 Ga0075368_10009675 3300006042 Bacteria 3472
76 Ga0075432_10017879 3300006058 Bacteria 2418
77 Ga0070715_10000003 3300006163 Bacteria 345282
78 Ga0075367_10061654 3300006178 Bacteria 2238
79 Ga0075428_100005004 3300006844 Bacteria 14724
80 Ga0075428_100149052 3300006844 Bacteria 2541
81 Ga0075428_100149773 3300006844 Bacteria 2535
82 Ga0075430_100012865 3300006846 Bacteria 7131
83 Ga0075430_100191476 3300006846 Bacteria 1700
84 Ga0075431_100042635 3300006847 Bacteria 4681
85 Ga0075431_100149555 3300006847 Bacteria 2405
86 Ga0075433_10133747 3300006852 Unclassified 2204
87 Ga0097620_100101458 3300006931 Bacteria 2935
88 Ga0099826_10020921 3300006948 Bacteria 4902
89 Ga0105251_10005290 3300009011 Bacteria 8492
90 Ga0105244_10088123 3300009036 Bacteria 1529
91 Ga0111539_10001342 3300009094 Bacteria 32789
92 Ga0111539_10002146 3300009094 Bacteria 26383
93 Ga0111539_10036359 3300009094 Bacteria 5955
94 Ga0111539_10086978 3300009094 Bacteria 3672
95 Ga0111539_10120234 3300009094 Unclassified 3078
96 Ga0111539_10233854 3300009094 Bacteria 2139
97 Ga0111539_10276033 3300009094 Bacteria 1956
98 Ga0105245_10002031 3300009098 Bacteria 18358
99 Ga0105245_10055296 3300009098 Bacteria 3565
100 Ga0105245_10062351 3300009098 Bacteria 3364
101 Ga0105245_10169192 3300009098 Bacteria 2080
102 Ga0105247_10092397 3300009101 Unclassified 1922
103 Ga0114129_10038933 3300009147 Bacteria 6701
104 Ga0114129_10179735 3300009147 Bacteria 2880
105 Ga0114129_10678441 3300009147 Bacteria 1327
106 Ga0105243_10110533 3300009148 Bacteria 2298
107 Ga0105243_10249498 3300009148 Bacteria 1584
108 Ga0105241_10106509 3300009174 Bacteria 2238
109 Ga0105242_10046981 3300009176 Bacteria 3504
110 Ga0105249_10000841 3300009553 Bacteria 27506
111 Ga0105249_10018644 3300009553 Bacteria 6180
112 Ga0105249_10073501 3300009553 Bacteria 3163
113 Ga0105239_10037606 3300010375 Bacteria 5304
114 Ga0105239_10042952 3300010375 Bacteria 4953
115 Ga0105239_10051572 3300010375 Bacteria 4510
116 Ga0105239_10229631 3300010375 Bacteria 2082
117 Ga0105246_10019404 3300011119 Bacteria 4344
118 Ga0105246_10041556 3300011119 Bacteria 3108
119 Ga0157371_10023682 3300013102 Bacteria 4489
120 Ga0157370_10032556 3300013104 Bacteria 5090
121 Ga0157369_10048428 3300013105 Bacteria 4612
122 Ga0157369_10361792 3300013105 Unclassified 1506
123 Ga0157378_10012517 3300013297 Bacteria 7425
124 Ga0163162_10036994 3300013306 Bacteria 4869
125 Ga0157372_10000616 3300013307 Bacteria 38850
126 Ga0157372_10199044 3300013307 Bacteria 2320
127 Ga0157375_10086906 3300013308 Bacteria 3178
128 Ga0157375_10129642 3300013308 Bacteria 2640
129 Ga0163163_10241602 3300014325 Bacteria 1856
130 Ga0157380_10000024 3300014326 Bacteria 110947
131 Ga0157380_10114791 3300014326 Bacteria 2270
132 Ga0182008_10006184 3300014497 Bacteria 6727
133 Ga0157377_10087637 3300014745 Bacteria 1832
134 Ga0157379_10054784 3300014968 Bacteria 3563
135 Ga0157379_10240557 3300014968 Bacteria 1642
136 Ga0182007_10011226 3300015262 Bacteria 3494
137 Ga0183367_1013 3300015688 Bacteria 334176
138 Ga0163161_10073856 3300017792 Bacteria 2500
139 Ga0197907_10354677 3300020069 Bacteria 2326
140 Ga0206356_11472949 3300020070 Bacteria 4321
141 Ga0206351_10029283 3300020077 Bacteria 3161
142 Ga0206352_11234775 3300020078 Bacteria 3132
143 Ga0206350_11301258 3300020080 Bacteria 2871
144 Ga0154015_1287331 3300020610 Bacteria 1545
145 Ga0224712_10003493 3300022467 Bacteria 4094
146 Ga0209758_1004580 3300025297 Bacteria 11393
147 Ga0207426_1018696 3300025302 Bacteria 2438
148 Ga0207713_1016850 3300025735 Bacteria 3692
149 Ga0207642_10012027 3300025899 Bacteria 3110
150 Ga0207688_10045246 3300025901 Bacteria 2455
151 Ga0207688_10074080 3300025901 Bacteria 1936
152 Ga0207647_10009632 3300025904 Bacteria 6858
153 Ga0207685_10000003 3300025905 Bacteria 344527
154 Ga0207645_10037301 3300025907 Bacteria 3118
155 Ga0207643_10007579 3300025908 Bacteria 5827
156 Ga0207654_10075598 3300025911 Bacteria 2013
157 Ga0207693_10000859 3300025915 Bacteria 27121
158 Ga0207687_10000350 3300025927 Bacteria 30682
159 Ga0207687_10008276 3300025927 Bacteria 6804
160 Ga0207687_10141629 3300025927 Bacteria 1825
161 Ga0207700_10000009 3300025928 Bacteria 314953
162 Ga0207664_10044349 3300025929 Bacteria 3482
163 Ga0207644_10071585 3300025931 Bacteria 2537
164 Ga0207706_10050046 3300025933 Bacteria 3693
165 Ga0207706_10073832 3300025933 Bacteria 2999
166 Ga0207706_10193079 3300025933 Bacteria 1787
167 Ga0207669_10031304 3300025937 Bacteria 2971
168 Ga0207704_10027421 3300025938 Bacteria 3143
169 Ga0207691_10043075 3300025940 Bacteria 4161
170 Ga0207711_10105332 3300025941 Bacteria 2501
171 Ga0207689_10086973 3300025942 Bacteria 2568
172 Ga0207661_10000166 3300025944 Bacteria 42698
173 Ga0207661_10001864 3300025944 Bacteria 14438
174 Ga0207679_10033855 3300025945 Bacteria 3599
175 Ga0207679_10086996 3300025945 Bacteria 2405
176 Ga0207679_10131459 3300025945 Bacteria 2009
177 Ga0207712_10008190 3300025961 Bacteria 6607
178 Ga0207712_10166793 3300025961 Bacteria 1717
179 Ga0207712_10219167 3300025961 Bacteria 1520
180 Ga0207668_10002710 3300025972 Bacteria 10367
181 Ga0207668_10043248 3300025972 Bacteria 3056
182 Ga0207668_10130247 3300025972 Bacteria 1920
183 Ga0207640_10000059 3300025981 Bacteria 90901
184 Ga0207658_10001012 3300025986 Bacteria 22933
185 Ga0207677_10151639 3300026023 Bacteria 1789
186 Ga0207677_10193462 3300026023 Bacteria 1611
187 Ga0207639_10277165 3300026041 Bacteria 1473
188 Ga0207678_10044529 3300026067 Bacteria 3838
189 Ga0207708_10005542 3300026075 Bacteria 9312
190 Ga0207708_10018003 3300026075 Bacteria 5316
191 Ga0207702_10000027 3300026078 Bacteria 183792
192 Ga0207702_10004385 3300026078 Bacteria 12570
193 Ga0207648_10026752 3300026089 Bacteria 5124
194 Ga0207674_10000156 3300026116 Bacteria 80650
195 Ga0207674_10006396 3300026116 Bacteria 13866
196 Ga0207674_10013677 3300026116 Bacteria 8990
197 Ga0207674_10020515 3300026116 Bacteria 7138
198 Ga0207675_100152168 3300026118 Bacteria 2202
199 Ga0207683_10037429 3300026121 Bacteria 4225
200 Ga0209371_1009618 3300027312 Bacteria 3054
201 Ga0209813_10004237 3300027866 Bacteria 3410
202 Ga0207428_10010741 3300027907 Bacteria 8168
203 Ga0207428_10021489 3300027907 Bacteria 5464
204 Ga0207428_10204093 3300027907 Bacteria 1487
205 Ga0268266_10000664 3300028379 Bacteria 46506
206 Ga0268266_10032922 3300028379 Bacteria 4406
207 Ga0268265_10000440 3300028380 Bacteria 43839
208 Ga0268265_10075616 3300028380 Bacteria 2639
209 Ga0307517_10027373 3300028786 Bacteria 6849
210 Ga0307515_10004249 3300028794 Bacteria 29735
211 Ga0307515_10081143 3300028794 Bacteria 4217
212 Ga0268256_1008087 3300030500 Bacteria 3649
213 Ga0307511_10000330 3300030521 Bacteria 50161
214 Ga0307511_10065907 3300030521 Bacteria 2704
215 Ga0307512_10007323 3300030522 Bacteria 10962
216 Ga0307513_10027362 3300031456 Bacteria 6550
217 Ga0307513_10122524 3300031456 Bacteria 2564
218 Ga0307513_10122676 3300031456 Bacteria 2561
219 Ga0307509_10070928 3300031507 Bacteria 3636
220 Ga0307408_100049093 3300031548 Bacteria 3030
221 Ga0307508_10021674 3300031616 Bacteria 5843
222 Ga0307514_10069054 3300031649 Bacteria 2660
223 Ga0307516_10096302 3300031730 Bacteria 2780
224 Ga0307405_10002494 3300031731 Bacteria 8135
225 Ga0307405_10015809 3300031731 Bacteria 4097
226 Ga0307518_10081976 3300031838 Bacteria 2328
227 Ga0307406_10028815 3300031901 Bacteria 3357
228 Ga0307406_10032918 3300031901 Bacteria 3168
229 Ga0307407_10010899 3300031903 Bacteria 4305
230 Ga0307409_100011102 3300031995 Bacteria 5654
231 Ga0307409_100014187 3300031995 Bacteria 5167
232 Ga0307409_100303677 3300031995 Bacteria 1486
233 Ga0307416_100000623 3300032002 Bacteria 18266
234 Ga0307416_100004246 3300032002 Bacteria 8602
235 Ga0307411_10004616 3300032005 Bacteria 6631
236 Ga0307415_100000256 3300032126 Bacteria 23002
237 Ga0307415_100002785 3300032126 Bacteria 8755
238 Ga0307507_10038524 3300033179 Bacteria 4843
239 Ga0307507_10069397 3300033179 Bacteria 3207
240 Ga0307510_10010376 3300033180 Bacteria 11066
241 Ga0307510_10052245 3300033180 Bacteria 4311
242 Ga0373960_0005121 3300035121 Bacteria 3023
243 Ga0373960_0015284 3300035121 Bacteria 1957
244 Ga0316574_0009190 3300035398 Bacteria 5526
245 Ga0373931_0072610 3300035691 Bacteria 1882
246 Ga0395899_0002021 3300037312 Bacteria 16714
247 Ga0395899_0007160 3300037312 Bacteria 8634
248 Ga0395900_0007778 3300037418 Bacteria 11058
249 Ga0395900_0045971 3300037418 Bacteria 4496
250 Ga0395900_0079332 3300037418 Bacteria 3373
251 Ga0395898_0004136 3300037466 Bacteria 15914
252 Ga0395898_0004392 3300037466 Bacteria 15422
253 Ga0395898_0058489 3300037466 Bacteria 3752
254 Ga0395898_0129837 3300037466 Bacteria 2414
255 Ga0395905_0018273 3300037471 Bacteria 6656
256 Ga0395905_0057557 3300037471 Bacteria 3636
257 Ga0395905_0070489 3300037471 Bacteria 3276
258 Ga0395905_0132661 3300037471 Bacteria 2343
259 Ga0395905_0281452 3300037471 Unclassified 1549
260 Ga0395901_0011756 3300038443 Bacteria 8873
261 Ga0395901_0060217 3300038443 Bacteria 3950
262 Ga0439436_0013029 3300041404 Bacteria 2517
263 Ga0439433_0000942 3300041999 Bacteria 5831
264 Ga0439448_0007983 3300042005 Bacteria 3085
265 Ga0439432_045951 3300042006 Bacteria 1373
266 Ga0439449_0001531 3300042007 Bacteria 9045
267 Ga0439449_0011276 3300042007 Bacteria 3365
268 Ga0439457_000238 3300042014 Bacteria 14826
269 Ga0450898_001885 3300042134 Bacteria 2843
270 Ga0450899_001520 3300042135 Bacteria 2578
271 Ga0450903_000229 3300042138 Bacteria 12488
272 Ga0450906_002805 3300042145 Bacteria 3796
273 Ga0439446_0002277 3300042156 Bacteria 4581
274 Ga0439458_0000860 3300042157 Bacteria 7849
275 Ga0450908_003464 3300042184 Bacteria 3067
276 Ga0466969_0026698 3300044656 Bacteria 2961
277 Ga0466972_0032099 3300044658 Bacteria 2579
278 Ga0466972_0033546 3300044658 Bacteria 2517
279 Ga0466972_0039606 3300044658 Bacteria 2299
280 Ga0466972_0056308 3300044658 Bacteria 1891
281 Ga0466965_0005551 3300044683 Bacteria 5689
282 Ga0466966_0002355 3300044684 Bacteria 12341
283 Ga0466966_0002457 3300044684 Bacteria 12116
284 Ga0466961_0005711 3300044693 Bacteria 7873
285 Ga0466961_0044320 3300044693 Bacteria 2846
286 Ga0466963_0000405 3300044694 Bacteria 19720
287 Ga0466963_0092748 3300044694 Bacteria 2058
288 Ga0466964_0022528 3300044706 Bacteria 2445
289 Ga0466968_0024133 3300044735 Bacteria 2483
290 Ga0466970_0004138 3300044765 Bacteria 7132
291 Ga0466970_0006903 3300044765 Bacteria 5684
292 Ga0466957_0001317 3300044842 Bacteria 12978
293 Ga0466957_0001584 3300044842 Bacteria 11952
294 Ga0466960_0000033 3300044901 Bacteria 46153
295 Ga0466960_0081839 3300044901 Bacteria 1629
296 Ga0466959_0069492 3300045049 Bacteria 2551
297 Ga0451576_0113558 3300045051 Bacteria 2820
298 Ga0466958_0005655 3300045836 Bacteria 6750
299 Ga0466967_0000008 3300045976 Bacteria 127135
300 Ga0466967_0036899 3300045976 Bacteria 4177
301 Ga0495617_008934 3300046452 Bacteria 3446
302 Ga0495627_034414 3300046453 Bacteria 1583
303 Ga0495592_0012929 3300046454 Bacteria 6346
304 Ga0495592_0137942 3300046454 Bacteria 1699
305 Ga0495603_0004681 3300046455 Bacteria 8173
306 Ga0495603_0006825 3300046455 Bacteria 6847
307 Ga0495603_0047483 3300046455 Bacteria 2556
308 Ga0495629_0001046 3300046459 Bacteria 22155
309 Ga0495629_0044283 3300046459 Bacteria 3123
310 Ga0495629_0090933 3300046459 Bacteria 2129
311 Ga0495629_0109659 3300046459 Bacteria 1924
312 Ga0495638_0121436 3300046460 Bacteria 1543
313 Ga0495653_0032856 3300046463 Bacteria 4116
314 Ga0495650_0000398 3300046471 Bacteria 72672
315 Ga0495580_0062764 3300046472 Bacteria 2606
316 Ga0495582_0000159 3300046473 Bacteria 36459
317 Ga0495605_0022625 3300046474 Bacteria 3316
318 Ga0495662_0003818 3300046476 Bacteria 7595
319 Ga0495662_0021537 3300046476 Bacteria 3114
320 Ga0495662_0052918 3300046476 Bacteria 1961
321 Ga0495594_0011901 3300046499 Bacteria 4526
322 Ga0495594_0043213 3300046499 Bacteria 2469
323 Ga0495596_0008034 3300046500 Bacteria 4715
324 Ga0495607_0029476 3300046501 Bacteria 3377
325 Ga0495606_0005398 3300046507 Bacteria 12254
326 Ga0495608_0000001 3300046511 Bacteria 411278
327 Ga0495608_0023731 3300046511 Bacteria 4200
328 Ga0495610_0062417 3300046512 Bacteria 1767
329 Ga0495616_0005334 3300046513 Bacteria 7928
330 Ga0495618_0037235 3300046514 Bacteria 3054
331 Ga0495628_0000858 3300046516 Bacteria 28086
332 Ga0495628_0098249 3300046516 Bacteria 2261
333 Ga0495628_0193393 3300046516 Bacteria 1535
334 Ga0495630_0007228 3300046517 Bacteria 7922
335 Ga0495631_0003400 3300046518 Bacteria 8716
336 Ga0495632_0079597 3300046519 Bacteria 1564
337 Ga0495637_0052442 3300046520 Bacteria 1703
338 Ga0495637_0066936 3300046520 Bacteria 1459
339 Ga0495643_0001191 3300046522 Bacteria 25336
340 Ga0495666_0008192 3300046526 Bacteria 5237
341 Ga0495652_0007389 3300046529 Bacteria 10129
342 Ga0495652_0075499 3300046529 Bacteria 2799
343 Ga0495640_0016024 3300046533 Bacteria 5620
344 Ga0495640_0131522 3300046533 Bacteria 1619
345 Ga0495587_0013882 3300046536 Bacteria 5057
346 Ga0495609_0040017 3300046538 Bacteria 2110
347 Ga0495609_0044593 3300046538 Bacteria 1988
348 Ga0495645_0118103 3300046543 Bacteria 1870
349 Ga0495645_0127583 3300046543 Bacteria 1786
350 Ga0495622_0000521 3300046557 Bacteria 23348
351 Ga0495622_0008154 3300046557 Bacteria 4853
352 Ga0495633_0007953 3300046558 Bacteria 6041
353 Ga0495633_0034957 3300046558 Bacteria 2415
354 Ga0495668_0000182 3300046616 Bacteria 93763
355 Ga0495634_0001996 3300046642 Bacteria 17374
356 Ga0495634_0011594 3300046642 Bacteria 6412
357 Ga0495611_0036800 3300046648 Bacteria 2173
358 Ga0495611_0077027 3300046648 Bacteria 1529
359 Ga0495625_0000464 3300046660 Bacteria 60878
360 Ga0495625_0026014 3300046660 Bacteria 4426
361 Ga0495659_0034936 3300046664 Bacteria 1770
362 Ga0495588_0000179 3300046674 Bacteria 77030
363 Ga0495588_0006065 3300046674 Bacteria 5423
364 Ga0495657_0000002 3300046675 Bacteria 411958
365 Ga0495657_0077732 3300046675 Bacteria 2152
366 Ga0495657_0090009 3300046675 Bacteria 1970
367 Ga0495623_0086170 3300046679 Bacteria 1936
368 Ga0495658_0000190 3300046683 Bacteria 35518
369 Ga0495613_0000242 3300046689 Bacteria 51661
370 Ga0495613_0017363 3300046689 Bacteria 5362
371 Ga0495613_0094258 3300046689 Bacteria 2166
372 Ga0495624_0001522 3300046690 Bacteria 17958
373 Ga0495624_0027902 3300046690 Bacteria 3691
374 Ga0495670_0052499 3300046691 Bacteria 2041
375 Ga0495589_0008202 3300046794 Bacteria 5461
376 Ga0495589_0016235 3300046794 Bacteria 3826
377 Ga0495581_0013192 3300047315 Bacteria 4792
378 Ga0495604_0000513 3300047317 Bacteria 34041
379 Ga0495604_0001522 3300047317 Bacteria 19077
380 Ga0495604_0005945 3300047317 Bacteria 9682
381 Ga0495604_0024466 3300047317 Bacteria 4818
382 Ga0495636_0004033 3300047318 Bacteria 5744
383 Ga0495636_0006112 3300047318 Bacteria 4730
384 Ga0495674_0000007 3300047319 Bacteria 336257
385 Ga0495674_0164277 3300047319 Bacteria 1856
386 Ga0495672_0043031 3300047320 Bacteria 2718
387 Ga0495676_0030482 3300047321 Bacteria 4576
388 Ga0495676_0036997 3300047321 Bacteria 4068
389 Ga0495676_0067798 3300047321 Bacteria 2759
390 Ga0495680_0043182 3300047322 Bacteria 3571
391 Ga0495680_0087218 3300047322 Bacteria 2348
392 Ga0495680_0114163 3300047322 Bacteria 1999
393 Ga0495680_0186733 3300047322 Bacteria 1493
394 Ga0495683_0035402 3300047323 Bacteria 2537
395 Ga0495683_0054700 3300047323 Bacteria 1988
396 Ga0495675_0000162 3300047444 Bacteria 47605
397 Ga0495675_0011550 3300047444 Bacteria 5544
398 Ga0495685_006311 3300047447 Bacteria 3874
399 Ga0495685_007714 3300047447 Bacteria 3559
400 Ga0495685_041360 3300047447 Bacteria 1575
401 Ga0495681_0001153 3300047470 Bacteria 20012
402 Ga0495684_0068281 3300047471 Bacteria 2703
403 Ga0495686_0032104 3300047472 Bacteria 3401
404 Ga0495602_0000010 3300048088 Bacteria 212121
405 Ga0495602_0000188 3300048088 Bacteria 58305
406 Ga0495614_0043536 3300048089 Bacteria 1925
407 Ga0495614_0050741 3300048089 Bacteria 1777
408 Ga0495626_0000286 3300048091 Bacteria 54819
409 Ga0496101_0006280 3300048904 Bacteria 7650
410 Ga0496102_0139047 3300048905 Bacteria 2276
411 Ga0496103_0151794 3300048906 Bacteria 1484
412 Ga0496104_0020972 3300048907 Bacteria 5995
413 Ga0496105_0027534 3300048908 Bacteria 4645
414 Ga0496106_0022722 3300048909 Bacteria 4661
415 Ga0496106_0055028 3300048909 Bacteria 3007
416 Ga0496107_0008800 3300048910 Bacteria 6994
417 Ga0496107_0055918 3300048910 Bacteria 2850
418 Ga0496108_0002372 3300048911 Bacteria 15085
419 Ga0496108_0007744 3300048911 Bacteria 8701
420 Ga0496108_0009918 3300048911 Bacteria 7722
421 Ga0496108_0048312 3300048911 Bacteria 3558
422 Ga0496109_0000035 3300048912 Bacteria 159744
423 Ga0496109_0007413 3300048912 Bacteria 9284
424 Ga0496109_0200231 3300048912 Bacteria 1877
425 Ga0496110_0000112 3300048913 Bacteria 44496
426 Ga0496110_0000476 3300048913 Bacteria 27211
427 Ga0496111_0000091 3300048914 Bacteria 38326
428 Ga0496112_0000002 3300048915 Bacteria 782039
429 Ga0496112_0001898 3300048915 Bacteria 16486
430 Ga0496113_0000093 3300048916 Bacteria 38914
431 Ga0496113_0126772 3300048916 Bacteria 2000
432 Ga0496114_0022858 3300048917 Bacteria 5096
433 Ga0496115_0225221 3300048918 Bacteria 1547
434 Ga0496119_0005514 3300048922 Bacteria 12076
435 Ga0496121_0031897 3300048924 Bacteria 4803
436 Ga0496124_0017478 3300048927 Bacteria 6757
437 Ga0496125_0033667 3300048928 Bacteria 4530
438 Ga0496126_0028027 3300048929 Bacteria 5371
439 Ga0496126_0064007 3300048929 Bacteria 3295
440 Ga0501031_0030822 3300049568 Bacteria 3498
441 Ga0501031_0091605 3300049568 Bacteria 1983
442 Ga0501033_0000872 3300049570 Bacteria 27578
443 Ga0501033_0001082 3300049570 Bacteria 24644
444 Ga0501033_0053120 3300049570 Bacteria 3001
445 Ga0501034_0001218 3300049571 Bacteria 35189
446 Ga0501034_0015605 3300049571 Bacteria 7802
447 Ga0501034_0021166 3300049571 Bacteria 6634
448 Ga0501036_0000189 3300049572 Bacteria 40908
449 Ga0501036_0034077 3300049572 Bacteria 4306
450 Ga0501036_0096253 3300049572 Bacteria 2502
451 Ga0501036_0152469 3300049572 Bacteria 1949
452 Ga0501037_0058366 3300049573 Bacteria 2816
453 Ga0501038_0009078 3300049574 Bacteria 9127
454 Ga0501038_0032427 3300049574 Bacteria 4609
455 Ga0501039_0017828 3300049575 Bacteria 5447
456 Ga0501039_0093354 3300049575 Bacteria 2345
457 Ga0501040_0026377 3300049576 Bacteria 3907
458 Ga0501041_0007141 3300049577 Bacteria 6551
459 Ga0501041_0052484 3300049577 Bacteria 2486
460 Ga0501042_0052569 3300049578 Bacteria 2905
461 Ga0501042_0280410 3300049578 Bacteria 1203
462 Ga0501043_0000373 3300049579 Bacteria 40611
463 Ga0501043_0070296 3300049579 Bacteria 2749
464 Ga0501046_0015570 3300049580 Bacteria 6387
465 Ga0501047_0073476 3300049581 Bacteria 3292
466 Ga0501048_0053658 3300049582 Bacteria 2865
467 Ga0501067_0007041 3300049583 Bacteria 6246
468 Ga0501068_0005826 3300049584 Bacteria 6759
469 Ga0501068_0007172 3300049584 Bacteria 6173
470 Ga0501069_0080787 3300049585 Bacteria 1831
471 Ga0501070_0001778 3300049586 Bacteria 19038
472 Ga0501070_0142896 3300049586 Bacteria 1976
473 Ga0501070_0188183 3300049586 Bacteria 1697
474 Ga0501071_0037939 3300049587 Bacteria 3442
475 Ga0501071_0058859 3300049587 Bacteria 2778
476 Ga0501072_0017741 3300049588 Bacteria 5473
477 Ga0501072_0035706 3300049588 Bacteria 3895
478 Ga0501073_0169414 3300049589 Bacteria 1512
479 Ga0501074_0003673 3300049590 Bacteria 10885
480 Ga0501074_0011092 3300049590 Bacteria 6544
481 Ga0501075_0017240 3300049591 Bacteria 5215
482 Ga0501076_0005958 3300049592 Bacteria 8802
483 Ga0501077_0029326 3300049593 Bacteria 3498
484 Ga0501077_0089624 3300049593 Bacteria 1949
485 Ga0501079_0038721 3300049741 Bacteria 3676
486 Ga0501080_0011233 3300049742 Bacteria 8197
487 Ga0501080_0092891 3300049742 Bacteria 2802
488 Ga0501081_0020139 3300049743 Bacteria 4446
489 Ga0501081_0062705 3300049743 Bacteria 2579
490 Ga0501035_0000934 3300049822 Bacteria 30908
491 Ga0501035_0059807 3300049822 Bacteria 3393
492 Ga0501035_0219653 3300049822 Bacteria 1623
493 Ga0501044_0000883 3300049823 Bacteria 36150
494 Ga0501044_0043467 3300049823 Bacteria 4667
495 Ga0501045_0009418 3300049824 Bacteria 6831
496 nmdc:mga03n38_6903_c1 3300050490 Bacteria 3984
497 nmdc:mga06z11_21149_c1 3300050494 Bacteria 3019
498 nmdc:mga04h51_4600_c1 3300050495 Bacteria 3449
499 nmdc:mga05p37_326192_c1 3300050507 Bacteria 1815
500 nmdc:mga05p37_39682_c1 3300050507 Bacteria 5780
501 nmdc:mga09592_2418_c1 3300050508 Bacteria 15066
502 nmdc:mga0qj67_9140_c1 3300050509 Bacteria 7356
503 nmdc:mga06r32_290204_c1 3300050510 Bacteria 1622
504 nmdc:mga08y16_155285_c1 3300050511 Bacteria 2378
505 nmdc:mga08y16_255674_c1 3300050511 Bacteria 1810
506 nmdc:mga08y16_27106_c1 3300050511 Bacteria 6039
507 nmdc:mga08y16_59391_c1 3300050511 Bacteria 3994
508 nmdc:mga0n895_162040_c1 3300050512 Bacteria 2268
509 nmdc:mga0a205_123911_c1 3300050515 Bacteria 2484
510 Ga0495601_0000012 3300053077 Bacteria 227853
511 Ga0495601_0061537 3300053077 Bacteria 2383
512 Ga0495612_0027371 3300053078 Bacteria 2292
513 Ga0495655_0000406 3300053083 Bacteria 7323
514 Ga0495655_0002744 3300053083 Bacteria 2829
515 Ga0495595_0000001 3300053084 Bacteria 495226
516 Ga0495595_0013415 3300053084 Bacteria 3462
517 Ga0495619_0000018 3300053085 Bacteria 209943
518 Ga0495619_0000372 3300053085 Bacteria 30832
519 Ga0495619_0000509 3300053085 Bacteria 25913
520 Ga0495619_0062461 3300053085 Bacteria 2480
521 Ga0500644_0021429 3300053088 Bacteria 1936
522 Ga0500583_0091442 3300053092 Bacteria 1481
523 Ga0500560_001057 3300053107 Bacteria 4471
524 Ga0500595_014819 3300053119 Bacteria 2947
525 Ga0500577_0042237 3300053142 Bacteria 1668
526 Ga0500600_0064233 3300053149 Bacteria 2035
527 Ga0500616_0002119 3300053153 Bacteria 17229
528 Ga0501084_0016506 3300054114 Bacteria 6132
529 Ga0501084_0127358 3300054114 Bacteria 2143
530 Ga0501082_0005404 3300060353 Bacteria 11083
531 Ga0466962_0001787 3300061719 Bacteria 10113
532 Ga0530510_0006564 3300061734 Bacteria 8106

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0000521 Ga0495622_0000521_20033_21148 338
2 3300009147 Ga0114129_10678441 Ga0114129_106784411 342
3 3300046689 Ga0495613_0000242 Ga0495613_0000242_47777_48943 343
4 3300053077 Ga0495601_0000012 Ga0495601_0000012_200611_201774 343
5 3300010375 Ga0105239_10042952 Ga0105239_100429522 344
6 3300047317 Ga0495604_0005945 Ga0495604_0005945_1537_2697 348
7 3300048088 Ga0495602_0000010 Ga0495602_0000010_199255_200415 348
8 3300053084 Ga0495595_0013415 Ga0495595_0013415_629_1789 348
9 3300053085 Ga0495619_0000372 Ga0495619_0000372_10057_11220 348
10 3300005343 Ga0070687_100052471 Ga0070687_1000524712 349
11 3300020069 Ga0197907_10354677 Ga0197907_103546772 349
12 3300022467 Ga0224712_10003493 Ga0224712_100034932 349
13 3300026041 Ga0207639_10277165 Ga0207639_102771652 349
14 3300026075 Ga0207708_10018003 Ga0207708_100180035 349
15 3300046642 Ga0495634_0001996 Ga0495634_0001996_16144_17295 349
16 3300047317 Ga0495604_0001522 Ga0495604_0001522_5587_6753 349
17 3300047322 Ga0495680_0087218 Ga0495680_0087218_970_2124 349
18 3300014326 Ga0157380_10114791 Ga0157380_101147911 350
19 3300046517 Ga0495630_0007228 Ga0495630_0007228_4044_5201 350
20 3300047471 Ga0495684_0068281 Ga0495684_0068281_835_1992 350
21 3300005329 Ga0070683_100013435 Ga0070683_1000134353 351
22 3300020070 Ga0206356_11472949 Ga0206356_114729492 351
23 3300005329 Ga0070683_100000481 Ga0070683_1000004816 352
24 3300005535 Ga0070684_100010251 Ga0070684_1000102515 352
25 3300025915 Ga0207693_10000859 Ga0207693_1000085919 352
26 3300025944 Ga0207661_10000166 Ga0207661_100001666 352
27 3300046463 Ga0495653_0032856 Ga0495653_0032856_1648_2763 352
28 3300046516 Ga0495628_0000858 Ga0495628_0000858_17186_18343 352
29 3300048088 Ga0495602_0000188 Ga0495602_0000188_41458_42615 352
30 3300049589 Ga0501073_0169414 Ga0501073_0169414_46_1152 352
31 3300049742 Ga0501080_0092891 Ga0501080_0092891_438_1544 352
32 3300053077 Ga0495601_0061537 Ga0495601_0061537_1126_2349 352
33 3300046529 Ga0495652_0007389 Ga0495652_0007389_7757_8887 353
34 3300046536 Ga0495587_0013882 Ga0495587_0013882_1368_2522 353
35 3300046543 Ga0495645_0127583 Ga0495645_0127583_559_1689 353
36 3300048915 Ga0496112_0000002 Ga0496112_0000002_473134_474294 353
37 3300048915 Ga0496112_0001898 Ga0496112_0001898_9711_10880 353
38 3300048916 Ga0496113_0000093 Ga0496113_0000093_9644_10813 353
39 3300035398 Ga0316574_0009190 Ga0316574_0009190_2421_3653 354
40 3300047319 Ga0495674_0000007 Ga0495674_0000007_155909_157066 354
41 3300005337 Ga0070682_100000815 Ga0070682_10000081520 355
42 3300005841 Ga0068863_100015526 Ga0068863_1000155263 355
43 3300025972 Ga0207668_10130247 Ga0207668_101302472 355
44 3300044842 Ga0466957_0001584 Ga0466957_0001584_720_1880 355
45 3300048906 Ga0496103_0151794 Ga0496103_0151794_61_1215 355
46 3300048911 Ga0496108_0007744 Ga0496108_0007744_2682_3845 355
47 3300048912 Ga0496109_0000035 Ga0496109_0000035_112493_113656 355
48 3300049572 Ga0501036_0152469 Ga0501036_0152469_187_1305 355
49 3300049575 Ga0501039_0093354 Ga0501039_0093354_1155_2273 355
50 3300049577 Ga0501041_0052484 Ga0501041_0052484_584_1702 355
51 3300049578 Ga0501042_0280410 Ga0501042_0280410_21_1139 355
52 3300049587 Ga0501071_0037939 Ga0501071_0037939_621_1739 355
53 3300049588 Ga0501072_0035706 Ga0501072_0035706_625_1743 355
54 3300049593 Ga0501077_0089624 Ga0501077_0089624_634_1752 355
55 3300049743 Ga0501081_0062705 Ga0501081_0062705_851_1969 355
56 3300049822 Ga0501035_0219653 Ga0501035_0219653_170_1288 355
57 3300054114 Ga0501084_0127358 Ga0501084_0127358_50_1168 355
58 3300005466 Ga0070685_10033933 Ga0070685_100339332 356
59 3300005614 Ga0068856_100000057 Ga0068856_10000005770 356
60 3300005981 Ga0081538_10006851 Ga0081538_100068514 356
61 3300026078 Ga0207702_10000027 Ga0207702_1000002777 356
62 3300005436 Ga0070713_100000076 Ga0070713_10000007648 357
63 3300005438 Ga0070701_10051624 Ga0070701_100516242 357
64 3300009148 Ga0105243_10110533 Ga0105243_101105332 357
65 3300009174 Ga0105241_10106509 Ga0105241_101065092 357
66 3300009553 Ga0105249_10000841 Ga0105249_1000084131 357
67 3300013297 Ga0157378_10012517 Ga0157378_100125174 357
68 3300013307 Ga0157372_10000616 Ga0157372_1000061629 357
69 3300014325 Ga0163163_10241602 Ga0163163_102416022 357
70 3300014968 Ga0157379_10054784 Ga0157379_100547843 357
71 3300020078 Ga0206352_11234775 Ga0206352_112347752 357
72 3300025907 Ga0207645_10037301 Ga0207645_100373013 357
73 3300025911 Ga0207654_10075598 Ga0207654_100755981 357
74 3300025928 Ga0207700_10000009 Ga0207700_10000009231 357
75 3300026067 Ga0207678_10044529 Ga0207678_100445293 357
76 3300026118 Ga0207675_100152168 Ga0207675_1001521682 357
77 3300046473 Ga0495582_0000159 Ga0495582_0000159_5498_6652 357
78 3300046674 Ga0495588_0000179 Ga0495588_0000179_13717_14880 357
79 3300046683 Ga0495658_0000190 Ga0495658_0000190_1866_3020 357
80 3300047322 Ga0495680_0114163 Ga0495680_0114163_732_1898 357
81 3300005329 Ga0070683_100000288 Ga0070683_1000002886 358
82 3300005331 Ga0070670_100013950 Ga0070670_1000139504 358
83 3300005344 Ga0070661_100107774 Ga0070661_1001077742 358
84 3300005466 Ga0070685_10065160 Ga0070685_100651601 358
85 3300005564 Ga0070664_100161454 Ga0070664_1001614542 358
86 3300025944 Ga0207661_10001864 Ga0207661_100018646 358
87 3300025945 Ga0207679_10131459 Ga0207679_101314592 358
88 3300026116 Ga0207674_10013677 Ga0207674_100136777 358
89 3300044694 Ga0466963_0092748 Ga0466963_0092748_885_2045 358
90 3300045051 Ga0451576_0113558 Ga0451576_0113558_790_1971 358
91 3300046511 Ga0495608_0000001 Ga0495608_0000001_248897_250081 358
92 3300046675 Ga0495657_0000002 Ga0495657_0000002_249577_250761 358
93 3300047444 Ga0495675_0000162 Ga0495675_0000162_6275_7459 358
94 3300053084 Ga0495595_0000001 Ga0495595_0000001_161198_162382 358
95 3300053085 Ga0495619_0000509 Ga0495619_0000509_6271_7455 358
96 3300005341 Ga0070691_10037210 Ga0070691_100372102 359
97 3300005981 Ga0081538_10051026 Ga0081538_100510263 359
98 3300046543 Ga0495645_0118103 Ga0495645_0118103_64_1215 359
99 3300050511 nmdc:mga08y16_155285_c1 nmdc:mga08y16_155285_c1_92_1327 359
100 3300004798 Ga0058859_11190849 Ga0058859_111908492 360
101 3300005439 Ga0070711_100138059 Ga0070711_1001380592 360
102 3300005578 Ga0068854_100000115 Ga0068854_10000011560 360
103 3300009098 Ga0105245_10062351 Ga0105245_100623512 360
104 3300025981 Ga0207640_10000059 Ga0207640_1000005930 360
105 3300026075 Ga0207708_10005542 Ga0207708_100055425 360
106 3300047322 Ga0495680_0186733 Ga0495680_0186733_321_1481 360
107 3300053085 Ga0495619_0000018 Ga0495619_0000018_136283_137455 360
108 3300005329 Ga0070683_100005284 Ga0070683_1000052842 361
109 3300005441 Ga0070700_100000859 Ga0070700_1000008595 361
110 3300005535 Ga0070684_100001695 Ga0070684_1000016954 361
111 3300005564 Ga0070664_100041141 Ga0070664_1000411414 361
112 3300005577 Ga0068857_100004457 Ga0068857_1000044576 361
113 3300005615 Ga0070702_100024072 Ga0070702_1000240725 361
114 3300009094 Ga0111539_10036359 Ga0111539_100363596 361
115 3300009094 Ga0111539_10276033 Ga0111539_102760332 361
116 3300009147 Ga0114129_10179735 Ga0114129_101797352 361
117 3300009176 Ga0105242_10046981 Ga0105242_100469812 361
118 3300010375 Ga0105239_10037606 Ga0105239_100376066 361
119 3300013307 Ga0157372_10199044 Ga0157372_101990442 361
120 3300014968 Ga0157379_10240557 Ga0157379_102405572 361
121 3300025927 Ga0207687_10008276 Ga0207687_100082763 361
122 3300025933 Ga0207706_10193079 Ga0207706_101930792 361
123 3300025938 Ga0207704_10027421 Ga0207704_100274215 361
124 3300025945 Ga0207679_10033855 Ga0207679_100338552 361
125 3300025961 Ga0207712_10219167 Ga0207712_102191672 361
126 3300026116 Ga0207674_10006396 Ga0207674_1000639611 361
127 3300046690 Ga0495624_0001522 Ga0495624_0001522_5928_7094 361
128 3300047472 Ga0495686_0032104 Ga0495686_0032104_45_1199 361
129 3300050507 nmdc:mga05p37_326192_c1 nmdc:mga05p37_326192_c1_291_1517 361
130 3300050511 nmdc:mga08y16_59391_c1 nmdc:mga08y16_59391_c1_2737_3963 361
131 3300053078 Ga0495612_0027371 Ga0495612_0027371_773_1924 361
132 3300005614 Ga0068856_100031605 Ga0068856_1000316054 362
133 3300013102 Ga0157371_10023682 Ga0157371_100236823 362
134 3300025901 Ga0207688_10045246 Ga0207688_100452462 362
135 3300026078 Ga0207702_10004385 Ga0207702_100043854 362
136 3300046520 Ga0495637_0066936 Ga0495637_0066936_95_1276 362
137 3300048913 Ga0496110_0000476 Ga0496110_0000476_4773_5945 362
138 3300049568 Ga0501031_0030822 Ga0501031_0030822_1109_2242 362
139 3300049570 Ga0501033_0053120 Ga0501033_0053120_678_1811 362
140 3300049572 Ga0501036_0096253 Ga0501036_0096253_874_2007 362
141 3300049573 Ga0501037_0058366 Ga0501037_0058366_1294_2427 362
142 3300049574 Ga0501038_0032427 Ga0501038_0032427_432_1565 362
143 3300049576 Ga0501040_0026377 Ga0501040_0026377_1555_2688 362
144 3300049577 Ga0501041_0007141 Ga0501041_0007141_5263_6396 362
145 3300049578 Ga0501042_0052569 Ga0501042_0052569_793_1926 362
146 3300049580 Ga0501046_0015570 Ga0501046_0015570_644_1777 362
147 3300049582 Ga0501048_0053658 Ga0501048_0053658_1190_2323 362
148 3300049584 Ga0501068_0007172 Ga0501068_0007172_3645_4778 362
149 3300049585 Ga0501069_0080787 Ga0501069_0080787_300_1433 362
150 3300049587 Ga0501071_0058859 Ga0501071_0058859_666_1799 362
151 3300049588 Ga0501072_0017741 Ga0501072_0017741_216_1349 362
152 3300049590 Ga0501074_0011092 Ga0501074_0011092_4197_5330 362
153 3300049591 Ga0501075_0017240 Ga0501075_0017240_116_1249 362
154 3300049592 Ga0501076_0005958 Ga0501076_0005958_6342_7475 362
155 3300049593 Ga0501077_0029326 Ga0501077_0029326_1109_2242 362
156 3300049741 Ga0501079_0038721 Ga0501079_0038721_381_1514 362
157 3300049742 Ga0501080_0011233 Ga0501080_0011233_4171_5304 362
158 3300049743 Ga0501081_0020139 Ga0501081_0020139_1823_2956 362
159 3300049822 Ga0501035_0059807 Ga0501035_0059807_17_1150 362
160 3300049823 Ga0501044_0043467 Ga0501044_0043467_3161_4294 362
161 3300049824 Ga0501045_0009418 Ga0501045_0009418_1088_2221 362
162 3300053085 Ga0495619_0062461 Ga0495619_0062461_510_1661 362
163 3300054114 Ga0501084_0016506 Ga0501084_0016506_611_1744 362
164 3300060353 Ga0501082_0005404 Ga0501082_0005404_1965_3098 362
165 3300061734 Ga0530510_0006564 Ga0530510_0006564_3586_4719 362
166 3300005347 Ga0070668_100002947 Ga0070668_1000029476 363
167 3300005367 Ga0070667_100002992 Ga0070667_1000029924 363
168 3300005548 Ga0070665_100054350 Ga0070665_1000543502 363
169 3300005844 Ga0068862_100000391 Ga0068862_10000039114 363
170 3300009553 Ga0105249_10073501 Ga0105249_100735012 363
171 3300013105 Ga0157369_10361792 Ga0157369_103617922 363
172 3300014326 Ga0157380_10000024 Ga0157380_1000002413 363
173 3300020080 Ga0206350_11301258 Ga0206350_113012582 363
174 3300025931 Ga0207644_10071585 Ga0207644_100715851 363
175 3300025933 Ga0207706_10073832 Ga0207706_100738323 363
176 3300025961 Ga0207712_10008190 Ga0207712_100081902 363
177 3300025972 Ga0207668_10002710 Ga0207668_100027105 363
178 3300025986 Ga0207658_10001012 Ga0207658_100010124 363
179 3300028379 Ga0268266_10032922 Ga0268266_100329223 363
180 3300028380 Ga0268265_10000440 Ga0268265_1000044033 363
181 3300046459 Ga0495629_0001046 Ga0495629_0001046_16290_17456 363
182 3300025942 Ga0207689_10086973 Ga0207689_100869732 364
183 3300048908 Ga0496105_0027534 Ga0496105_0027534_2902_4062 364
184 3300048922 Ga0496119_0005514 Ga0496119_0005514_6204_7364 364
185 3300048924 Ga0496121_0031897 Ga0496121_0031897_938_2098 364
186 3300048928 Ga0496125_0033667 Ga0496125_0033667_1982_3142 364
187 3300005329 Ga0070683_100041185 Ga0070683_1000411852 365
188 3300020077 Ga0206351_10029283 Ga0206351_100292832 365
189 3300020610 Ga0154015_1287331 Ga0154015_12873312 365
190 3300026023 Ga0207677_10193462 Ga0207677_101934622 365
191 3300053083 Ga0495655_0000406 Ga0495655_0000406_16_1200 365
192 3300005329 Ga0070683_100036163 Ga0070683_1000361633 366
193 3300005335 Ga0070666_10007530 Ga0070666_100075301 366
194 3300005548 Ga0070665_100007269 Ga0070665_1000072692 366
195 3300009101 Ga0105247_10092397 Ga0105247_100923972 366
196 3300028379 Ga0268266_10000664 Ga0268266_100006642 366
197 3300030521 Ga0307511_10065907 Ga0307511_100659072 366
198 3300037471 Ga0395905_0132661 Ga0395905_0132661_345_1478 366
199 3300047317 Ga0495604_0000513 Ga0495604_0000513_23519_24679 366
200 3300048927 Ga0496124_0017478 Ga0496124_0017478_4332_5483 366
201 3300048929 Ga0496126_0064007 Ga0496126_0064007_637_1788 366
202 3300013104 Ga0157370_10032556 Ga0157370_100325563 367
203 3300025927 Ga0207687_10000350 Ga0207687_100003506 367
204 3300048929 Ga0496126_0028027 Ga0496126_0028027_2210_3316 367
205 3300005329 Ga0070683_100029574 Ga0070683_1000295744 368
206 3300005937 Ga0081455_10096845 Ga0081455_100968451 368
207 3300009098 Ga0105245_10002031 Ga0105245_100020317 368
208 3300026023 Ga0207677_10151639 Ga0207677_101516392 368
209 3300048909 Ga0496106_0055028 Ga0496106_0055028_1087_2268 368
210 3300048911 Ga0496108_0002372 Ga0496108_0002372_10939_12120 368
211 3300048912 Ga0496109_0007413 Ga0496109_0007413_5419_6600 368
212 3300048913 Ga0496110_0000112 Ga0496110_0000112_5162_6343 368
213 3300048914 Ga0496111_0000091 Ga0496111_0000091_29230_30411 368
214 3300048916 Ga0496113_0126772 Ga0496113_0126772_193_1374 368
215 3300005339 Ga0070660_100142946 Ga0070660_1001429461 369
216 3300026121 Ga0207683_10037429 Ga0207683_100374292 369
217 3300035121 Ga0373960_0015284 Ga0373960_0015284_299_1480 369
218 3300004801 Ga0058860_12198597 Ga0058860_121985971 370
219 3300005340 Ga0070689_100247790 Ga0070689_1002477902 370
220 3300005345 Ga0070692_10057853 Ga0070692_100578532 370
221 3300006844 Ga0075428_100005004 Ga0075428_1000050043 370
222 3300009094 Ga0111539_10002146 Ga0111539_100021464 370
223 3300025908 Ga0207643_10007579 Ga0207643_100075794 370
224 3300025941 Ga0207711_10105332 Ga0207711_101053322 370
225 3300026116 Ga0207674_10020515 Ga0207674_100205153 370
226 3300027907 Ga0207428_10021489 Ga0207428_100214894 370
227 3300044765 Ga0466970_0006903 Ga0466970_0006903_3274_4524 370
228 3300046648 Ga0495611_0077027 Ga0495611_0077027_20_1204 370
229 3300046664 Ga0495659_0034936 Ga0495659_0034936_196_1377 370
230 3300047447 Ga0495685_006311 Ga0495685_006311_2048_3295 370
231 3300048918 Ga0496115_0225221 Ga0496115_0225221_48_1259 370
232 3300050511 nmdc:mga08y16_27106_c1 nmdc:mga08y16_27106_c1_3495_4676 370
233 3300053083 Ga0495655_0002744 Ga0495655_0002744_169_1350 370
234 3300005328 Ga0070676_10091013 Ga0070676_100910132 371
235 3300005334 Ga0068869_100124369 Ga0068869_1001243692 371
236 3300005344 Ga0070661_100037882 Ga0070661_1000378821 371
237 3300005466 Ga0070685_10130444 Ga0070685_101304442 371
238 3300005543 Ga0070672_100070841 Ga0070672_1000708412 371
239 3300005544 Ga0070686_100032182 Ga0070686_1000321822 371
240 3300005547 Ga0070693_100207352 Ga0070693_1002073521 371
241 3300005617 Ga0068859_100101456 Ga0068859_1001014562 371
242 3300005842 Ga0068858_100123240 Ga0068858_1001232403 371
243 3300005985 Ga0081539_10000294 Ga0081539_1000029446 371
244 3300006058 Ga0075432_10017879 Ga0075432_100178792 371
245 3300006852 Ga0075433_10133747 Ga0075433_101337472 371
246 3300006931 Ga0097620_100101458 Ga0097620_1001014582 371
247 3300009094 Ga0111539_10233854 Ga0111539_102338542 371
248 3300013308 Ga0157375_10129642 Ga0157375_101296422 371
249 3300025940 Ga0207691_10043075 Ga0207691_100430754 371
250 3300025945 Ga0207679_10086996 Ga0207679_100869962 371
251 3300035121 Ga0373960_0005121 Ga0373960_0005121_1432_2562 371
252 3300035691 Ga0373931_0072610 Ga0373931_0072610_57_1187 371
253 3300044658 Ga0466972_0033546 Ga0466972_0033546_518_1765 371
254 3300044684 Ga0466966_0002457 Ga0466966_0002457_6461_7708 371
255 3300044693 Ga0466961_0005711 Ga0466961_0005711_2221_3468 371
256 3300045976 Ga0466967_0036899 Ga0466967_0036899_2113_3240 371
257 3300046500 Ga0495596_0008034 Ga0495596_0008034_3306_4430 371
258 3300050511 nmdc:mga08y16_255674_c1 nmdc:mga08y16_255674_c1_336_1466 371
259 3300050512 nmdc:mga0n895_162040_c1 nmdc:mga0n895_162040_c1_915_2045 371
260 3300050515 nmdc:mga0a205_123911_c1 nmdc:mga0a205_123911_c1_692_1822 371
261 3300053142 Ga0500577_0042237 Ga0500577_0042237_157_1275 371
262 iso_pu_bacteria 3006393351 3006397946 371
263 3300005347 Ga0070668_100007037 Ga0070668_10000703710 372
264 3300005457 Ga0070662_100118357 Ga0070662_1001183572 372
265 3300005577 Ga0068857_100001044 Ga0068857_10000104416 372
266 3300005719 Ga0068861_100159686 Ga0068861_1001596862 372
267 3300006844 Ga0075428_100149052 Ga0075428_1001490522 372
268 3300006844 Ga0075428_100149773 Ga0075428_1001497733 372
269 3300009094 Ga0111539_10001342 Ga0111539_100013429 372
270 3300009094 Ga0111539_10120234 Ga0111539_101202342 372
271 3300009098 Ga0105245_10169192 Ga0105245_101691922 372
272 3300009553 Ga0105249_10018644 Ga0105249_100186443 372
273 3300010375 Ga0105239_10229631 Ga0105239_102296312 372
274 3300011119 Ga0105246_10041556 Ga0105246_100415564 372
275 3300013306 Ga0163162_10036994 Ga0163162_100369944 372
276 3300017792 Ga0163161_10073856 Ga0163161_100738562 372
277 3300025901 Ga0207688_10074080 Ga0207688_100740802 372
278 3300025927 Ga0207687_10141629 Ga0207687_101416292 372
279 3300025933 Ga0207706_10050046 Ga0207706_100500462 372
280 3300026116 Ga0207674_10000156 Ga0207674_1000015612 372
281 3300027907 Ga0207428_10010741 Ga0207428_1001074110 372
282 3300027907 Ga0207428_10204093 Ga0207428_102040932 372
283 3300037466 Ga0395898_0058489 Ga0395898_0058489_1672_2919 372
284 3300045976 Ga0466967_0000008 Ga0466967_0000008_54486_55646 372
285 3300049581 Ga0501047_0073476 Ga0501047_0073476_1977_3224 372
286 3300050507 nmdc:mga05p37_39682_c1 nmdc:mga05p37_39682_c1_4375_5511 372
287 3300050510 nmdc:mga06r32_290204_c1 nmdc:mga06r32_290204_c1_43_1176 372
288 3300003322 rootL2_10071172 rootL2_100711722 373
289 3300006163 Ga0070715_10000003 Ga0070715_1000000322 373
290 3300025905 Ga0207685_10000003 Ga0207685_1000000322 373
291 3300048910 Ga0496107_0055918 Ga0496107_0055918_475_1629 373
292 3300005329 Ga0070683_100062833 Ga0070683_1000628332 374
293 3300005347 Ga0070668_100060950 Ga0070668_1000609502 374
294 3300005456 Ga0070678_100272445 Ga0070678_1002724451 374
295 3300005544 Ga0070686_100105005 Ga0070686_1001050052 374
296 3300009094 Ga0111539_10086978 Ga0111539_100869782 374
297 3300009098 Ga0105245_10055296 Ga0105245_100552964 374
298 3300013308 Ga0157375_10086906 Ga0157375_100869062 374
299 3300014745 Ga0157377_10087637 Ga0157377_100876372 374
300 3300025899 Ga0207642_10012027 Ga0207642_100120273 374
301 3300025937 Ga0207669_10031304 Ga0207669_100313042 374
302 3300025961 Ga0207712_10166793 Ga0207712_101667932 374
303 3300025972 Ga0207668_10043248 Ga0207668_100432482 374
304 3300026089 Ga0207648_10026752 Ga0207648_100267522 374
305 3300028380 Ga0268265_10075616 Ga0268265_100756162 374
306 3300048904 Ga0496101_0006280 Ga0496101_0006280_1373_2599 374
307 3300048905 Ga0496102_0139047 Ga0496102_0139047_414_1640 374
308 3300048907 Ga0496104_0020972 Ga0496104_0020972_4101_5324 374
309 3300048909 Ga0496106_0022722 Ga0496106_0022722_2346_3572 374
310 3300048910 Ga0496107_0008800 Ga0496107_0008800_926_2152 374
311 3300048911 Ga0496108_0009918 Ga0496108_0009918_4806_6029 374
312 3300048917 Ga0496114_0022858 Ga0496114_0022858_1499_2725 374
313 3300031901 Ga0307406_10028815 Ga0307406_100288152 375
314 3300049823 Ga0501044_0000883 Ga0501044_0000883_32093_33220 375
315 3300005435 Ga0070714_100114737 Ga0070714_1001147372 376
316 3300010375 Ga0105239_10051572 Ga0105239_100515722 376
317 3300025929 Ga0207664_10044349 Ga0207664_100443493 376
318 3300031731 Ga0307405_10015809 Ga0307405_100158094 376
319 3300031995 Ga0307409_100011102 Ga0307409_1000111023 376
320 3300032002 Ga0307416_100000623 Ga0307416_10000062311 376
321 3300032126 Ga0307415_100000256 Ga0307415_10000025614 376
322 3300037471 Ga0395905_0070489 Ga0395905_0070489_1579_2766 376
323 3300005549 Ga0070704_100072001 Ga0070704_1000720012 378
324 3300053119 Ga0500595_014819 Ga0500595_014819_934_2109 378
325 iso_pu_bacteria 2954701450 2954709718 378
326 3300005834 Ga0068851_10002118 Ga0068851_100021184 380
327 3300044901 Ga0466960_0081839 Ga0466960_0081839_300_1508 380
328 3300046476 Ga0495662_0003818 Ga0495662_0003818_507_1808 380
329 3300046689 Ga0495613_0017363 Ga0495613_0017363_3844_5091 380
330 3300037312 Ga0395899_0002021 Ga0395899_0002021_13173_14360 381
331 3300037312 Ga0395899_0007160 Ga0395899_0007160_2353_3567 381
332 3300037418 Ga0395900_0007778 Ga0395900_0007778_8887_10101 381
333 3300037418 Ga0395900_0045971 Ga0395900_0045971_3097_4284 381
334 3300037466 Ga0395898_0004136 Ga0395898_0004136_9191_10405 381
335 3300037471 Ga0395905_0018273 Ga0395905_0018273_4366_5580 381
336 3300037471 Ga0395905_0057557 Ga0395905_0057557_969_2156 381
337 3300038443 Ga0395901_0011756 Ga0395901_0011756_5332_6519 381
338 3300038443 Ga0395901_0060217 Ga0395901_0060217_2221_3435 381
339 3300048089 Ga0495614_0050741 Ga0495614_0050741_13_1161 382
340 3300053153 Ga0500616_0002119 Ga0500616_0002119_6692_7900 382
341 3300006847 Ga0075431_100149555 Ga0075431_1001495553 383
342 3300037466 Ga0395898_0129837 Ga0395898_0129837_886_2082 383
343 3300041404 Ga0439436_0013029 Ga0439436_0013029_98_1345 383
344 3300041999 Ga0439433_0000942 Ga0439433_0000942_3896_5143 383
345 3300042007 Ga0439449_0011276 Ga0439449_0011276_1447_2694 383
346 3300042014 Ga0439457_000238 Ga0439457_000238_10572_11819 383
347 3300046476 Ga0495662_0052918 Ga0495662_0052918_681_1928 383
348 3300003203 JGI25406J46586_10001018 JGI25406J46586_100010182 384
349 3300005985 Ga0081539_10000204 Ga0081539_1000020436 384
350 3300031456 Ga0307513_10122676 Ga0307513_101226762 384
351 3300005937 Ga0081455_10017265 Ga0081455_100172652 386
352 3300031548 Ga0307408_100049093 Ga0307408_1000490933 386
353 3300031731 Ga0307405_10002494 Ga0307405_100024944 386
354 3300031901 Ga0307406_10032918 Ga0307406_100329183 386
355 3300031903 Ga0307407_10010899 Ga0307407_100108994 386
356 3300031995 Ga0307409_100014187 Ga0307409_1000141873 386
357 3300032002 Ga0307416_100004246 Ga0307416_1000042467 386
358 3300032005 Ga0307411_10004616 Ga0307411_100046164 386
359 3300032126 Ga0307415_100002785 Ga0307415_1000027854 386
360 3300037471 Ga0395905_0281452 Ga0395905_0281452_80_1267 386
361 3300049583 Ga0501067_0007041 Ga0501067_0007041_4321_5502 387
362 3300049584 Ga0501068_0005826 Ga0501068_0005826_2314_3495 387
363 iso_pu_bacteria 2791354901 2791915523 387
364 3300053092 Ga0500583_0091442 Ga0500583_0091442_43_1209 388
365 iso_pu_bacteria 2622736626 2623586726 389
366 iso_pu_bacteria 2929226422 2929227427 389
367 3300031995 Ga0307409_100303677 Ga0307409_1003036772 390
368 3300014497 Ga0182008_10006184 Ga0182008_100061844 394
369 3300015262 Ga0182007_10011226 Ga0182007_100112263 394
370 3300025297 Ga0209758_1004580 Ga0209758_10045808 394
371 3300030522 Ga0307512_10007323 Ga0307512_100073239 394
372 3300033179 Ga0307507_10069397 Ga0307507_100693972 394
373 3300049568 Ga0501031_0091605 Ga0501031_0091605_513_1760 394
374 3300049571 Ga0501034_0015605 Ga0501034_0015605_1199_2446 394
375 3300049571 Ga0501034_0021166 Ga0501034_0021166_1784_3004 394
376 3300049574 Ga0501038_0009078 Ga0501038_0009078_1276_2523 394
377 3300049579 Ga0501043_0070296 Ga0501043_0070296_1038_2285 394
378 3300049572 Ga0501036_0034077 Ga0501036_0034077_85_1332 395
379 3300044658 Ga0466972_0032099 Ga0466972_0032099_323_1570 396
380 3300006846 Ga0075430_100191476 Ga0075430_1001914762 397
381 3300046499 Ga0495594_0011901 Ga0495594_0011901_2605_3834 397
382 3300049570 Ga0501033_0000872 Ga0501033_0000872_22362_23609 398
383 3300006846 Ga0075430_100012865 Ga0075430_1000128655 399
384 3300006847 Ga0075431_100042635 Ga0075431_1000426352 399
385 3300009147 Ga0114129_10038933 Ga0114129_100389332 399
386 3300046471 Ga0495650_0000398 Ga0495650_0000398_21233_22450 399
387 3300050508 nmdc:mga09592_2418_c1 nmdc:mga09592_2418_c1_5281_6516 399
388 3300050509 nmdc:mga0qj67_9140_c1 nmdc:mga0qj67_9140_c1_3556_4791 399
389 iso_pu_bacteria 2675903059 2676480386 399
390 3300044658 Ga0466972_0056308 Ga0466972_0056308_189_1436 401
391 3300044901 Ga0466960_0000033 Ga0466960_0000033_20257_21483 401
392 3300003316 rootH1_10010547 rootH1_100105472 404
393 3300003320 rootH2_10033896 rootH2_100338963 404
394 3300042007 Ga0439449_0001531 Ga0439449_0001531_5103_6350 405
395 3300046616 Ga0495668_0000182 Ga0495668_0000182_66703_67941 406
396 3300046660 Ga0495625_0000464 Ga0495625_0000464_56332_57570 406
397 3300047323 Ga0495683_0054700 Ga0495683_0054700_165_1403 406
398 3300048091 Ga0495626_0000286 Ga0495626_0000286_9435_10673 406
399 3300028786 Ga0307517_10027373 Ga0307517_100273735 407
400 3300028794 Ga0307515_10004249 Ga0307515_100042493 407
401 3300033179 Ga0307507_10038524 Ga0307507_100385244 407
402 3300044735 Ga0466968_0024133 Ga0466968_0024133_419_1666 407
403 3300046459 Ga0495629_0044283 Ga0495629_0044283_650_1897 407
404 3300046660 Ga0495625_0026014 Ga0495625_0026014_811_2058 407
405 3300046674 Ga0495588_0006065 Ga0495588_0006065_2511_3758 407
406 3300047470 Ga0495681_0001153 Ga0495681_0001153_16458_17705 407
407 3300053107 Ga0500560_001057 Ga0500560_001057_670_1917 407
408 3300042006 Ga0439432_045951 Ga0439432_045951_24_1274 408
409 3300042156 Ga0439446_0002277 Ga0439446_0002277_3257_4507 408
410 3300006042 Ga0075368_10009675 Ga0075368_100096752 410
411 3300006178 Ga0075367_10061654 Ga0075367_100616542 410
412 3300027866 Ga0209813_10004237 Ga0209813_100042372 410
413 3300044656 Ga0466969_0026698 Ga0466969_0026698_324_1571 410
414 3300044658 Ga0466972_0039606 Ga0466972_0039606_706_1953 410
415 3300044683 Ga0466965_0005551 Ga0466965_0005551_1615_2862 410
416 3300044684 Ga0466966_0002355 Ga0466966_0002355_10568_11815 410
417 3300044693 Ga0466961_0044320 Ga0466961_0044320_822_2069 410
418 3300044694 Ga0466963_0000405 Ga0466963_0000405_12465_13712 410
419 3300044765 Ga0466970_0004138 Ga0466970_0004138_936_2183 410
420 3300044842 Ga0466957_0001317 Ga0466957_0001317_6820_8067 410
421 3300045049 Ga0466959_0069492 Ga0466959_0069492_527_1774 410
422 3300045836 Ga0466958_0005655 Ga0466958_0005655_2984_4231 410
423 3300050494 nmdc:mga06z11_21149_c1 nmdc:mga06z11_21149_c1_491_1738 410
424 3300050495 nmdc:mga04h51_4600_c1 nmdc:mga04h51_4600_c1_251_1498 410
425 3300061719 Ga0466962_0001787 Ga0466962_0001787_1653_2900 410
426 iso_pu_bacteria 2802429296 2804848199 410
427 iso_pu_bacteria 2862382967 2862392411 410
428 iso_pu_bacteria 2912715099 2912717310 410
429 iso_pu_bacteria 8008558824 8008563090 410
430 iso_pu_bacteria 8025413630 8025414238 410
431 iso_pu_bacteria 8048406513 8048409819 410
432 3300031649 Ga0307514_10069054 Ga0307514_100690543 411
433 3300031730 Ga0307516_10096302 Ga0307516_100963021 411
434 3300033180 Ga0307510_10010376 Ga0307510_100103763 411
435 3300049570 Ga0501033_0001082 Ga0501033_0001082_19694_20929 411
436 3300049571 Ga0501034_0001218 Ga0501034_0001218_3844_5079 411
437 3300049572 Ga0501036_0000189 Ga0501036_0000189_21773_23008 411
438 3300049575 Ga0501039_0017828 Ga0501039_0017828_2241_3476 411
439 3300049579 Ga0501043_0000373 Ga0501043_0000373_13260_14495 411
440 3300049586 Ga0501070_0001778 Ga0501070_0001778_3844_5079 411
441 3300049590 Ga0501074_0003673 Ga0501074_0003673_1596_2831 411
442 3300049822 Ga0501035_0000934 Ga0501035_0000934_17901_19136 411
443 iso_pu_bacteria 2547132111 2547410605 411
444 iso_pu_bacteria 2582581313 2585307813 411
445 iso_pu_bacteria 2616644814 2616700076 411
446 iso_pu_bacteria 2643221587 2643943701 411
447 iso_pu_bacteria 2643221647 2644269623 411
448 iso_pu_bacteria 2643221678 2644437737 411
449 iso_pu_bacteria 2643221714 2644629875 411
450 iso_pu_bacteria 2784132148 2784590668 411
451 iso_pu_bacteria 2784746768 2785371838 411
452 iso_pu_bacteria 2786546132 2786672951 411
453 iso_pu_bacteria 2808606359 2808844340 411
454 iso_pu_bacteria 2808606375 2808913918 411
455 iso_pu_bacteria 2808606448 2809234356 411
456 iso_pu_bacteria 2811994879 2812355652 411
457 iso_pu_bacteria 2818991463 2819698918 411
458 iso_pu_bacteria 2852635781 2852639753 411
459 iso_pu_bacteria 2862281513 2862284306 411
460 iso_pu_bacteria 2862290372 2862290786 411
461 iso_pu_bacteria 2862507626 2862514309 411
462 iso_pu_bacteria 2862574272 2862577197 411
463 iso_pu_bacteria 2867428634 2867434240 411
464 iso_pu_bacteria 2875391855 2875397016 411
465 iso_pu_bacteria 2877676314 2877678743 411
466 iso_pu_bacteria 2912723979 2912729877 411
467 iso_pu_bacteria 2912757875 2912763075 411
468 iso_pu_bacteria 2918501144 2918506809 411
469 iso_pu_bacteria 2919468124 2919472526 411
470 iso_pu_bacteria 2946072368 2946078017 411
471 iso_pu_bacteria 2947224130 2947226655 411
472 iso_pu_bacteria 2954002825 2954005826 411
473 iso_pu_bacteria 2954380949 2954383714 411
474 iso_pu_bacteria 2954673503 2954679259 411
475 iso_pu_bacteria 2954682443 2954684895 411
476 iso_pu_bacteria 2954691527 2954694514 411
477 iso_pu_bacteria 2954711539 2954714006 411
478 iso_pu_bacteria 2954721474 2954723975 411
479 iso_pu_bacteria 2954731030 2954737865 411
480 iso_pu_bacteria 2954740390 2954742872 411
481 iso_pu_bacteria 2954749733 2954756717 411
482 iso_pu_bacteria 2954759201 2954761829 411
483 iso_pu_bacteria 2966598605 2966600577 411
484 iso_pu_bacteria 2997451912 2997453139 411
485 iso_pu_bacteria 3006493962 3006500006 411
486 iso_pu_bacteria 8008574985 8008576864 411
487 iso_pu_bacteria 8023623736 8023625684 411
488 iso_pu_bacteria 8025530807 8025532692 411
489 iso_pu_bacteria 8054160619 8054163137 411
490 3300031456 Ga0307513_10027362 Ga0307513_100273625 412
491 iso_pu_bacteria 2997600082 2997604039 412
492 iso_pu_bacteria 8056829672 8056831620 413
493 3300003354 JGI25160J50197_1012981 JGI25160J50197_10129812 414
494 3300025302 Ga0207426_1018696 Ga0207426_10186962 414
495 3300028794 Ga0307515_10081143 Ga0307515_100811433 414
496 3300053149 Ga0500600_0064233 Ga0500600_0064233_149_1393 414
497 3300001989 JGI24739J22299_10016582 JGI24739J22299_100165822 415
498 3300002067 JGI24735J21928_10021419 JGI24735J21928_100214192 415
499 3300002075 JGI24738J21930_10011357 JGI24738J21930_100113571 415
500 3300003316 rootH1_10033378 rootH1_100333782 415
501 3300006948 Ga0099826_10020921 Ga0099826_100209215 415
502 3300009011 Ga0105251_10005290 Ga0105251_100052906 415
503 3300009036 Ga0105244_10088123 Ga0105244_100881231 415
504 3300009148 Ga0105243_10249498 Ga0105243_102494982 415
505 3300011119 Ga0105246_10019404 Ga0105246_100194042 415
506 3300013105 Ga0157369_10048428 Ga0157369_100484282 415
507 3300015688 Ga0183367_1013 Ga0183367_101362 415
508 3300025735 Ga0207713_1016850 Ga0207713_10168502 415
509 3300025904 Ga0207647_10009632 Ga0207647_100096323 415
510 3300027312 Ga0209371_1009618 Ga0209371_10096182 415
511 3300030500 Ga0268256_1008087 Ga0268256_10080873 415
512 3300030521 Ga0307511_10000330 Ga0307511_100003303 415
513 3300031456 Ga0307513_10122524 Ga0307513_101225242 415
514 3300031507 Ga0307509_10070928 Ga0307509_100709282 415
515 3300031616 Ga0307508_10021674 Ga0307508_100216744 415
516 3300031838 Ga0307518_10081976 Ga0307518_100819762 415
517 3300033180 Ga0307510_10052245 Ga0307510_100522453 415
518 3300037418 Ga0395900_0079332 Ga0395900_0079332_348_1595 415
519 3300037466 Ga0395898_0004392 Ga0395898_0004392_9595_10842 415
520 3300042005 Ga0439448_0007983 Ga0439448_0007983_1349_2596 415
521 3300042134 Ga0450898_001885 Ga0450898_001885_1179_2426 415
522 3300042135 Ga0450899_001520 Ga0450899_001520_519_1766 415
523 3300042138 Ga0450903_000229 Ga0450903_000229_3142_4389 415
524 3300042145 Ga0450906_002805 Ga0450906_002805_2206_3453 415
525 3300042157 Ga0439458_0000860 Ga0439458_0000860_3630_4877 415
526 3300042184 Ga0450908_003464 Ga0450908_003464_1522_2769 415
527 3300044706 Ga0466964_0022528 Ga0466964_0022528_402_1649 415
528 3300046452 Ga0495617_008934 Ga0495617_008934_1501_2748 415
529 3300046453 Ga0495627_034414 Ga0495627_034414_170_1417 415
530 3300046454 Ga0495592_0012929 Ga0495592_0012929_4872_6119 415
531 3300046454 Ga0495592_0137942 Ga0495592_0137942_328_1575 415
532 3300046455 Ga0495603_0004681 Ga0495603_0004681_6100_7401 415
533 3300046455 Ga0495603_0006825 Ga0495603_0006825_5179_6480 415
534 3300046455 Ga0495603_0047483 Ga0495603_0047483_83_1330 415
535 3300046459 Ga0495629_0090933 Ga0495629_0090933_694_1941 415
536 3300046459 Ga0495629_0109659 Ga0495629_0109659_348_1595 415
537 3300046460 Ga0495638_0121436 Ga0495638_0121436_68_1315 415
538 3300046472 Ga0495580_0062764 Ga0495580_0062764_56_1303 415
539 3300046474 Ga0495605_0022625 Ga0495605_0022625_1910_3157 415
540 3300046476 Ga0495662_0021537 Ga0495662_0021537_1384_2631 415
541 3300046499 Ga0495594_0043213 Ga0495594_0043213_1140_2387 415
542 3300046501 Ga0495607_0029476 Ga0495607_0029476_1766_3013 415
543 3300046507 Ga0495606_0005398 Ga0495606_0005398_7701_8948 415
544 3300046511 Ga0495608_0023731 Ga0495608_0023731_1097_2344 415
545 3300046512 Ga0495610_0062417 Ga0495610_0062417_132_1379 415
546 3300046513 Ga0495616_0005334 Ga0495616_0005334_225_1472 415
547 3300046514 Ga0495618_0037235 Ga0495618_0037235_1292_2539 415
548 3300046516 Ga0495628_0098249 Ga0495628_0098249_225_1472 415
549 3300046516 Ga0495628_0193393 Ga0495628_0193393_61_1308 415
550 3300046518 Ga0495631_0003400 Ga0495631_0003400_360_1607 415
551 3300046519 Ga0495632_0079597 Ga0495632_0079597_142_1389 415
552 3300046520 Ga0495637_0052442 Ga0495637_0052442_24_1271 415
553 3300046522 Ga0495643_0001191 Ga0495643_0001191_4897_6144 415
554 3300046526 Ga0495666_0008192 Ga0495666_0008192_1083_2330 415
555 3300046529 Ga0495652_0075499 Ga0495652_0075499_139_1386 415
556 3300046533 Ga0495640_0016024 Ga0495640_0016024_2694_3941 415
557 3300046533 Ga0495640_0131522 Ga0495640_0131522_137_1384 415
558 3300046538 Ga0495609_0040017 Ga0495609_0040017_660_1907 415
559 3300046538 Ga0495609_0044593 Ga0495609_0044593_402_1649 415
560 3300046557 Ga0495622_0008154 Ga0495622_0008154_2885_4132 415
561 3300046558 Ga0495633_0007953 Ga0495633_0007953_4083_5330 415
562 3300046558 Ga0495633_0034957 Ga0495633_0034957_19_1266 415
563 3300046642 Ga0495634_0011594 Ga0495634_0011594_969_2216 415
564 3300046648 Ga0495611_0036800 Ga0495611_0036800_116_1363 415
565 3300046675 Ga0495657_0077732 Ga0495657_0077732_678_1925 415
566 3300046675 Ga0495657_0090009 Ga0495657_0090009_108_1355 415
567 3300046679 Ga0495623_0086170 Ga0495623_0086170_216_1463 415
568 3300046689 Ga0495613_0094258 Ga0495613_0094258_28_1275 415
569 3300046690 Ga0495624_0027902 Ga0495624_0027902_1462_2709 415
570 3300046691 Ga0495670_0052499 Ga0495670_0052499_31_1278 415
571 3300046794 Ga0495589_0008202 Ga0495589_0008202_150_1397 415
572 3300046794 Ga0495589_0016235 Ga0495589_0016235_1665_2912 415
573 3300047315 Ga0495581_0013192 Ga0495581_0013192_3130_4377 415
574 3300047317 Ga0495604_0024466 Ga0495604_0024466_1161_2408 415
575 3300047318 Ga0495636_0004033 Ga0495636_0004033_1273_2520 415
576 3300047318 Ga0495636_0006112 Ga0495636_0006112_3395_4642 415
577 3300047319 Ga0495674_0164277 Ga0495674_0164277_492_1739 415
578 3300047320 Ga0495672_0043031 Ga0495672_0043031_499_1746 415
579 3300047321 Ga0495676_0030482 Ga0495676_0030482_385_1632 415
580 3300047321 Ga0495676_0036997 Ga0495676_0036997_2508_3755 415
581 3300047321 Ga0495676_0067798 Ga0495676_0067798_399_1646 415
582 3300047322 Ga0495680_0043182 Ga0495680_0043182_2144_3391 415
583 3300047323 Ga0495683_0035402 Ga0495683_0035402_768_2015 415
584 3300047444 Ga0495675_0011550 Ga0495675_0011550_2342_3589 415
585 3300047447 Ga0495685_007714 Ga0495685_007714_1674_2921 415
586 3300047447 Ga0495685_041360 Ga0495685_041360_266_1513 415
587 3300048089 Ga0495614_0043536 Ga0495614_0043536_200_1447 415
588 3300048911 Ga0496108_0048312 Ga0496108_0048312_45_1292 415
589 3300048912 Ga0496109_0200231 Ga0496109_0200231_361_1608 415
590 3300049586 Ga0501070_0142896 Ga0501070_0142896_587_1834 415
591 3300049586 Ga0501070_0188183 Ga0501070_0188183_70_1317 415
592 3300050490 nmdc:mga03n38_6903_c1 nmdc:mga03n38_6903_c1_2247_3494 415
593 3300053088 Ga0500644_0021429 Ga0500644_0021429_389_1636 415
594 iso_pu_bacteria 2582581314 2585316791 415

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

100

384

0.91

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

89

350

0.82

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

140

391

0.78

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

98

355

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eqb-assembly2.cif.gz_B 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes 0.8969 74 412
4eqb-assembly2.cif.gz_B 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes 0.8814 74 412
2v84-assembly1.cif.gz_A crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum 0.8575 76 415
4gl0-assembly1.cif.gz_A putative spermidine/putrescine abc transporter from listeria monocytogenes 0.8566 74 412
3ttk-assembly3.cif.gz_C crystal structure of apo-spud 0.8542 75 413
ID Description Score Start End Superfamily
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9232 77 378 3.40.190.10
af_Q2G2A8_33_356_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9033 73 414 3.40.190.10
2v84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8978 76 367 3.40.190.10
af_Q2G2A8_33_356_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8955 73 414 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8954 77 378 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7K2ZPR5-F1-model_v4 Extracellular solute-binding protein 0.9733 69 415 GO:0015846
GO:0019808
GO:0042597
AF-A0A1C4NP67-F1-model_v4 deleted 0.9692 237 415
AF-A0A1C4NP67-F1-model_v4 deleted 0.964 237 415
AF-A0A7V8YAI9-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein 0.9639 85 415 GO:0015846
GO:0019808
GO:0042597
AF-A0A7K2ZPR5-F1-model_v4 Extracellular solute-binding protein 0.9623 69 415 GO:0015846
GO:0019808
GO:0042597

Feature Viewer

pLDDT pTM Quality
85.4 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map