F467349
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 594 | 396 | 532 | 385 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10027362|Ga0307513_100273625 |
| Length | 416 |
| Sequence | MRTREHSRLSPEAAAVLSALPPGQARLSGTTRRTVLRGLLAAGAFAATGGALTACGMPGTRQDPAACRAPDESASDKKLAISNWPLYIDVDENDETKRPSVEAFTKQTGIEVTYQEDINDNNEFFGKVRNQLSACQAIDRDIMVLTDWMAARMIRLGWVQPLQKDKLPNVDANLLDSLRGRSWDKNTEYAVPWQTGLSGIAFNGNVTKEVRTVDELLTRPDLKGKVTMLSEMRDTMGLMMLADGADPANFTEEQYDHALTRLQAAVDSGQIRRFTGNDYAQELAKGDIAACVAWSGDVIQLNFEDEKVQFVTPDAGVMLWSDNMQVPNEATHQENAEAFMNYYYEPSVAAELAAWVNYICPVKGAQAEMESIDPELAANPLIFPDQSVLSSAKVFMALNEAEERIYEQKFQQVIGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 3 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 4 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 5 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 6 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 7 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 8 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 9 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 10 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 11 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 12 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 13 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 14 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 15 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 16 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 17 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 18 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 19 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 20 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 21 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 22 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 23 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 24 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 25 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 26 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 27 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 28 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 29 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 30 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 31 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 32 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 33 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 34 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 35 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 36 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 37 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 38 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 39 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 40 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 41 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 42 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 43 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 44 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 45 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 46 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 47 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 48 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 49 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 50 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 51 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 52 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 53 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 54 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 55 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 56 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 57 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 58 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 60 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 61 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 62 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 63 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 64 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 65 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 201 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 222 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 223 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 224 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 228 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 229 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 230 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 231 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 232 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 233 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 234 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 235 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 329 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 380 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 381 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 382 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 383 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 384 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 388 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 389 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 390 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 391 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 392 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 393 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 394 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 395 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 396 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.05 |
| Metatranscriptomes | 1.52 |
| Isolates | 10.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.69 |
| Nodule | 0.67 |
| Rhizoplane | 4.21 |
| Rhizosphere | 84.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10016582 | 3300001989 | Bacteria | 2666 |
| 2 | JGI24735J21928_10021419 | 3300002067 | Bacteria | 1974 |
| 3 | JGI24738J21930_10011357 | 3300002075 | Bacteria | 1960 |
| 4 | JGI25406J46586_10001018 | 3300003203 | Bacteria | 13133 |
| 5 | rootH1_10010547 | 3300003316 | Bacteria | 2607 |
| 6 | rootH1_10033378 | 3300003316 | Bacteria | 2323 |
| 7 | rootH2_10033896 | 3300003320 | Bacteria | 3275 |
| 8 | rootL2_10071172 | 3300003322 | Bacteria | 1910 |
| 9 | JGI25160J50197_1012981 | 3300003354 | Bacteria | 2860 |
| 10 | Ga0058859_11190849 | 3300004798 | Bacteria | 1535 |
| 11 | Ga0058860_12198597 | 3300004801 | Bacteria | 1382 |
| 12 | Ga0070676_10091013 | 3300005328 | Bacteria | 1869 |
| 13 | Ga0070683_100000288 | 3300005329 | Bacteria | 34747 |
| 14 | Ga0070683_100000481 | 3300005329 | Bacteria | 28092 |
| 15 | Ga0070683_100005284 | 3300005329 | Bacteria | 10753 |
| 16 | Ga0070683_100013435 | 3300005329 | Bacteria | 7142 |
| 17 | Ga0070683_100029574 | 3300005329 | Bacteria | 4962 |
| 18 | Ga0070683_100036163 | 3300005329 | Bacteria | 4517 |
| 19 | Ga0070683_100041185 | 3300005329 | Bacteria | 4248 |
| 20 | Ga0070683_100062833 | 3300005329 | Bacteria | 3453 |
| 21 | Ga0070670_100013950 | 3300005331 | Bacteria | 6891 |
| 22 | Ga0068869_100124369 | 3300005334 | Bacteria | 1976 |
| 23 | Ga0070666_10007530 | 3300005335 | Bacteria | 6712 |
| 24 | Ga0070682_100000815 | 3300005337 | Bacteria | 18228 |
| 25 | Ga0070660_100142946 | 3300005339 | Bacteria | 1921 |
| 26 | Ga0070689_100247790 | 3300005340 | Bacteria | 1469 |
| 27 | Ga0070691_10037210 | 3300005341 | Bacteria | 2296 |
| 28 | Ga0070687_100052471 | 3300005343 | Bacteria | 2116 |
| 29 | Ga0070661_100037882 | 3300005344 | Bacteria | 3509 |
| 30 | Ga0070661_100107774 | 3300005344 | Bacteria | 2078 |
| 31 | Ga0070692_10057853 | 3300005345 | Bacteria | 2034 |
| 32 | Ga0070668_100002947 | 3300005347 | Bacteria | 12579 |
| 33 | Ga0070668_100007037 | 3300005347 | Bacteria | 8335 |
| 34 | Ga0070668_100060950 | 3300005347 | Bacteria | 2923 |
| 35 | Ga0070667_100002992 | 3300005367 | Bacteria | 14517 |
| 36 | Ga0070714_100114737 | 3300005435 | Bacteria | 2390 |
| 37 | Ga0070713_100000076 | 3300005436 | Bacteria | 61668 |
| 38 | Ga0070701_10051624 | 3300005438 | Bacteria | 2134 |
| 39 | Ga0070711_100138059 | 3300005439 | Bacteria | 1824 |
| 40 | Ga0070700_100000859 | 3300005441 | Bacteria | 14995 |
| 41 | Ga0070678_100272445 | 3300005456 | Bacteria | 1428 |
| 42 | Ga0070662_100118357 | 3300005457 | Bacteria | 2027 |
| 43 | Ga0070685_10033933 | 3300005466 | Bacteria | 2871 |
| 44 | Ga0070685_10065160 | 3300005466 | Bacteria | 2144 |
| 45 | Ga0070685_10130444 | 3300005466 | Bacteria | 1571 |
| 46 | Ga0070684_100001695 | 3300005535 | Bacteria | 16034 |
| 47 | Ga0070684_100010251 | 3300005535 | Bacteria | 7419 |
| 48 | Ga0070672_100070841 | 3300005543 | Bacteria | 2771 |
| 49 | Ga0070686_100032182 | 3300005544 | Bacteria | 3213 |
| 50 | Ga0070686_100105005 | 3300005544 | Bacteria | 1915 |
| 51 | Ga0070693_100207352 | 3300005547 | Bacteria | 1277 |
| 52 | Ga0070665_100007269 | 3300005548 | Bacteria | 11253 |
| 53 | Ga0070665_100054350 | 3300005548 | Bacteria | 4016 |
| 54 | Ga0070704_100072001 | 3300005549 | Bacteria | 2513 |
| 55 | Ga0070664_100041141 | 3300005564 | Bacteria | 3899 |
| 56 | Ga0070664_100161454 | 3300005564 | Bacteria | 1983 |
| 57 | Ga0068857_100001044 | 3300005577 | Bacteria | 21432 |
| 58 | Ga0068857_100004457 | 3300005577 | Bacteria | 11832 |
| 59 | Ga0068854_100000115 | 3300005578 | Bacteria | 55089 |
| 60 | Ga0068856_100000057 | 3300005614 | Bacteria | 102045 |
| 61 | Ga0068856_100031605 | 3300005614 | Bacteria | 5181 |
| 62 | Ga0070702_100024072 | 3300005615 | Bacteria | 3244 |
| 63 | Ga0068859_100101456 | 3300005617 | Bacteria | 2935 |
| 64 | Ga0068861_100159686 | 3300005719 | Bacteria | 1858 |
| 65 | Ga0068851_10002118 | 3300005834 | Bacteria | 8726 |
| 66 | Ga0068863_100015526 | 3300005841 | Bacteria | 7317 |
| 67 | Ga0068858_100123240 | 3300005842 | Bacteria | 2425 |
| 68 | Ga0068862_100000391 | 3300005844 | Bacteria | 47191 |
| 69 | Ga0081455_10017265 | 3300005937 | Bacteria | 6926 |
| 70 | Ga0081455_10096845 | 3300005937 | Bacteria | 2378 |
| 71 | Ga0081538_10006851 | 3300005981 | Bacteria | 9927 |
| 72 | Ga0081538_10051026 | 3300005981 | Bacteria | 2489 |
| 73 | Ga0081539_10000204 | 3300005985 | Bacteria | 137351 |
| 74 | Ga0081539_10000294 | 3300005985 | Bacteria | 112974 |
| 75 | Ga0075368_10009675 | 3300006042 | Bacteria | 3472 |
| 76 | Ga0075432_10017879 | 3300006058 | Bacteria | 2418 |
| 77 | Ga0070715_10000003 | 3300006163 | Bacteria | 345282 |
| 78 | Ga0075367_10061654 | 3300006178 | Bacteria | 2238 |
| 79 | Ga0075428_100005004 | 3300006844 | Bacteria | 14724 |
| 80 | Ga0075428_100149052 | 3300006844 | Bacteria | 2541 |
| 81 | Ga0075428_100149773 | 3300006844 | Bacteria | 2535 |
| 82 | Ga0075430_100012865 | 3300006846 | Bacteria | 7131 |
| 83 | Ga0075430_100191476 | 3300006846 | Bacteria | 1700 |
| 84 | Ga0075431_100042635 | 3300006847 | Bacteria | 4681 |
| 85 | Ga0075431_100149555 | 3300006847 | Bacteria | 2405 |
| 86 | Ga0075433_10133747 | 3300006852 | Unclassified | 2204 |
| 87 | Ga0097620_100101458 | 3300006931 | Bacteria | 2935 |
| 88 | Ga0099826_10020921 | 3300006948 | Bacteria | 4902 |
| 89 | Ga0105251_10005290 | 3300009011 | Bacteria | 8492 |
| 90 | Ga0105244_10088123 | 3300009036 | Bacteria | 1529 |
| 91 | Ga0111539_10001342 | 3300009094 | Bacteria | 32789 |
| 92 | Ga0111539_10002146 | 3300009094 | Bacteria | 26383 |
| 93 | Ga0111539_10036359 | 3300009094 | Bacteria | 5955 |
| 94 | Ga0111539_10086978 | 3300009094 | Bacteria | 3672 |
| 95 | Ga0111539_10120234 | 3300009094 | Unclassified | 3078 |
| 96 | Ga0111539_10233854 | 3300009094 | Bacteria | 2139 |
| 97 | Ga0111539_10276033 | 3300009094 | Bacteria | 1956 |
| 98 | Ga0105245_10002031 | 3300009098 | Bacteria | 18358 |
| 99 | Ga0105245_10055296 | 3300009098 | Bacteria | 3565 |
| 100 | Ga0105245_10062351 | 3300009098 | Bacteria | 3364 |
| 101 | Ga0105245_10169192 | 3300009098 | Bacteria | 2080 |
| 102 | Ga0105247_10092397 | 3300009101 | Unclassified | 1922 |
| 103 | Ga0114129_10038933 | 3300009147 | Bacteria | 6701 |
| 104 | Ga0114129_10179735 | 3300009147 | Bacteria | 2880 |
| 105 | Ga0114129_10678441 | 3300009147 | Bacteria | 1327 |
| 106 | Ga0105243_10110533 | 3300009148 | Bacteria | 2298 |
| 107 | Ga0105243_10249498 | 3300009148 | Bacteria | 1584 |
| 108 | Ga0105241_10106509 | 3300009174 | Bacteria | 2238 |
| 109 | Ga0105242_10046981 | 3300009176 | Bacteria | 3504 |
| 110 | Ga0105249_10000841 | 3300009553 | Bacteria | 27506 |
| 111 | Ga0105249_10018644 | 3300009553 | Bacteria | 6180 |
| 112 | Ga0105249_10073501 | 3300009553 | Bacteria | 3163 |
| 113 | Ga0105239_10037606 | 3300010375 | Bacteria | 5304 |
| 114 | Ga0105239_10042952 | 3300010375 | Bacteria | 4953 |
| 115 | Ga0105239_10051572 | 3300010375 | Bacteria | 4510 |
| 116 | Ga0105239_10229631 | 3300010375 | Bacteria | 2082 |
| 117 | Ga0105246_10019404 | 3300011119 | Bacteria | 4344 |
| 118 | Ga0105246_10041556 | 3300011119 | Bacteria | 3108 |
| 119 | Ga0157371_10023682 | 3300013102 | Bacteria | 4489 |
| 120 | Ga0157370_10032556 | 3300013104 | Bacteria | 5090 |
| 121 | Ga0157369_10048428 | 3300013105 | Bacteria | 4612 |
| 122 | Ga0157369_10361792 | 3300013105 | Unclassified | 1506 |
| 123 | Ga0157378_10012517 | 3300013297 | Bacteria | 7425 |
| 124 | Ga0163162_10036994 | 3300013306 | Bacteria | 4869 |
| 125 | Ga0157372_10000616 | 3300013307 | Bacteria | 38850 |
| 126 | Ga0157372_10199044 | 3300013307 | Bacteria | 2320 |
| 127 | Ga0157375_10086906 | 3300013308 | Bacteria | 3178 |
| 128 | Ga0157375_10129642 | 3300013308 | Bacteria | 2640 |
| 129 | Ga0163163_10241602 | 3300014325 | Bacteria | 1856 |
| 130 | Ga0157380_10000024 | 3300014326 | Bacteria | 110947 |
| 131 | Ga0157380_10114791 | 3300014326 | Bacteria | 2270 |
| 132 | Ga0182008_10006184 | 3300014497 | Bacteria | 6727 |
| 133 | Ga0157377_10087637 | 3300014745 | Bacteria | 1832 |
| 134 | Ga0157379_10054784 | 3300014968 | Bacteria | 3563 |
| 135 | Ga0157379_10240557 | 3300014968 | Bacteria | 1642 |
| 136 | Ga0182007_10011226 | 3300015262 | Bacteria | 3494 |
| 137 | Ga0183367_1013 | 3300015688 | Bacteria | 334176 |
| 138 | Ga0163161_10073856 | 3300017792 | Bacteria | 2500 |
| 139 | Ga0197907_10354677 | 3300020069 | Bacteria | 2326 |
| 140 | Ga0206356_11472949 | 3300020070 | Bacteria | 4321 |
| 141 | Ga0206351_10029283 | 3300020077 | Bacteria | 3161 |
| 142 | Ga0206352_11234775 | 3300020078 | Bacteria | 3132 |
| 143 | Ga0206350_11301258 | 3300020080 | Bacteria | 2871 |
| 144 | Ga0154015_1287331 | 3300020610 | Bacteria | 1545 |
| 145 | Ga0224712_10003493 | 3300022467 | Bacteria | 4094 |
| 146 | Ga0209758_1004580 | 3300025297 | Bacteria | 11393 |
| 147 | Ga0207426_1018696 | 3300025302 | Bacteria | 2438 |
| 148 | Ga0207713_1016850 | 3300025735 | Bacteria | 3692 |
| 149 | Ga0207642_10012027 | 3300025899 | Bacteria | 3110 |
| 150 | Ga0207688_10045246 | 3300025901 | Bacteria | 2455 |
| 151 | Ga0207688_10074080 | 3300025901 | Bacteria | 1936 |
| 152 | Ga0207647_10009632 | 3300025904 | Bacteria | 6858 |
| 153 | Ga0207685_10000003 | 3300025905 | Bacteria | 344527 |
| 154 | Ga0207645_10037301 | 3300025907 | Bacteria | 3118 |
| 155 | Ga0207643_10007579 | 3300025908 | Bacteria | 5827 |
| 156 | Ga0207654_10075598 | 3300025911 | Bacteria | 2013 |
| 157 | Ga0207693_10000859 | 3300025915 | Bacteria | 27121 |
| 158 | Ga0207687_10000350 | 3300025927 | Bacteria | 30682 |
| 159 | Ga0207687_10008276 | 3300025927 | Bacteria | 6804 |
| 160 | Ga0207687_10141629 | 3300025927 | Bacteria | 1825 |
| 161 | Ga0207700_10000009 | 3300025928 | Bacteria | 314953 |
| 162 | Ga0207664_10044349 | 3300025929 | Bacteria | 3482 |
| 163 | Ga0207644_10071585 | 3300025931 | Bacteria | 2537 |
| 164 | Ga0207706_10050046 | 3300025933 | Bacteria | 3693 |
| 165 | Ga0207706_10073832 | 3300025933 | Bacteria | 2999 |
| 166 | Ga0207706_10193079 | 3300025933 | Bacteria | 1787 |
| 167 | Ga0207669_10031304 | 3300025937 | Bacteria | 2971 |
| 168 | Ga0207704_10027421 | 3300025938 | Bacteria | 3143 |
| 169 | Ga0207691_10043075 | 3300025940 | Bacteria | 4161 |
| 170 | Ga0207711_10105332 | 3300025941 | Bacteria | 2501 |
| 171 | Ga0207689_10086973 | 3300025942 | Bacteria | 2568 |
| 172 | Ga0207661_10000166 | 3300025944 | Bacteria | 42698 |
| 173 | Ga0207661_10001864 | 3300025944 | Bacteria | 14438 |
| 174 | Ga0207679_10033855 | 3300025945 | Bacteria | 3599 |
| 175 | Ga0207679_10086996 | 3300025945 | Bacteria | 2405 |
| 176 | Ga0207679_10131459 | 3300025945 | Bacteria | 2009 |
| 177 | Ga0207712_10008190 | 3300025961 | Bacteria | 6607 |
| 178 | Ga0207712_10166793 | 3300025961 | Bacteria | 1717 |
| 179 | Ga0207712_10219167 | 3300025961 | Bacteria | 1520 |
| 180 | Ga0207668_10002710 | 3300025972 | Bacteria | 10367 |
| 181 | Ga0207668_10043248 | 3300025972 | Bacteria | 3056 |
| 182 | Ga0207668_10130247 | 3300025972 | Bacteria | 1920 |
| 183 | Ga0207640_10000059 | 3300025981 | Bacteria | 90901 |
| 184 | Ga0207658_10001012 | 3300025986 | Bacteria | 22933 |
| 185 | Ga0207677_10151639 | 3300026023 | Bacteria | 1789 |
| 186 | Ga0207677_10193462 | 3300026023 | Bacteria | 1611 |
| 187 | Ga0207639_10277165 | 3300026041 | Bacteria | 1473 |
| 188 | Ga0207678_10044529 | 3300026067 | Bacteria | 3838 |
| 189 | Ga0207708_10005542 | 3300026075 | Bacteria | 9312 |
| 190 | Ga0207708_10018003 | 3300026075 | Bacteria | 5316 |
| 191 | Ga0207702_10000027 | 3300026078 | Bacteria | 183792 |
| 192 | Ga0207702_10004385 | 3300026078 | Bacteria | 12570 |
| 193 | Ga0207648_10026752 | 3300026089 | Bacteria | 5124 |
| 194 | Ga0207674_10000156 | 3300026116 | Bacteria | 80650 |
| 195 | Ga0207674_10006396 | 3300026116 | Bacteria | 13866 |
| 196 | Ga0207674_10013677 | 3300026116 | Bacteria | 8990 |
| 197 | Ga0207674_10020515 | 3300026116 | Bacteria | 7138 |
| 198 | Ga0207675_100152168 | 3300026118 | Bacteria | 2202 |
| 199 | Ga0207683_10037429 | 3300026121 | Bacteria | 4225 |
| 200 | Ga0209371_1009618 | 3300027312 | Bacteria | 3054 |
| 201 | Ga0209813_10004237 | 3300027866 | Bacteria | 3410 |
| 202 | Ga0207428_10010741 | 3300027907 | Bacteria | 8168 |
| 203 | Ga0207428_10021489 | 3300027907 | Bacteria | 5464 |
| 204 | Ga0207428_10204093 | 3300027907 | Bacteria | 1487 |
| 205 | Ga0268266_10000664 | 3300028379 | Bacteria | 46506 |
| 206 | Ga0268266_10032922 | 3300028379 | Bacteria | 4406 |
| 207 | Ga0268265_10000440 | 3300028380 | Bacteria | 43839 |
| 208 | Ga0268265_10075616 | 3300028380 | Bacteria | 2639 |
| 209 | Ga0307517_10027373 | 3300028786 | Bacteria | 6849 |
| 210 | Ga0307515_10004249 | 3300028794 | Bacteria | 29735 |
| 211 | Ga0307515_10081143 | 3300028794 | Bacteria | 4217 |
| 212 | Ga0268256_1008087 | 3300030500 | Bacteria | 3649 |
| 213 | Ga0307511_10000330 | 3300030521 | Bacteria | 50161 |
| 214 | Ga0307511_10065907 | 3300030521 | Bacteria | 2704 |
| 215 | Ga0307512_10007323 | 3300030522 | Bacteria | 10962 |
| 216 | Ga0307513_10027362 | 3300031456 | Bacteria | 6550 |
| 217 | Ga0307513_10122524 | 3300031456 | Bacteria | 2564 |
| 218 | Ga0307513_10122676 | 3300031456 | Bacteria | 2561 |
| 219 | Ga0307509_10070928 | 3300031507 | Bacteria | 3636 |
| 220 | Ga0307408_100049093 | 3300031548 | Bacteria | 3030 |
| 221 | Ga0307508_10021674 | 3300031616 | Bacteria | 5843 |
| 222 | Ga0307514_10069054 | 3300031649 | Bacteria | 2660 |
| 223 | Ga0307516_10096302 | 3300031730 | Bacteria | 2780 |
| 224 | Ga0307405_10002494 | 3300031731 | Bacteria | 8135 |
| 225 | Ga0307405_10015809 | 3300031731 | Bacteria | 4097 |
| 226 | Ga0307518_10081976 | 3300031838 | Bacteria | 2328 |
| 227 | Ga0307406_10028815 | 3300031901 | Bacteria | 3357 |
| 228 | Ga0307406_10032918 | 3300031901 | Bacteria | 3168 |
| 229 | Ga0307407_10010899 | 3300031903 | Bacteria | 4305 |
| 230 | Ga0307409_100011102 | 3300031995 | Bacteria | 5654 |
| 231 | Ga0307409_100014187 | 3300031995 | Bacteria | 5167 |
| 232 | Ga0307409_100303677 | 3300031995 | Bacteria | 1486 |
| 233 | Ga0307416_100000623 | 3300032002 | Bacteria | 18266 |
| 234 | Ga0307416_100004246 | 3300032002 | Bacteria | 8602 |
| 235 | Ga0307411_10004616 | 3300032005 | Bacteria | 6631 |
| 236 | Ga0307415_100000256 | 3300032126 | Bacteria | 23002 |
| 237 | Ga0307415_100002785 | 3300032126 | Bacteria | 8755 |
| 238 | Ga0307507_10038524 | 3300033179 | Bacteria | 4843 |
| 239 | Ga0307507_10069397 | 3300033179 | Bacteria | 3207 |
| 240 | Ga0307510_10010376 | 3300033180 | Bacteria | 11066 |
| 241 | Ga0307510_10052245 | 3300033180 | Bacteria | 4311 |
| 242 | Ga0373960_0005121 | 3300035121 | Bacteria | 3023 |
| 243 | Ga0373960_0015284 | 3300035121 | Bacteria | 1957 |
| 244 | Ga0316574_0009190 | 3300035398 | Bacteria | 5526 |
| 245 | Ga0373931_0072610 | 3300035691 | Bacteria | 1882 |
| 246 | Ga0395899_0002021 | 3300037312 | Bacteria | 16714 |
| 247 | Ga0395899_0007160 | 3300037312 | Bacteria | 8634 |
| 248 | Ga0395900_0007778 | 3300037418 | Bacteria | 11058 |
| 249 | Ga0395900_0045971 | 3300037418 | Bacteria | 4496 |
| 250 | Ga0395900_0079332 | 3300037418 | Bacteria | 3373 |
| 251 | Ga0395898_0004136 | 3300037466 | Bacteria | 15914 |
| 252 | Ga0395898_0004392 | 3300037466 | Bacteria | 15422 |
| 253 | Ga0395898_0058489 | 3300037466 | Bacteria | 3752 |
| 254 | Ga0395898_0129837 | 3300037466 | Bacteria | 2414 |
| 255 | Ga0395905_0018273 | 3300037471 | Bacteria | 6656 |
| 256 | Ga0395905_0057557 | 3300037471 | Bacteria | 3636 |
| 257 | Ga0395905_0070489 | 3300037471 | Bacteria | 3276 |
| 258 | Ga0395905_0132661 | 3300037471 | Bacteria | 2343 |
| 259 | Ga0395905_0281452 | 3300037471 | Unclassified | 1549 |
| 260 | Ga0395901_0011756 | 3300038443 | Bacteria | 8873 |
| 261 | Ga0395901_0060217 | 3300038443 | Bacteria | 3950 |
| 262 | Ga0439436_0013029 | 3300041404 | Bacteria | 2517 |
| 263 | Ga0439433_0000942 | 3300041999 | Bacteria | 5831 |
| 264 | Ga0439448_0007983 | 3300042005 | Bacteria | 3085 |
| 265 | Ga0439432_045951 | 3300042006 | Bacteria | 1373 |
| 266 | Ga0439449_0001531 | 3300042007 | Bacteria | 9045 |
| 267 | Ga0439449_0011276 | 3300042007 | Bacteria | 3365 |
| 268 | Ga0439457_000238 | 3300042014 | Bacteria | 14826 |
| 269 | Ga0450898_001885 | 3300042134 | Bacteria | 2843 |
| 270 | Ga0450899_001520 | 3300042135 | Bacteria | 2578 |
| 271 | Ga0450903_000229 | 3300042138 | Bacteria | 12488 |
| 272 | Ga0450906_002805 | 3300042145 | Bacteria | 3796 |
| 273 | Ga0439446_0002277 | 3300042156 | Bacteria | 4581 |
| 274 | Ga0439458_0000860 | 3300042157 | Bacteria | 7849 |
| 275 | Ga0450908_003464 | 3300042184 | Bacteria | 3067 |
| 276 | Ga0466969_0026698 | 3300044656 | Bacteria | 2961 |
| 277 | Ga0466972_0032099 | 3300044658 | Bacteria | 2579 |
| 278 | Ga0466972_0033546 | 3300044658 | Bacteria | 2517 |
| 279 | Ga0466972_0039606 | 3300044658 | Bacteria | 2299 |
| 280 | Ga0466972_0056308 | 3300044658 | Bacteria | 1891 |
| 281 | Ga0466965_0005551 | 3300044683 | Bacteria | 5689 |
| 282 | Ga0466966_0002355 | 3300044684 | Bacteria | 12341 |
| 283 | Ga0466966_0002457 | 3300044684 | Bacteria | 12116 |
| 284 | Ga0466961_0005711 | 3300044693 | Bacteria | 7873 |
| 285 | Ga0466961_0044320 | 3300044693 | Bacteria | 2846 |
| 286 | Ga0466963_0000405 | 3300044694 | Bacteria | 19720 |
| 287 | Ga0466963_0092748 | 3300044694 | Bacteria | 2058 |
| 288 | Ga0466964_0022528 | 3300044706 | Bacteria | 2445 |
| 289 | Ga0466968_0024133 | 3300044735 | Bacteria | 2483 |
| 290 | Ga0466970_0004138 | 3300044765 | Bacteria | 7132 |
| 291 | Ga0466970_0006903 | 3300044765 | Bacteria | 5684 |
| 292 | Ga0466957_0001317 | 3300044842 | Bacteria | 12978 |
| 293 | Ga0466957_0001584 | 3300044842 | Bacteria | 11952 |
| 294 | Ga0466960_0000033 | 3300044901 | Bacteria | 46153 |
| 295 | Ga0466960_0081839 | 3300044901 | Bacteria | 1629 |
| 296 | Ga0466959_0069492 | 3300045049 | Bacteria | 2551 |
| 297 | Ga0451576_0113558 | 3300045051 | Bacteria | 2820 |
| 298 | Ga0466958_0005655 | 3300045836 | Bacteria | 6750 |
| 299 | Ga0466967_0000008 | 3300045976 | Bacteria | 127135 |
| 300 | Ga0466967_0036899 | 3300045976 | Bacteria | 4177 |
| 301 | Ga0495617_008934 | 3300046452 | Bacteria | 3446 |
| 302 | Ga0495627_034414 | 3300046453 | Bacteria | 1583 |
| 303 | Ga0495592_0012929 | 3300046454 | Bacteria | 6346 |
| 304 | Ga0495592_0137942 | 3300046454 | Bacteria | 1699 |
| 305 | Ga0495603_0004681 | 3300046455 | Bacteria | 8173 |
| 306 | Ga0495603_0006825 | 3300046455 | Bacteria | 6847 |
| 307 | Ga0495603_0047483 | 3300046455 | Bacteria | 2556 |
| 308 | Ga0495629_0001046 | 3300046459 | Bacteria | 22155 |
| 309 | Ga0495629_0044283 | 3300046459 | Bacteria | 3123 |
| 310 | Ga0495629_0090933 | 3300046459 | Bacteria | 2129 |
| 311 | Ga0495629_0109659 | 3300046459 | Bacteria | 1924 |
| 312 | Ga0495638_0121436 | 3300046460 | Bacteria | 1543 |
| 313 | Ga0495653_0032856 | 3300046463 | Bacteria | 4116 |
| 314 | Ga0495650_0000398 | 3300046471 | Bacteria | 72672 |
| 315 | Ga0495580_0062764 | 3300046472 | Bacteria | 2606 |
| 316 | Ga0495582_0000159 | 3300046473 | Bacteria | 36459 |
| 317 | Ga0495605_0022625 | 3300046474 | Bacteria | 3316 |
| 318 | Ga0495662_0003818 | 3300046476 | Bacteria | 7595 |
| 319 | Ga0495662_0021537 | 3300046476 | Bacteria | 3114 |
| 320 | Ga0495662_0052918 | 3300046476 | Bacteria | 1961 |
| 321 | Ga0495594_0011901 | 3300046499 | Bacteria | 4526 |
| 322 | Ga0495594_0043213 | 3300046499 | Bacteria | 2469 |
| 323 | Ga0495596_0008034 | 3300046500 | Bacteria | 4715 |
| 324 | Ga0495607_0029476 | 3300046501 | Bacteria | 3377 |
| 325 | Ga0495606_0005398 | 3300046507 | Bacteria | 12254 |
| 326 | Ga0495608_0000001 | 3300046511 | Bacteria | 411278 |
| 327 | Ga0495608_0023731 | 3300046511 | Bacteria | 4200 |
| 328 | Ga0495610_0062417 | 3300046512 | Bacteria | 1767 |
| 329 | Ga0495616_0005334 | 3300046513 | Bacteria | 7928 |
| 330 | Ga0495618_0037235 | 3300046514 | Bacteria | 3054 |
| 331 | Ga0495628_0000858 | 3300046516 | Bacteria | 28086 |
| 332 | Ga0495628_0098249 | 3300046516 | Bacteria | 2261 |
| 333 | Ga0495628_0193393 | 3300046516 | Bacteria | 1535 |
| 334 | Ga0495630_0007228 | 3300046517 | Bacteria | 7922 |
| 335 | Ga0495631_0003400 | 3300046518 | Bacteria | 8716 |
| 336 | Ga0495632_0079597 | 3300046519 | Bacteria | 1564 |
| 337 | Ga0495637_0052442 | 3300046520 | Bacteria | 1703 |
| 338 | Ga0495637_0066936 | 3300046520 | Bacteria | 1459 |
| 339 | Ga0495643_0001191 | 3300046522 | Bacteria | 25336 |
| 340 | Ga0495666_0008192 | 3300046526 | Bacteria | 5237 |
| 341 | Ga0495652_0007389 | 3300046529 | Bacteria | 10129 |
| 342 | Ga0495652_0075499 | 3300046529 | Bacteria | 2799 |
| 343 | Ga0495640_0016024 | 3300046533 | Bacteria | 5620 |
| 344 | Ga0495640_0131522 | 3300046533 | Bacteria | 1619 |
| 345 | Ga0495587_0013882 | 3300046536 | Bacteria | 5057 |
| 346 | Ga0495609_0040017 | 3300046538 | Bacteria | 2110 |
| 347 | Ga0495609_0044593 | 3300046538 | Bacteria | 1988 |
| 348 | Ga0495645_0118103 | 3300046543 | Bacteria | 1870 |
| 349 | Ga0495645_0127583 | 3300046543 | Bacteria | 1786 |
| 350 | Ga0495622_0000521 | 3300046557 | Bacteria | 23348 |
| 351 | Ga0495622_0008154 | 3300046557 | Bacteria | 4853 |
| 352 | Ga0495633_0007953 | 3300046558 | Bacteria | 6041 |
| 353 | Ga0495633_0034957 | 3300046558 | Bacteria | 2415 |
| 354 | Ga0495668_0000182 | 3300046616 | Bacteria | 93763 |
| 355 | Ga0495634_0001996 | 3300046642 | Bacteria | 17374 |
| 356 | Ga0495634_0011594 | 3300046642 | Bacteria | 6412 |
| 357 | Ga0495611_0036800 | 3300046648 | Bacteria | 2173 |
| 358 | Ga0495611_0077027 | 3300046648 | Bacteria | 1529 |
| 359 | Ga0495625_0000464 | 3300046660 | Bacteria | 60878 |
| 360 | Ga0495625_0026014 | 3300046660 | Bacteria | 4426 |
| 361 | Ga0495659_0034936 | 3300046664 | Bacteria | 1770 |
| 362 | Ga0495588_0000179 | 3300046674 | Bacteria | 77030 |
| 363 | Ga0495588_0006065 | 3300046674 | Bacteria | 5423 |
| 364 | Ga0495657_0000002 | 3300046675 | Bacteria | 411958 |
| 365 | Ga0495657_0077732 | 3300046675 | Bacteria | 2152 |
| 366 | Ga0495657_0090009 | 3300046675 | Bacteria | 1970 |
| 367 | Ga0495623_0086170 | 3300046679 | Bacteria | 1936 |
| 368 | Ga0495658_0000190 | 3300046683 | Bacteria | 35518 |
| 369 | Ga0495613_0000242 | 3300046689 | Bacteria | 51661 |
| 370 | Ga0495613_0017363 | 3300046689 | Bacteria | 5362 |
| 371 | Ga0495613_0094258 | 3300046689 | Bacteria | 2166 |
| 372 | Ga0495624_0001522 | 3300046690 | Bacteria | 17958 |
| 373 | Ga0495624_0027902 | 3300046690 | Bacteria | 3691 |
| 374 | Ga0495670_0052499 | 3300046691 | Bacteria | 2041 |
| 375 | Ga0495589_0008202 | 3300046794 | Bacteria | 5461 |
| 376 | Ga0495589_0016235 | 3300046794 | Bacteria | 3826 |
| 377 | Ga0495581_0013192 | 3300047315 | Bacteria | 4792 |
| 378 | Ga0495604_0000513 | 3300047317 | Bacteria | 34041 |
| 379 | Ga0495604_0001522 | 3300047317 | Bacteria | 19077 |
| 380 | Ga0495604_0005945 | 3300047317 | Bacteria | 9682 |
| 381 | Ga0495604_0024466 | 3300047317 | Bacteria | 4818 |
| 382 | Ga0495636_0004033 | 3300047318 | Bacteria | 5744 |
| 383 | Ga0495636_0006112 | 3300047318 | Bacteria | 4730 |
| 384 | Ga0495674_0000007 | 3300047319 | Bacteria | 336257 |
| 385 | Ga0495674_0164277 | 3300047319 | Bacteria | 1856 |
| 386 | Ga0495672_0043031 | 3300047320 | Bacteria | 2718 |
| 387 | Ga0495676_0030482 | 3300047321 | Bacteria | 4576 |
| 388 | Ga0495676_0036997 | 3300047321 | Bacteria | 4068 |
| 389 | Ga0495676_0067798 | 3300047321 | Bacteria | 2759 |
| 390 | Ga0495680_0043182 | 3300047322 | Bacteria | 3571 |
| 391 | Ga0495680_0087218 | 3300047322 | Bacteria | 2348 |
| 392 | Ga0495680_0114163 | 3300047322 | Bacteria | 1999 |
| 393 | Ga0495680_0186733 | 3300047322 | Bacteria | 1493 |
| 394 | Ga0495683_0035402 | 3300047323 | Bacteria | 2537 |
| 395 | Ga0495683_0054700 | 3300047323 | Bacteria | 1988 |
| 396 | Ga0495675_0000162 | 3300047444 | Bacteria | 47605 |
| 397 | Ga0495675_0011550 | 3300047444 | Bacteria | 5544 |
| 398 | Ga0495685_006311 | 3300047447 | Bacteria | 3874 |
| 399 | Ga0495685_007714 | 3300047447 | Bacteria | 3559 |
| 400 | Ga0495685_041360 | 3300047447 | Bacteria | 1575 |
| 401 | Ga0495681_0001153 | 3300047470 | Bacteria | 20012 |
| 402 | Ga0495684_0068281 | 3300047471 | Bacteria | 2703 |
| 403 | Ga0495686_0032104 | 3300047472 | Bacteria | 3401 |
| 404 | Ga0495602_0000010 | 3300048088 | Bacteria | 212121 |
| 405 | Ga0495602_0000188 | 3300048088 | Bacteria | 58305 |
| 406 | Ga0495614_0043536 | 3300048089 | Bacteria | 1925 |
| 407 | Ga0495614_0050741 | 3300048089 | Bacteria | 1777 |
| 408 | Ga0495626_0000286 | 3300048091 | Bacteria | 54819 |
| 409 | Ga0496101_0006280 | 3300048904 | Bacteria | 7650 |
| 410 | Ga0496102_0139047 | 3300048905 | Bacteria | 2276 |
| 411 | Ga0496103_0151794 | 3300048906 | Bacteria | 1484 |
| 412 | Ga0496104_0020972 | 3300048907 | Bacteria | 5995 |
| 413 | Ga0496105_0027534 | 3300048908 | Bacteria | 4645 |
| 414 | Ga0496106_0022722 | 3300048909 | Bacteria | 4661 |
| 415 | Ga0496106_0055028 | 3300048909 | Bacteria | 3007 |
| 416 | Ga0496107_0008800 | 3300048910 | Bacteria | 6994 |
| 417 | Ga0496107_0055918 | 3300048910 | Bacteria | 2850 |
| 418 | Ga0496108_0002372 | 3300048911 | Bacteria | 15085 |
| 419 | Ga0496108_0007744 | 3300048911 | Bacteria | 8701 |
| 420 | Ga0496108_0009918 | 3300048911 | Bacteria | 7722 |
| 421 | Ga0496108_0048312 | 3300048911 | Bacteria | 3558 |
| 422 | Ga0496109_0000035 | 3300048912 | Bacteria | 159744 |
| 423 | Ga0496109_0007413 | 3300048912 | Bacteria | 9284 |
| 424 | Ga0496109_0200231 | 3300048912 | Bacteria | 1877 |
| 425 | Ga0496110_0000112 | 3300048913 | Bacteria | 44496 |
| 426 | Ga0496110_0000476 | 3300048913 | Bacteria | 27211 |
| 427 | Ga0496111_0000091 | 3300048914 | Bacteria | 38326 |
| 428 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 429 | Ga0496112_0001898 | 3300048915 | Bacteria | 16486 |
| 430 | Ga0496113_0000093 | 3300048916 | Bacteria | 38914 |
| 431 | Ga0496113_0126772 | 3300048916 | Bacteria | 2000 |
| 432 | Ga0496114_0022858 | 3300048917 | Bacteria | 5096 |
| 433 | Ga0496115_0225221 | 3300048918 | Bacteria | 1547 |
| 434 | Ga0496119_0005514 | 3300048922 | Bacteria | 12076 |
| 435 | Ga0496121_0031897 | 3300048924 | Bacteria | 4803 |
| 436 | Ga0496124_0017478 | 3300048927 | Bacteria | 6757 |
| 437 | Ga0496125_0033667 | 3300048928 | Bacteria | 4530 |
| 438 | Ga0496126_0028027 | 3300048929 | Bacteria | 5371 |
| 439 | Ga0496126_0064007 | 3300048929 | Bacteria | 3295 |
| 440 | Ga0501031_0030822 | 3300049568 | Bacteria | 3498 |
| 441 | Ga0501031_0091605 | 3300049568 | Bacteria | 1983 |
| 442 | Ga0501033_0000872 | 3300049570 | Bacteria | 27578 |
| 443 | Ga0501033_0001082 | 3300049570 | Bacteria | 24644 |
| 444 | Ga0501033_0053120 | 3300049570 | Bacteria | 3001 |
| 445 | Ga0501034_0001218 | 3300049571 | Bacteria | 35189 |
| 446 | Ga0501034_0015605 | 3300049571 | Bacteria | 7802 |
| 447 | Ga0501034_0021166 | 3300049571 | Bacteria | 6634 |
| 448 | Ga0501036_0000189 | 3300049572 | Bacteria | 40908 |
| 449 | Ga0501036_0034077 | 3300049572 | Bacteria | 4306 |
| 450 | Ga0501036_0096253 | 3300049572 | Bacteria | 2502 |
| 451 | Ga0501036_0152469 | 3300049572 | Bacteria | 1949 |
| 452 | Ga0501037_0058366 | 3300049573 | Bacteria | 2816 |
| 453 | Ga0501038_0009078 | 3300049574 | Bacteria | 9127 |
| 454 | Ga0501038_0032427 | 3300049574 | Bacteria | 4609 |
| 455 | Ga0501039_0017828 | 3300049575 | Bacteria | 5447 |
| 456 | Ga0501039_0093354 | 3300049575 | Bacteria | 2345 |
| 457 | Ga0501040_0026377 | 3300049576 | Bacteria | 3907 |
| 458 | Ga0501041_0007141 | 3300049577 | Bacteria | 6551 |
| 459 | Ga0501041_0052484 | 3300049577 | Bacteria | 2486 |
| 460 | Ga0501042_0052569 | 3300049578 | Bacteria | 2905 |
| 461 | Ga0501042_0280410 | 3300049578 | Bacteria | 1203 |
| 462 | Ga0501043_0000373 | 3300049579 | Bacteria | 40611 |
| 463 | Ga0501043_0070296 | 3300049579 | Bacteria | 2749 |
| 464 | Ga0501046_0015570 | 3300049580 | Bacteria | 6387 |
| 465 | Ga0501047_0073476 | 3300049581 | Bacteria | 3292 |
| 466 | Ga0501048_0053658 | 3300049582 | Bacteria | 2865 |
| 467 | Ga0501067_0007041 | 3300049583 | Bacteria | 6246 |
| 468 | Ga0501068_0005826 | 3300049584 | Bacteria | 6759 |
| 469 | Ga0501068_0007172 | 3300049584 | Bacteria | 6173 |
| 470 | Ga0501069_0080787 | 3300049585 | Bacteria | 1831 |
| 471 | Ga0501070_0001778 | 3300049586 | Bacteria | 19038 |
| 472 | Ga0501070_0142896 | 3300049586 | Bacteria | 1976 |
| 473 | Ga0501070_0188183 | 3300049586 | Bacteria | 1697 |
| 474 | Ga0501071_0037939 | 3300049587 | Bacteria | 3442 |
| 475 | Ga0501071_0058859 | 3300049587 | Bacteria | 2778 |
| 476 | Ga0501072_0017741 | 3300049588 | Bacteria | 5473 |
| 477 | Ga0501072_0035706 | 3300049588 | Bacteria | 3895 |
| 478 | Ga0501073_0169414 | 3300049589 | Bacteria | 1512 |
| 479 | Ga0501074_0003673 | 3300049590 | Bacteria | 10885 |
| 480 | Ga0501074_0011092 | 3300049590 | Bacteria | 6544 |
| 481 | Ga0501075_0017240 | 3300049591 | Bacteria | 5215 |
| 482 | Ga0501076_0005958 | 3300049592 | Bacteria | 8802 |
| 483 | Ga0501077_0029326 | 3300049593 | Bacteria | 3498 |
| 484 | Ga0501077_0089624 | 3300049593 | Bacteria | 1949 |
| 485 | Ga0501079_0038721 | 3300049741 | Bacteria | 3676 |
| 486 | Ga0501080_0011233 | 3300049742 | Bacteria | 8197 |
| 487 | Ga0501080_0092891 | 3300049742 | Bacteria | 2802 |
| 488 | Ga0501081_0020139 | 3300049743 | Bacteria | 4446 |
| 489 | Ga0501081_0062705 | 3300049743 | Bacteria | 2579 |
| 490 | Ga0501035_0000934 | 3300049822 | Bacteria | 30908 |
| 491 | Ga0501035_0059807 | 3300049822 | Bacteria | 3393 |
| 492 | Ga0501035_0219653 | 3300049822 | Bacteria | 1623 |
| 493 | Ga0501044_0000883 | 3300049823 | Bacteria | 36150 |
| 494 | Ga0501044_0043467 | 3300049823 | Bacteria | 4667 |
| 495 | Ga0501045_0009418 | 3300049824 | Bacteria | 6831 |
| 496 | nmdc:mga03n38_6903_c1 | 3300050490 | Bacteria | 3984 |
| 497 | nmdc:mga06z11_21149_c1 | 3300050494 | Bacteria | 3019 |
| 498 | nmdc:mga04h51_4600_c1 | 3300050495 | Bacteria | 3449 |
| 499 | nmdc:mga05p37_326192_c1 | 3300050507 | Bacteria | 1815 |
| 500 | nmdc:mga05p37_39682_c1 | 3300050507 | Bacteria | 5780 |
| 501 | nmdc:mga09592_2418_c1 | 3300050508 | Bacteria | 15066 |
| 502 | nmdc:mga0qj67_9140_c1 | 3300050509 | Bacteria | 7356 |
| 503 | nmdc:mga06r32_290204_c1 | 3300050510 | Bacteria | 1622 |
| 504 | nmdc:mga08y16_155285_c1 | 3300050511 | Bacteria | 2378 |
| 505 | nmdc:mga08y16_255674_c1 | 3300050511 | Bacteria | 1810 |
| 506 | nmdc:mga08y16_27106_c1 | 3300050511 | Bacteria | 6039 |
| 507 | nmdc:mga08y16_59391_c1 | 3300050511 | Bacteria | 3994 |
| 508 | nmdc:mga0n895_162040_c1 | 3300050512 | Bacteria | 2268 |
| 509 | nmdc:mga0a205_123911_c1 | 3300050515 | Bacteria | 2484 |
| 510 | Ga0495601_0000012 | 3300053077 | Bacteria | 227853 |
| 511 | Ga0495601_0061537 | 3300053077 | Bacteria | 2383 |
| 512 | Ga0495612_0027371 | 3300053078 | Bacteria | 2292 |
| 513 | Ga0495655_0000406 | 3300053083 | Bacteria | 7323 |
| 514 | Ga0495655_0002744 | 3300053083 | Bacteria | 2829 |
| 515 | Ga0495595_0000001 | 3300053084 | Bacteria | 495226 |
| 516 | Ga0495595_0013415 | 3300053084 | Bacteria | 3462 |
| 517 | Ga0495619_0000018 | 3300053085 | Bacteria | 209943 |
| 518 | Ga0495619_0000372 | 3300053085 | Bacteria | 30832 |
| 519 | Ga0495619_0000509 | 3300053085 | Bacteria | 25913 |
| 520 | Ga0495619_0062461 | 3300053085 | Bacteria | 2480 |
| 521 | Ga0500644_0021429 | 3300053088 | Bacteria | 1936 |
| 522 | Ga0500583_0091442 | 3300053092 | Bacteria | 1481 |
| 523 | Ga0500560_001057 | 3300053107 | Bacteria | 4471 |
| 524 | Ga0500595_014819 | 3300053119 | Bacteria | 2947 |
| 525 | Ga0500577_0042237 | 3300053142 | Bacteria | 1668 |
| 526 | Ga0500600_0064233 | 3300053149 | Bacteria | 2035 |
| 527 | Ga0500616_0002119 | 3300053153 | Bacteria | 17229 |
| 528 | Ga0501084_0016506 | 3300054114 | Bacteria | 6132 |
| 529 | Ga0501084_0127358 | 3300054114 | Bacteria | 2143 |
| 530 | Ga0501082_0005404 | 3300060353 | Bacteria | 11083 |
| 531 | Ga0466962_0001787 | 3300061719 | Bacteria | 10113 |
| 532 | Ga0530510_0006564 | 3300061734 | Bacteria | 8106 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046557 | Ga0495622_0000521 | Ga0495622_0000521_20033_21148 | 338 |
| 2 | 3300009147 | Ga0114129_10678441 | Ga0114129_106784411 | 342 |
| 3 | 3300046689 | Ga0495613_0000242 | Ga0495613_0000242_47777_48943 | 343 |
| 4 | 3300053077 | Ga0495601_0000012 | Ga0495601_0000012_200611_201774 | 343 |
| 5 | 3300010375 | Ga0105239_10042952 | Ga0105239_100429522 | 344 |
| 6 | 3300047317 | Ga0495604_0005945 | Ga0495604_0005945_1537_2697 | 348 |
| 7 | 3300048088 | Ga0495602_0000010 | Ga0495602_0000010_199255_200415 | 348 |
| 8 | 3300053084 | Ga0495595_0013415 | Ga0495595_0013415_629_1789 | 348 |
| 9 | 3300053085 | Ga0495619_0000372 | Ga0495619_0000372_10057_11220 | 348 |
| 10 | 3300005343 | Ga0070687_100052471 | Ga0070687_1000524712 | 349 |
| 11 | 3300020069 | Ga0197907_10354677 | Ga0197907_103546772 | 349 |
| 12 | 3300022467 | Ga0224712_10003493 | Ga0224712_100034932 | 349 |
| 13 | 3300026041 | Ga0207639_10277165 | Ga0207639_102771652 | 349 |
| 14 | 3300026075 | Ga0207708_10018003 | Ga0207708_100180035 | 349 |
| 15 | 3300046642 | Ga0495634_0001996 | Ga0495634_0001996_16144_17295 | 349 |
| 16 | 3300047317 | Ga0495604_0001522 | Ga0495604_0001522_5587_6753 | 349 |
| 17 | 3300047322 | Ga0495680_0087218 | Ga0495680_0087218_970_2124 | 349 |
| 18 | 3300014326 | Ga0157380_10114791 | Ga0157380_101147911 | 350 |
| 19 | 3300046517 | Ga0495630_0007228 | Ga0495630_0007228_4044_5201 | 350 |
| 20 | 3300047471 | Ga0495684_0068281 | Ga0495684_0068281_835_1992 | 350 |
| 21 | 3300005329 | Ga0070683_100013435 | Ga0070683_1000134353 | 351 |
| 22 | 3300020070 | Ga0206356_11472949 | Ga0206356_114729492 | 351 |
| 23 | 3300005329 | Ga0070683_100000481 | Ga0070683_1000004816 | 352 |
| 24 | 3300005535 | Ga0070684_100010251 | Ga0070684_1000102515 | 352 |
| 25 | 3300025915 | Ga0207693_10000859 | Ga0207693_1000085919 | 352 |
| 26 | 3300025944 | Ga0207661_10000166 | Ga0207661_100001666 | 352 |
| 27 | 3300046463 | Ga0495653_0032856 | Ga0495653_0032856_1648_2763 | 352 |
| 28 | 3300046516 | Ga0495628_0000858 | Ga0495628_0000858_17186_18343 | 352 |
| 29 | 3300048088 | Ga0495602_0000188 | Ga0495602_0000188_41458_42615 | 352 |
| 30 | 3300049589 | Ga0501073_0169414 | Ga0501073_0169414_46_1152 | 352 |
| 31 | 3300049742 | Ga0501080_0092891 | Ga0501080_0092891_438_1544 | 352 |
| 32 | 3300053077 | Ga0495601_0061537 | Ga0495601_0061537_1126_2349 | 352 |
| 33 | 3300046529 | Ga0495652_0007389 | Ga0495652_0007389_7757_8887 | 353 |
| 34 | 3300046536 | Ga0495587_0013882 | Ga0495587_0013882_1368_2522 | 353 |
| 35 | 3300046543 | Ga0495645_0127583 | Ga0495645_0127583_559_1689 | 353 |
| 36 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_473134_474294 | 353 |
| 37 | 3300048915 | Ga0496112_0001898 | Ga0496112_0001898_9711_10880 | 353 |
| 38 | 3300048916 | Ga0496113_0000093 | Ga0496113_0000093_9644_10813 | 353 |
| 39 | 3300035398 | Ga0316574_0009190 | Ga0316574_0009190_2421_3653 | 354 |
| 40 | 3300047319 | Ga0495674_0000007 | Ga0495674_0000007_155909_157066 | 354 |
| 41 | 3300005337 | Ga0070682_100000815 | Ga0070682_10000081520 | 355 |
| 42 | 3300005841 | Ga0068863_100015526 | Ga0068863_1000155263 | 355 |
| 43 | 3300025972 | Ga0207668_10130247 | Ga0207668_101302472 | 355 |
| 44 | 3300044842 | Ga0466957_0001584 | Ga0466957_0001584_720_1880 | 355 |
| 45 | 3300048906 | Ga0496103_0151794 | Ga0496103_0151794_61_1215 | 355 |
| 46 | 3300048911 | Ga0496108_0007744 | Ga0496108_0007744_2682_3845 | 355 |
| 47 | 3300048912 | Ga0496109_0000035 | Ga0496109_0000035_112493_113656 | 355 |
| 48 | 3300049572 | Ga0501036_0152469 | Ga0501036_0152469_187_1305 | 355 |
| 49 | 3300049575 | Ga0501039_0093354 | Ga0501039_0093354_1155_2273 | 355 |
| 50 | 3300049577 | Ga0501041_0052484 | Ga0501041_0052484_584_1702 | 355 |
| 51 | 3300049578 | Ga0501042_0280410 | Ga0501042_0280410_21_1139 | 355 |
| 52 | 3300049587 | Ga0501071_0037939 | Ga0501071_0037939_621_1739 | 355 |
| 53 | 3300049588 | Ga0501072_0035706 | Ga0501072_0035706_625_1743 | 355 |
| 54 | 3300049593 | Ga0501077_0089624 | Ga0501077_0089624_634_1752 | 355 |
| 55 | 3300049743 | Ga0501081_0062705 | Ga0501081_0062705_851_1969 | 355 |
| 56 | 3300049822 | Ga0501035_0219653 | Ga0501035_0219653_170_1288 | 355 |
| 57 | 3300054114 | Ga0501084_0127358 | Ga0501084_0127358_50_1168 | 355 |
| 58 | 3300005466 | Ga0070685_10033933 | Ga0070685_100339332 | 356 |
| 59 | 3300005614 | Ga0068856_100000057 | Ga0068856_10000005770 | 356 |
| 60 | 3300005981 | Ga0081538_10006851 | Ga0081538_100068514 | 356 |
| 61 | 3300026078 | Ga0207702_10000027 | Ga0207702_1000002777 | 356 |
| 62 | 3300005436 | Ga0070713_100000076 | Ga0070713_10000007648 | 357 |
| 63 | 3300005438 | Ga0070701_10051624 | Ga0070701_100516242 | 357 |
| 64 | 3300009148 | Ga0105243_10110533 | Ga0105243_101105332 | 357 |
| 65 | 3300009174 | Ga0105241_10106509 | Ga0105241_101065092 | 357 |
| 66 | 3300009553 | Ga0105249_10000841 | Ga0105249_1000084131 | 357 |
| 67 | 3300013297 | Ga0157378_10012517 | Ga0157378_100125174 | 357 |
| 68 | 3300013307 | Ga0157372_10000616 | Ga0157372_1000061629 | 357 |
| 69 | 3300014325 | Ga0163163_10241602 | Ga0163163_102416022 | 357 |
| 70 | 3300014968 | Ga0157379_10054784 | Ga0157379_100547843 | 357 |
| 71 | 3300020078 | Ga0206352_11234775 | Ga0206352_112347752 | 357 |
| 72 | 3300025907 | Ga0207645_10037301 | Ga0207645_100373013 | 357 |
| 73 | 3300025911 | Ga0207654_10075598 | Ga0207654_100755981 | 357 |
| 74 | 3300025928 | Ga0207700_10000009 | Ga0207700_10000009231 | 357 |
| 75 | 3300026067 | Ga0207678_10044529 | Ga0207678_100445293 | 357 |
| 76 | 3300026118 | Ga0207675_100152168 | Ga0207675_1001521682 | 357 |
| 77 | 3300046473 | Ga0495582_0000159 | Ga0495582_0000159_5498_6652 | 357 |
| 78 | 3300046674 | Ga0495588_0000179 | Ga0495588_0000179_13717_14880 | 357 |
| 79 | 3300046683 | Ga0495658_0000190 | Ga0495658_0000190_1866_3020 | 357 |
| 80 | 3300047322 | Ga0495680_0114163 | Ga0495680_0114163_732_1898 | 357 |
| 81 | 3300005329 | Ga0070683_100000288 | Ga0070683_1000002886 | 358 |
| 82 | 3300005331 | Ga0070670_100013950 | Ga0070670_1000139504 | 358 |
| 83 | 3300005344 | Ga0070661_100107774 | Ga0070661_1001077742 | 358 |
| 84 | 3300005466 | Ga0070685_10065160 | Ga0070685_100651601 | 358 |
| 85 | 3300005564 | Ga0070664_100161454 | Ga0070664_1001614542 | 358 |
| 86 | 3300025944 | Ga0207661_10001864 | Ga0207661_100018646 | 358 |
| 87 | 3300025945 | Ga0207679_10131459 | Ga0207679_101314592 | 358 |
| 88 | 3300026116 | Ga0207674_10013677 | Ga0207674_100136777 | 358 |
| 89 | 3300044694 | Ga0466963_0092748 | Ga0466963_0092748_885_2045 | 358 |
| 90 | 3300045051 | Ga0451576_0113558 | Ga0451576_0113558_790_1971 | 358 |
| 91 | 3300046511 | Ga0495608_0000001 | Ga0495608_0000001_248897_250081 | 358 |
| 92 | 3300046675 | Ga0495657_0000002 | Ga0495657_0000002_249577_250761 | 358 |
| 93 | 3300047444 | Ga0495675_0000162 | Ga0495675_0000162_6275_7459 | 358 |
| 94 | 3300053084 | Ga0495595_0000001 | Ga0495595_0000001_161198_162382 | 358 |
| 95 | 3300053085 | Ga0495619_0000509 | Ga0495619_0000509_6271_7455 | 358 |
| 96 | 3300005341 | Ga0070691_10037210 | Ga0070691_100372102 | 359 |
| 97 | 3300005981 | Ga0081538_10051026 | Ga0081538_100510263 | 359 |
| 98 | 3300046543 | Ga0495645_0118103 | Ga0495645_0118103_64_1215 | 359 |
| 99 | 3300050511 | nmdc:mga08y16_155285_c1 | nmdc:mga08y16_155285_c1_92_1327 | 359 |
| 100 | 3300004798 | Ga0058859_11190849 | Ga0058859_111908492 | 360 |
| 101 | 3300005439 | Ga0070711_100138059 | Ga0070711_1001380592 | 360 |
| 102 | 3300005578 | Ga0068854_100000115 | Ga0068854_10000011560 | 360 |
| 103 | 3300009098 | Ga0105245_10062351 | Ga0105245_100623512 | 360 |
| 104 | 3300025981 | Ga0207640_10000059 | Ga0207640_1000005930 | 360 |
| 105 | 3300026075 | Ga0207708_10005542 | Ga0207708_100055425 | 360 |
| 106 | 3300047322 | Ga0495680_0186733 | Ga0495680_0186733_321_1481 | 360 |
| 107 | 3300053085 | Ga0495619_0000018 | Ga0495619_0000018_136283_137455 | 360 |
| 108 | 3300005329 | Ga0070683_100005284 | Ga0070683_1000052842 | 361 |
| 109 | 3300005441 | Ga0070700_100000859 | Ga0070700_1000008595 | 361 |
| 110 | 3300005535 | Ga0070684_100001695 | Ga0070684_1000016954 | 361 |
| 111 | 3300005564 | Ga0070664_100041141 | Ga0070664_1000411414 | 361 |
| 112 | 3300005577 | Ga0068857_100004457 | Ga0068857_1000044576 | 361 |
| 113 | 3300005615 | Ga0070702_100024072 | Ga0070702_1000240725 | 361 |
| 114 | 3300009094 | Ga0111539_10036359 | Ga0111539_100363596 | 361 |
| 115 | 3300009094 | Ga0111539_10276033 | Ga0111539_102760332 | 361 |
| 116 | 3300009147 | Ga0114129_10179735 | Ga0114129_101797352 | 361 |
| 117 | 3300009176 | Ga0105242_10046981 | Ga0105242_100469812 | 361 |
| 118 | 3300010375 | Ga0105239_10037606 | Ga0105239_100376066 | 361 |
| 119 | 3300013307 | Ga0157372_10199044 | Ga0157372_101990442 | 361 |
| 120 | 3300014968 | Ga0157379_10240557 | Ga0157379_102405572 | 361 |
| 121 | 3300025927 | Ga0207687_10008276 | Ga0207687_100082763 | 361 |
| 122 | 3300025933 | Ga0207706_10193079 | Ga0207706_101930792 | 361 |
| 123 | 3300025938 | Ga0207704_10027421 | Ga0207704_100274215 | 361 |
| 124 | 3300025945 | Ga0207679_10033855 | Ga0207679_100338552 | 361 |
| 125 | 3300025961 | Ga0207712_10219167 | Ga0207712_102191672 | 361 |
| 126 | 3300026116 | Ga0207674_10006396 | Ga0207674_1000639611 | 361 |
| 127 | 3300046690 | Ga0495624_0001522 | Ga0495624_0001522_5928_7094 | 361 |
| 128 | 3300047472 | Ga0495686_0032104 | Ga0495686_0032104_45_1199 | 361 |
| 129 | 3300050507 | nmdc:mga05p37_326192_c1 | nmdc:mga05p37_326192_c1_291_1517 | 361 |
| 130 | 3300050511 | nmdc:mga08y16_59391_c1 | nmdc:mga08y16_59391_c1_2737_3963 | 361 |
| 131 | 3300053078 | Ga0495612_0027371 | Ga0495612_0027371_773_1924 | 361 |
| 132 | 3300005614 | Ga0068856_100031605 | Ga0068856_1000316054 | 362 |
| 133 | 3300013102 | Ga0157371_10023682 | Ga0157371_100236823 | 362 |
| 134 | 3300025901 | Ga0207688_10045246 | Ga0207688_100452462 | 362 |
| 135 | 3300026078 | Ga0207702_10004385 | Ga0207702_100043854 | 362 |
| 136 | 3300046520 | Ga0495637_0066936 | Ga0495637_0066936_95_1276 | 362 |
| 137 | 3300048913 | Ga0496110_0000476 | Ga0496110_0000476_4773_5945 | 362 |
| 138 | 3300049568 | Ga0501031_0030822 | Ga0501031_0030822_1109_2242 | 362 |
| 139 | 3300049570 | Ga0501033_0053120 | Ga0501033_0053120_678_1811 | 362 |
| 140 | 3300049572 | Ga0501036_0096253 | Ga0501036_0096253_874_2007 | 362 |
| 141 | 3300049573 | Ga0501037_0058366 | Ga0501037_0058366_1294_2427 | 362 |
| 142 | 3300049574 | Ga0501038_0032427 | Ga0501038_0032427_432_1565 | 362 |
| 143 | 3300049576 | Ga0501040_0026377 | Ga0501040_0026377_1555_2688 | 362 |
| 144 | 3300049577 | Ga0501041_0007141 | Ga0501041_0007141_5263_6396 | 362 |
| 145 | 3300049578 | Ga0501042_0052569 | Ga0501042_0052569_793_1926 | 362 |
| 146 | 3300049580 | Ga0501046_0015570 | Ga0501046_0015570_644_1777 | 362 |
| 147 | 3300049582 | Ga0501048_0053658 | Ga0501048_0053658_1190_2323 | 362 |
| 148 | 3300049584 | Ga0501068_0007172 | Ga0501068_0007172_3645_4778 | 362 |
| 149 | 3300049585 | Ga0501069_0080787 | Ga0501069_0080787_300_1433 | 362 |
| 150 | 3300049587 | Ga0501071_0058859 | Ga0501071_0058859_666_1799 | 362 |
| 151 | 3300049588 | Ga0501072_0017741 | Ga0501072_0017741_216_1349 | 362 |
| 152 | 3300049590 | Ga0501074_0011092 | Ga0501074_0011092_4197_5330 | 362 |
| 153 | 3300049591 | Ga0501075_0017240 | Ga0501075_0017240_116_1249 | 362 |
| 154 | 3300049592 | Ga0501076_0005958 | Ga0501076_0005958_6342_7475 | 362 |
| 155 | 3300049593 | Ga0501077_0029326 | Ga0501077_0029326_1109_2242 | 362 |
| 156 | 3300049741 | Ga0501079_0038721 | Ga0501079_0038721_381_1514 | 362 |
| 157 | 3300049742 | Ga0501080_0011233 | Ga0501080_0011233_4171_5304 | 362 |
| 158 | 3300049743 | Ga0501081_0020139 | Ga0501081_0020139_1823_2956 | 362 |
| 159 | 3300049822 | Ga0501035_0059807 | Ga0501035_0059807_17_1150 | 362 |
| 160 | 3300049823 | Ga0501044_0043467 | Ga0501044_0043467_3161_4294 | 362 |
| 161 | 3300049824 | Ga0501045_0009418 | Ga0501045_0009418_1088_2221 | 362 |
| 162 | 3300053085 | Ga0495619_0062461 | Ga0495619_0062461_510_1661 | 362 |
| 163 | 3300054114 | Ga0501084_0016506 | Ga0501084_0016506_611_1744 | 362 |
| 164 | 3300060353 | Ga0501082_0005404 | Ga0501082_0005404_1965_3098 | 362 |
| 165 | 3300061734 | Ga0530510_0006564 | Ga0530510_0006564_3586_4719 | 362 |
| 166 | 3300005347 | Ga0070668_100002947 | Ga0070668_1000029476 | 363 |
| 167 | 3300005367 | Ga0070667_100002992 | Ga0070667_1000029924 | 363 |
| 168 | 3300005548 | Ga0070665_100054350 | Ga0070665_1000543502 | 363 |
| 169 | 3300005844 | Ga0068862_100000391 | Ga0068862_10000039114 | 363 |
| 170 | 3300009553 | Ga0105249_10073501 | Ga0105249_100735012 | 363 |
| 171 | 3300013105 | Ga0157369_10361792 | Ga0157369_103617922 | 363 |
| 172 | 3300014326 | Ga0157380_10000024 | Ga0157380_1000002413 | 363 |
| 173 | 3300020080 | Ga0206350_11301258 | Ga0206350_113012582 | 363 |
| 174 | 3300025931 | Ga0207644_10071585 | Ga0207644_100715851 | 363 |
| 175 | 3300025933 | Ga0207706_10073832 | Ga0207706_100738323 | 363 |
| 176 | 3300025961 | Ga0207712_10008190 | Ga0207712_100081902 | 363 |
| 177 | 3300025972 | Ga0207668_10002710 | Ga0207668_100027105 | 363 |
| 178 | 3300025986 | Ga0207658_10001012 | Ga0207658_100010124 | 363 |
| 179 | 3300028379 | Ga0268266_10032922 | Ga0268266_100329223 | 363 |
| 180 | 3300028380 | Ga0268265_10000440 | Ga0268265_1000044033 | 363 |
| 181 | 3300046459 | Ga0495629_0001046 | Ga0495629_0001046_16290_17456 | 363 |
| 182 | 3300025942 | Ga0207689_10086973 | Ga0207689_100869732 | 364 |
| 183 | 3300048908 | Ga0496105_0027534 | Ga0496105_0027534_2902_4062 | 364 |
| 184 | 3300048922 | Ga0496119_0005514 | Ga0496119_0005514_6204_7364 | 364 |
| 185 | 3300048924 | Ga0496121_0031897 | Ga0496121_0031897_938_2098 | 364 |
| 186 | 3300048928 | Ga0496125_0033667 | Ga0496125_0033667_1982_3142 | 364 |
| 187 | 3300005329 | Ga0070683_100041185 | Ga0070683_1000411852 | 365 |
| 188 | 3300020077 | Ga0206351_10029283 | Ga0206351_100292832 | 365 |
| 189 | 3300020610 | Ga0154015_1287331 | Ga0154015_12873312 | 365 |
| 190 | 3300026023 | Ga0207677_10193462 | Ga0207677_101934622 | 365 |
| 191 | 3300053083 | Ga0495655_0000406 | Ga0495655_0000406_16_1200 | 365 |
| 192 | 3300005329 | Ga0070683_100036163 | Ga0070683_1000361633 | 366 |
| 193 | 3300005335 | Ga0070666_10007530 | Ga0070666_100075301 | 366 |
| 194 | 3300005548 | Ga0070665_100007269 | Ga0070665_1000072692 | 366 |
| 195 | 3300009101 | Ga0105247_10092397 | Ga0105247_100923972 | 366 |
| 196 | 3300028379 | Ga0268266_10000664 | Ga0268266_100006642 | 366 |
| 197 | 3300030521 | Ga0307511_10065907 | Ga0307511_100659072 | 366 |
| 198 | 3300037471 | Ga0395905_0132661 | Ga0395905_0132661_345_1478 | 366 |
| 199 | 3300047317 | Ga0495604_0000513 | Ga0495604_0000513_23519_24679 | 366 |
| 200 | 3300048927 | Ga0496124_0017478 | Ga0496124_0017478_4332_5483 | 366 |
| 201 | 3300048929 | Ga0496126_0064007 | Ga0496126_0064007_637_1788 | 366 |
| 202 | 3300013104 | Ga0157370_10032556 | Ga0157370_100325563 | 367 |
| 203 | 3300025927 | Ga0207687_10000350 | Ga0207687_100003506 | 367 |
| 204 | 3300048929 | Ga0496126_0028027 | Ga0496126_0028027_2210_3316 | 367 |
| 205 | 3300005329 | Ga0070683_100029574 | Ga0070683_1000295744 | 368 |
| 206 | 3300005937 | Ga0081455_10096845 | Ga0081455_100968451 | 368 |
| 207 | 3300009098 | Ga0105245_10002031 | Ga0105245_100020317 | 368 |
| 208 | 3300026023 | Ga0207677_10151639 | Ga0207677_101516392 | 368 |
| 209 | 3300048909 | Ga0496106_0055028 | Ga0496106_0055028_1087_2268 | 368 |
| 210 | 3300048911 | Ga0496108_0002372 | Ga0496108_0002372_10939_12120 | 368 |
| 211 | 3300048912 | Ga0496109_0007413 | Ga0496109_0007413_5419_6600 | 368 |
| 212 | 3300048913 | Ga0496110_0000112 | Ga0496110_0000112_5162_6343 | 368 |
| 213 | 3300048914 | Ga0496111_0000091 | Ga0496111_0000091_29230_30411 | 368 |
| 214 | 3300048916 | Ga0496113_0126772 | Ga0496113_0126772_193_1374 | 368 |
| 215 | 3300005339 | Ga0070660_100142946 | Ga0070660_1001429461 | 369 |
| 216 | 3300026121 | Ga0207683_10037429 | Ga0207683_100374292 | 369 |
| 217 | 3300035121 | Ga0373960_0015284 | Ga0373960_0015284_299_1480 | 369 |
| 218 | 3300004801 | Ga0058860_12198597 | Ga0058860_121985971 | 370 |
| 219 | 3300005340 | Ga0070689_100247790 | Ga0070689_1002477902 | 370 |
| 220 | 3300005345 | Ga0070692_10057853 | Ga0070692_100578532 | 370 |
| 221 | 3300006844 | Ga0075428_100005004 | Ga0075428_1000050043 | 370 |
| 222 | 3300009094 | Ga0111539_10002146 | Ga0111539_100021464 | 370 |
| 223 | 3300025908 | Ga0207643_10007579 | Ga0207643_100075794 | 370 |
| 224 | 3300025941 | Ga0207711_10105332 | Ga0207711_101053322 | 370 |
| 225 | 3300026116 | Ga0207674_10020515 | Ga0207674_100205153 | 370 |
| 226 | 3300027907 | Ga0207428_10021489 | Ga0207428_100214894 | 370 |
| 227 | 3300044765 | Ga0466970_0006903 | Ga0466970_0006903_3274_4524 | 370 |
| 228 | 3300046648 | Ga0495611_0077027 | Ga0495611_0077027_20_1204 | 370 |
| 229 | 3300046664 | Ga0495659_0034936 | Ga0495659_0034936_196_1377 | 370 |
| 230 | 3300047447 | Ga0495685_006311 | Ga0495685_006311_2048_3295 | 370 |
| 231 | 3300048918 | Ga0496115_0225221 | Ga0496115_0225221_48_1259 | 370 |
| 232 | 3300050511 | nmdc:mga08y16_27106_c1 | nmdc:mga08y16_27106_c1_3495_4676 | 370 |
| 233 | 3300053083 | Ga0495655_0002744 | Ga0495655_0002744_169_1350 | 370 |
| 234 | 3300005328 | Ga0070676_10091013 | Ga0070676_100910132 | 371 |
| 235 | 3300005334 | Ga0068869_100124369 | Ga0068869_1001243692 | 371 |
| 236 | 3300005344 | Ga0070661_100037882 | Ga0070661_1000378821 | 371 |
| 237 | 3300005466 | Ga0070685_10130444 | Ga0070685_101304442 | 371 |
| 238 | 3300005543 | Ga0070672_100070841 | Ga0070672_1000708412 | 371 |
| 239 | 3300005544 | Ga0070686_100032182 | Ga0070686_1000321822 | 371 |
| 240 | 3300005547 | Ga0070693_100207352 | Ga0070693_1002073521 | 371 |
| 241 | 3300005617 | Ga0068859_100101456 | Ga0068859_1001014562 | 371 |
| 242 | 3300005842 | Ga0068858_100123240 | Ga0068858_1001232403 | 371 |
| 243 | 3300005985 | Ga0081539_10000294 | Ga0081539_1000029446 | 371 |
| 244 | 3300006058 | Ga0075432_10017879 | Ga0075432_100178792 | 371 |
| 245 | 3300006852 | Ga0075433_10133747 | Ga0075433_101337472 | 371 |
| 246 | 3300006931 | Ga0097620_100101458 | Ga0097620_1001014582 | 371 |
| 247 | 3300009094 | Ga0111539_10233854 | Ga0111539_102338542 | 371 |
| 248 | 3300013308 | Ga0157375_10129642 | Ga0157375_101296422 | 371 |
| 249 | 3300025940 | Ga0207691_10043075 | Ga0207691_100430754 | 371 |
| 250 | 3300025945 | Ga0207679_10086996 | Ga0207679_100869962 | 371 |
| 251 | 3300035121 | Ga0373960_0005121 | Ga0373960_0005121_1432_2562 | 371 |
| 252 | 3300035691 | Ga0373931_0072610 | Ga0373931_0072610_57_1187 | 371 |
| 253 | 3300044658 | Ga0466972_0033546 | Ga0466972_0033546_518_1765 | 371 |
| 254 | 3300044684 | Ga0466966_0002457 | Ga0466966_0002457_6461_7708 | 371 |
| 255 | 3300044693 | Ga0466961_0005711 | Ga0466961_0005711_2221_3468 | 371 |
| 256 | 3300045976 | Ga0466967_0036899 | Ga0466967_0036899_2113_3240 | 371 |
| 257 | 3300046500 | Ga0495596_0008034 | Ga0495596_0008034_3306_4430 | 371 |
| 258 | 3300050511 | nmdc:mga08y16_255674_c1 | nmdc:mga08y16_255674_c1_336_1466 | 371 |
| 259 | 3300050512 | nmdc:mga0n895_162040_c1 | nmdc:mga0n895_162040_c1_915_2045 | 371 |
| 260 | 3300050515 | nmdc:mga0a205_123911_c1 | nmdc:mga0a205_123911_c1_692_1822 | 371 |
| 261 | 3300053142 | Ga0500577_0042237 | Ga0500577_0042237_157_1275 | 371 |
| 262 | iso_pu_bacteria | 3006393351 | 3006397946 | 371 |
| 263 | 3300005347 | Ga0070668_100007037 | Ga0070668_10000703710 | 372 |
| 264 | 3300005457 | Ga0070662_100118357 | Ga0070662_1001183572 | 372 |
| 265 | 3300005577 | Ga0068857_100001044 | Ga0068857_10000104416 | 372 |
| 266 | 3300005719 | Ga0068861_100159686 | Ga0068861_1001596862 | 372 |
| 267 | 3300006844 | Ga0075428_100149052 | Ga0075428_1001490522 | 372 |
| 268 | 3300006844 | Ga0075428_100149773 | Ga0075428_1001497733 | 372 |
| 269 | 3300009094 | Ga0111539_10001342 | Ga0111539_100013429 | 372 |
| 270 | 3300009094 | Ga0111539_10120234 | Ga0111539_101202342 | 372 |
| 271 | 3300009098 | Ga0105245_10169192 | Ga0105245_101691922 | 372 |
| 272 | 3300009553 | Ga0105249_10018644 | Ga0105249_100186443 | 372 |
| 273 | 3300010375 | Ga0105239_10229631 | Ga0105239_102296312 | 372 |
| 274 | 3300011119 | Ga0105246_10041556 | Ga0105246_100415564 | 372 |
| 275 | 3300013306 | Ga0163162_10036994 | Ga0163162_100369944 | 372 |
| 276 | 3300017792 | Ga0163161_10073856 | Ga0163161_100738562 | 372 |
| 277 | 3300025901 | Ga0207688_10074080 | Ga0207688_100740802 | 372 |
| 278 | 3300025927 | Ga0207687_10141629 | Ga0207687_101416292 | 372 |
| 279 | 3300025933 | Ga0207706_10050046 | Ga0207706_100500462 | 372 |
| 280 | 3300026116 | Ga0207674_10000156 | Ga0207674_1000015612 | 372 |
| 281 | 3300027907 | Ga0207428_10010741 | Ga0207428_1001074110 | 372 |
| 282 | 3300027907 | Ga0207428_10204093 | Ga0207428_102040932 | 372 |
| 283 | 3300037466 | Ga0395898_0058489 | Ga0395898_0058489_1672_2919 | 372 |
| 284 | 3300045976 | Ga0466967_0000008 | Ga0466967_0000008_54486_55646 | 372 |
| 285 | 3300049581 | Ga0501047_0073476 | Ga0501047_0073476_1977_3224 | 372 |
| 286 | 3300050507 | nmdc:mga05p37_39682_c1 | nmdc:mga05p37_39682_c1_4375_5511 | 372 |
| 287 | 3300050510 | nmdc:mga06r32_290204_c1 | nmdc:mga06r32_290204_c1_43_1176 | 372 |
| 288 | 3300003322 | rootL2_10071172 | rootL2_100711722 | 373 |
| 289 | 3300006163 | Ga0070715_10000003 | Ga0070715_1000000322 | 373 |
| 290 | 3300025905 | Ga0207685_10000003 | Ga0207685_1000000322 | 373 |
| 291 | 3300048910 | Ga0496107_0055918 | Ga0496107_0055918_475_1629 | 373 |
| 292 | 3300005329 | Ga0070683_100062833 | Ga0070683_1000628332 | 374 |
| 293 | 3300005347 | Ga0070668_100060950 | Ga0070668_1000609502 | 374 |
| 294 | 3300005456 | Ga0070678_100272445 | Ga0070678_1002724451 | 374 |
| 295 | 3300005544 | Ga0070686_100105005 | Ga0070686_1001050052 | 374 |
| 296 | 3300009094 | Ga0111539_10086978 | Ga0111539_100869782 | 374 |
| 297 | 3300009098 | Ga0105245_10055296 | Ga0105245_100552964 | 374 |
| 298 | 3300013308 | Ga0157375_10086906 | Ga0157375_100869062 | 374 |
| 299 | 3300014745 | Ga0157377_10087637 | Ga0157377_100876372 | 374 |
| 300 | 3300025899 | Ga0207642_10012027 | Ga0207642_100120273 | 374 |
| 301 | 3300025937 | Ga0207669_10031304 | Ga0207669_100313042 | 374 |
| 302 | 3300025961 | Ga0207712_10166793 | Ga0207712_101667932 | 374 |
| 303 | 3300025972 | Ga0207668_10043248 | Ga0207668_100432482 | 374 |
| 304 | 3300026089 | Ga0207648_10026752 | Ga0207648_100267522 | 374 |
| 305 | 3300028380 | Ga0268265_10075616 | Ga0268265_100756162 | 374 |
| 306 | 3300048904 | Ga0496101_0006280 | Ga0496101_0006280_1373_2599 | 374 |
| 307 | 3300048905 | Ga0496102_0139047 | Ga0496102_0139047_414_1640 | 374 |
| 308 | 3300048907 | Ga0496104_0020972 | Ga0496104_0020972_4101_5324 | 374 |
| 309 | 3300048909 | Ga0496106_0022722 | Ga0496106_0022722_2346_3572 | 374 |
| 310 | 3300048910 | Ga0496107_0008800 | Ga0496107_0008800_926_2152 | 374 |
| 311 | 3300048911 | Ga0496108_0009918 | Ga0496108_0009918_4806_6029 | 374 |
| 312 | 3300048917 | Ga0496114_0022858 | Ga0496114_0022858_1499_2725 | 374 |
| 313 | 3300031901 | Ga0307406_10028815 | Ga0307406_100288152 | 375 |
| 314 | 3300049823 | Ga0501044_0000883 | Ga0501044_0000883_32093_33220 | 375 |
| 315 | 3300005435 | Ga0070714_100114737 | Ga0070714_1001147372 | 376 |
| 316 | 3300010375 | Ga0105239_10051572 | Ga0105239_100515722 | 376 |
| 317 | 3300025929 | Ga0207664_10044349 | Ga0207664_100443493 | 376 |
| 318 | 3300031731 | Ga0307405_10015809 | Ga0307405_100158094 | 376 |
| 319 | 3300031995 | Ga0307409_100011102 | Ga0307409_1000111023 | 376 |
| 320 | 3300032002 | Ga0307416_100000623 | Ga0307416_10000062311 | 376 |
| 321 | 3300032126 | Ga0307415_100000256 | Ga0307415_10000025614 | 376 |
| 322 | 3300037471 | Ga0395905_0070489 | Ga0395905_0070489_1579_2766 | 376 |
| 323 | 3300005549 | Ga0070704_100072001 | Ga0070704_1000720012 | 378 |
| 324 | 3300053119 | Ga0500595_014819 | Ga0500595_014819_934_2109 | 378 |
| 325 | iso_pu_bacteria | 2954701450 | 2954709718 | 378 |
| 326 | 3300005834 | Ga0068851_10002118 | Ga0068851_100021184 | 380 |
| 327 | 3300044901 | Ga0466960_0081839 | Ga0466960_0081839_300_1508 | 380 |
| 328 | 3300046476 | Ga0495662_0003818 | Ga0495662_0003818_507_1808 | 380 |
| 329 | 3300046689 | Ga0495613_0017363 | Ga0495613_0017363_3844_5091 | 380 |
| 330 | 3300037312 | Ga0395899_0002021 | Ga0395899_0002021_13173_14360 | 381 |
| 331 | 3300037312 | Ga0395899_0007160 | Ga0395899_0007160_2353_3567 | 381 |
| 332 | 3300037418 | Ga0395900_0007778 | Ga0395900_0007778_8887_10101 | 381 |
| 333 | 3300037418 | Ga0395900_0045971 | Ga0395900_0045971_3097_4284 | 381 |
| 334 | 3300037466 | Ga0395898_0004136 | Ga0395898_0004136_9191_10405 | 381 |
| 335 | 3300037471 | Ga0395905_0018273 | Ga0395905_0018273_4366_5580 | 381 |
| 336 | 3300037471 | Ga0395905_0057557 | Ga0395905_0057557_969_2156 | 381 |
| 337 | 3300038443 | Ga0395901_0011756 | Ga0395901_0011756_5332_6519 | 381 |
| 338 | 3300038443 | Ga0395901_0060217 | Ga0395901_0060217_2221_3435 | 381 |
| 339 | 3300048089 | Ga0495614_0050741 | Ga0495614_0050741_13_1161 | 382 |
| 340 | 3300053153 | Ga0500616_0002119 | Ga0500616_0002119_6692_7900 | 382 |
| 341 | 3300006847 | Ga0075431_100149555 | Ga0075431_1001495553 | 383 |
| 342 | 3300037466 | Ga0395898_0129837 | Ga0395898_0129837_886_2082 | 383 |
| 343 | 3300041404 | Ga0439436_0013029 | Ga0439436_0013029_98_1345 | 383 |
| 344 | 3300041999 | Ga0439433_0000942 | Ga0439433_0000942_3896_5143 | 383 |
| 345 | 3300042007 | Ga0439449_0011276 | Ga0439449_0011276_1447_2694 | 383 |
| 346 | 3300042014 | Ga0439457_000238 | Ga0439457_000238_10572_11819 | 383 |
| 347 | 3300046476 | Ga0495662_0052918 | Ga0495662_0052918_681_1928 | 383 |
| 348 | 3300003203 | JGI25406J46586_10001018 | JGI25406J46586_100010182 | 384 |
| 349 | 3300005985 | Ga0081539_10000204 | Ga0081539_1000020436 | 384 |
| 350 | 3300031456 | Ga0307513_10122676 | Ga0307513_101226762 | 384 |
| 351 | 3300005937 | Ga0081455_10017265 | Ga0081455_100172652 | 386 |
| 352 | 3300031548 | Ga0307408_100049093 | Ga0307408_1000490933 | 386 |
| 353 | 3300031731 | Ga0307405_10002494 | Ga0307405_100024944 | 386 |
| 354 | 3300031901 | Ga0307406_10032918 | Ga0307406_100329183 | 386 |
| 355 | 3300031903 | Ga0307407_10010899 | Ga0307407_100108994 | 386 |
| 356 | 3300031995 | Ga0307409_100014187 | Ga0307409_1000141873 | 386 |
| 357 | 3300032002 | Ga0307416_100004246 | Ga0307416_1000042467 | 386 |
| 358 | 3300032005 | Ga0307411_10004616 | Ga0307411_100046164 | 386 |
| 359 | 3300032126 | Ga0307415_100002785 | Ga0307415_1000027854 | 386 |
| 360 | 3300037471 | Ga0395905_0281452 | Ga0395905_0281452_80_1267 | 386 |
| 361 | 3300049583 | Ga0501067_0007041 | Ga0501067_0007041_4321_5502 | 387 |
| 362 | 3300049584 | Ga0501068_0005826 | Ga0501068_0005826_2314_3495 | 387 |
| 363 | iso_pu_bacteria | 2791354901 | 2791915523 | 387 |
| 364 | 3300053092 | Ga0500583_0091442 | Ga0500583_0091442_43_1209 | 388 |
| 365 | iso_pu_bacteria | 2622736626 | 2623586726 | 389 |
| 366 | iso_pu_bacteria | 2929226422 | 2929227427 | 389 |
| 367 | 3300031995 | Ga0307409_100303677 | Ga0307409_1003036772 | 390 |
| 368 | 3300014497 | Ga0182008_10006184 | Ga0182008_100061844 | 394 |
| 369 | 3300015262 | Ga0182007_10011226 | Ga0182007_100112263 | 394 |
| 370 | 3300025297 | Ga0209758_1004580 | Ga0209758_10045808 | 394 |
| 371 | 3300030522 | Ga0307512_10007323 | Ga0307512_100073239 | 394 |
| 372 | 3300033179 | Ga0307507_10069397 | Ga0307507_100693972 | 394 |
| 373 | 3300049568 | Ga0501031_0091605 | Ga0501031_0091605_513_1760 | 394 |
| 374 | 3300049571 | Ga0501034_0015605 | Ga0501034_0015605_1199_2446 | 394 |
| 375 | 3300049571 | Ga0501034_0021166 | Ga0501034_0021166_1784_3004 | 394 |
| 376 | 3300049574 | Ga0501038_0009078 | Ga0501038_0009078_1276_2523 | 394 |
| 377 | 3300049579 | Ga0501043_0070296 | Ga0501043_0070296_1038_2285 | 394 |
| 378 | 3300049572 | Ga0501036_0034077 | Ga0501036_0034077_85_1332 | 395 |
| 379 | 3300044658 | Ga0466972_0032099 | Ga0466972_0032099_323_1570 | 396 |
| 380 | 3300006846 | Ga0075430_100191476 | Ga0075430_1001914762 | 397 |
| 381 | 3300046499 | Ga0495594_0011901 | Ga0495594_0011901_2605_3834 | 397 |
| 382 | 3300049570 | Ga0501033_0000872 | Ga0501033_0000872_22362_23609 | 398 |
| 383 | 3300006846 | Ga0075430_100012865 | Ga0075430_1000128655 | 399 |
| 384 | 3300006847 | Ga0075431_100042635 | Ga0075431_1000426352 | 399 |
| 385 | 3300009147 | Ga0114129_10038933 | Ga0114129_100389332 | 399 |
| 386 | 3300046471 | Ga0495650_0000398 | Ga0495650_0000398_21233_22450 | 399 |
| 387 | 3300050508 | nmdc:mga09592_2418_c1 | nmdc:mga09592_2418_c1_5281_6516 | 399 |
| 388 | 3300050509 | nmdc:mga0qj67_9140_c1 | nmdc:mga0qj67_9140_c1_3556_4791 | 399 |
| 389 | iso_pu_bacteria | 2675903059 | 2676480386 | 399 |
| 390 | 3300044658 | Ga0466972_0056308 | Ga0466972_0056308_189_1436 | 401 |
| 391 | 3300044901 | Ga0466960_0000033 | Ga0466960_0000033_20257_21483 | 401 |
| 392 | 3300003316 | rootH1_10010547 | rootH1_100105472 | 404 |
| 393 | 3300003320 | rootH2_10033896 | rootH2_100338963 | 404 |
| 394 | 3300042007 | Ga0439449_0001531 | Ga0439449_0001531_5103_6350 | 405 |
| 395 | 3300046616 | Ga0495668_0000182 | Ga0495668_0000182_66703_67941 | 406 |
| 396 | 3300046660 | Ga0495625_0000464 | Ga0495625_0000464_56332_57570 | 406 |
| 397 | 3300047323 | Ga0495683_0054700 | Ga0495683_0054700_165_1403 | 406 |
| 398 | 3300048091 | Ga0495626_0000286 | Ga0495626_0000286_9435_10673 | 406 |
| 399 | 3300028786 | Ga0307517_10027373 | Ga0307517_100273735 | 407 |
| 400 | 3300028794 | Ga0307515_10004249 | Ga0307515_100042493 | 407 |
| 401 | 3300033179 | Ga0307507_10038524 | Ga0307507_100385244 | 407 |
| 402 | 3300044735 | Ga0466968_0024133 | Ga0466968_0024133_419_1666 | 407 |
| 403 | 3300046459 | Ga0495629_0044283 | Ga0495629_0044283_650_1897 | 407 |
| 404 | 3300046660 | Ga0495625_0026014 | Ga0495625_0026014_811_2058 | 407 |
| 405 | 3300046674 | Ga0495588_0006065 | Ga0495588_0006065_2511_3758 | 407 |
| 406 | 3300047470 | Ga0495681_0001153 | Ga0495681_0001153_16458_17705 | 407 |
| 407 | 3300053107 | Ga0500560_001057 | Ga0500560_001057_670_1917 | 407 |
| 408 | 3300042006 | Ga0439432_045951 | Ga0439432_045951_24_1274 | 408 |
| 409 | 3300042156 | Ga0439446_0002277 | Ga0439446_0002277_3257_4507 | 408 |
| 410 | 3300006042 | Ga0075368_10009675 | Ga0075368_100096752 | 410 |
| 411 | 3300006178 | Ga0075367_10061654 | Ga0075367_100616542 | 410 |
| 412 | 3300027866 | Ga0209813_10004237 | Ga0209813_100042372 | 410 |
| 413 | 3300044656 | Ga0466969_0026698 | Ga0466969_0026698_324_1571 | 410 |
| 414 | 3300044658 | Ga0466972_0039606 | Ga0466972_0039606_706_1953 | 410 |
| 415 | 3300044683 | Ga0466965_0005551 | Ga0466965_0005551_1615_2862 | 410 |
| 416 | 3300044684 | Ga0466966_0002355 | Ga0466966_0002355_10568_11815 | 410 |
| 417 | 3300044693 | Ga0466961_0044320 | Ga0466961_0044320_822_2069 | 410 |
| 418 | 3300044694 | Ga0466963_0000405 | Ga0466963_0000405_12465_13712 | 410 |
| 419 | 3300044765 | Ga0466970_0004138 | Ga0466970_0004138_936_2183 | 410 |
| 420 | 3300044842 | Ga0466957_0001317 | Ga0466957_0001317_6820_8067 | 410 |
| 421 | 3300045049 | Ga0466959_0069492 | Ga0466959_0069492_527_1774 | 410 |
| 422 | 3300045836 | Ga0466958_0005655 | Ga0466958_0005655_2984_4231 | 410 |
| 423 | 3300050494 | nmdc:mga06z11_21149_c1 | nmdc:mga06z11_21149_c1_491_1738 | 410 |
| 424 | 3300050495 | nmdc:mga04h51_4600_c1 | nmdc:mga04h51_4600_c1_251_1498 | 410 |
| 425 | 3300061719 | Ga0466962_0001787 | Ga0466962_0001787_1653_2900 | 410 |
| 426 | iso_pu_bacteria | 2802429296 | 2804848199 | 410 |
| 427 | iso_pu_bacteria | 2862382967 | 2862392411 | 410 |
| 428 | iso_pu_bacteria | 2912715099 | 2912717310 | 410 |
| 429 | iso_pu_bacteria | 8008558824 | 8008563090 | 410 |
| 430 | iso_pu_bacteria | 8025413630 | 8025414238 | 410 |
| 431 | iso_pu_bacteria | 8048406513 | 8048409819 | 410 |
| 432 | 3300031649 | Ga0307514_10069054 | Ga0307514_100690543 | 411 |
| 433 | 3300031730 | Ga0307516_10096302 | Ga0307516_100963021 | 411 |
| 434 | 3300033180 | Ga0307510_10010376 | Ga0307510_100103763 | 411 |
| 435 | 3300049570 | Ga0501033_0001082 | Ga0501033_0001082_19694_20929 | 411 |
| 436 | 3300049571 | Ga0501034_0001218 | Ga0501034_0001218_3844_5079 | 411 |
| 437 | 3300049572 | Ga0501036_0000189 | Ga0501036_0000189_21773_23008 | 411 |
| 438 | 3300049575 | Ga0501039_0017828 | Ga0501039_0017828_2241_3476 | 411 |
| 439 | 3300049579 | Ga0501043_0000373 | Ga0501043_0000373_13260_14495 | 411 |
| 440 | 3300049586 | Ga0501070_0001778 | Ga0501070_0001778_3844_5079 | 411 |
| 441 | 3300049590 | Ga0501074_0003673 | Ga0501074_0003673_1596_2831 | 411 |
| 442 | 3300049822 | Ga0501035_0000934 | Ga0501035_0000934_17901_19136 | 411 |
| 443 | iso_pu_bacteria | 2547132111 | 2547410605 | 411 |
| 444 | iso_pu_bacteria | 2582581313 | 2585307813 | 411 |
| 445 | iso_pu_bacteria | 2616644814 | 2616700076 | 411 |
| 446 | iso_pu_bacteria | 2643221587 | 2643943701 | 411 |
| 447 | iso_pu_bacteria | 2643221647 | 2644269623 | 411 |
| 448 | iso_pu_bacteria | 2643221678 | 2644437737 | 411 |
| 449 | iso_pu_bacteria | 2643221714 | 2644629875 | 411 |
| 450 | iso_pu_bacteria | 2784132148 | 2784590668 | 411 |
| 451 | iso_pu_bacteria | 2784746768 | 2785371838 | 411 |
| 452 | iso_pu_bacteria | 2786546132 | 2786672951 | 411 |
| 453 | iso_pu_bacteria | 2808606359 | 2808844340 | 411 |
| 454 | iso_pu_bacteria | 2808606375 | 2808913918 | 411 |
| 455 | iso_pu_bacteria | 2808606448 | 2809234356 | 411 |
| 456 | iso_pu_bacteria | 2811994879 | 2812355652 | 411 |
| 457 | iso_pu_bacteria | 2818991463 | 2819698918 | 411 |
| 458 | iso_pu_bacteria | 2852635781 | 2852639753 | 411 |
| 459 | iso_pu_bacteria | 2862281513 | 2862284306 | 411 |
| 460 | iso_pu_bacteria | 2862290372 | 2862290786 | 411 |
| 461 | iso_pu_bacteria | 2862507626 | 2862514309 | 411 |
| 462 | iso_pu_bacteria | 2862574272 | 2862577197 | 411 |
| 463 | iso_pu_bacteria | 2867428634 | 2867434240 | 411 |
| 464 | iso_pu_bacteria | 2875391855 | 2875397016 | 411 |
| 465 | iso_pu_bacteria | 2877676314 | 2877678743 | 411 |
| 466 | iso_pu_bacteria | 2912723979 | 2912729877 | 411 |
| 467 | iso_pu_bacteria | 2912757875 | 2912763075 | 411 |
| 468 | iso_pu_bacteria | 2918501144 | 2918506809 | 411 |
| 469 | iso_pu_bacteria | 2919468124 | 2919472526 | 411 |
| 470 | iso_pu_bacteria | 2946072368 | 2946078017 | 411 |
| 471 | iso_pu_bacteria | 2947224130 | 2947226655 | 411 |
| 472 | iso_pu_bacteria | 2954002825 | 2954005826 | 411 |
| 473 | iso_pu_bacteria | 2954380949 | 2954383714 | 411 |
| 474 | iso_pu_bacteria | 2954673503 | 2954679259 | 411 |
| 475 | iso_pu_bacteria | 2954682443 | 2954684895 | 411 |
| 476 | iso_pu_bacteria | 2954691527 | 2954694514 | 411 |
| 477 | iso_pu_bacteria | 2954711539 | 2954714006 | 411 |
| 478 | iso_pu_bacteria | 2954721474 | 2954723975 | 411 |
| 479 | iso_pu_bacteria | 2954731030 | 2954737865 | 411 |
| 480 | iso_pu_bacteria | 2954740390 | 2954742872 | 411 |
| 481 | iso_pu_bacteria | 2954749733 | 2954756717 | 411 |
| 482 | iso_pu_bacteria | 2954759201 | 2954761829 | 411 |
| 483 | iso_pu_bacteria | 2966598605 | 2966600577 | 411 |
| 484 | iso_pu_bacteria | 2997451912 | 2997453139 | 411 |
| 485 | iso_pu_bacteria | 3006493962 | 3006500006 | 411 |
| 486 | iso_pu_bacteria | 8008574985 | 8008576864 | 411 |
| 487 | iso_pu_bacteria | 8023623736 | 8023625684 | 411 |
| 488 | iso_pu_bacteria | 8025530807 | 8025532692 | 411 |
| 489 | iso_pu_bacteria | 8054160619 | 8054163137 | 411 |
| 490 | 3300031456 | Ga0307513_10027362 | Ga0307513_100273625 | 412 |
| 491 | iso_pu_bacteria | 2997600082 | 2997604039 | 412 |
| 492 | iso_pu_bacteria | 8056829672 | 8056831620 | 413 |
| 493 | 3300003354 | JGI25160J50197_1012981 | JGI25160J50197_10129812 | 414 |
| 494 | 3300025302 | Ga0207426_1018696 | Ga0207426_10186962 | 414 |
| 495 | 3300028794 | Ga0307515_10081143 | Ga0307515_100811433 | 414 |
| 496 | 3300053149 | Ga0500600_0064233 | Ga0500600_0064233_149_1393 | 414 |
| 497 | 3300001989 | JGI24739J22299_10016582 | JGI24739J22299_100165822 | 415 |
| 498 | 3300002067 | JGI24735J21928_10021419 | JGI24735J21928_100214192 | 415 |
| 499 | 3300002075 | JGI24738J21930_10011357 | JGI24738J21930_100113571 | 415 |
| 500 | 3300003316 | rootH1_10033378 | rootH1_100333782 | 415 |
| 501 | 3300006948 | Ga0099826_10020921 | Ga0099826_100209215 | 415 |
| 502 | 3300009011 | Ga0105251_10005290 | Ga0105251_100052906 | 415 |
| 503 | 3300009036 | Ga0105244_10088123 | Ga0105244_100881231 | 415 |
| 504 | 3300009148 | Ga0105243_10249498 | Ga0105243_102494982 | 415 |
| 505 | 3300011119 | Ga0105246_10019404 | Ga0105246_100194042 | 415 |
| 506 | 3300013105 | Ga0157369_10048428 | Ga0157369_100484282 | 415 |
| 507 | 3300015688 | Ga0183367_1013 | Ga0183367_101362 | 415 |
| 508 | 3300025735 | Ga0207713_1016850 | Ga0207713_10168502 | 415 |
| 509 | 3300025904 | Ga0207647_10009632 | Ga0207647_100096323 | 415 |
| 510 | 3300027312 | Ga0209371_1009618 | Ga0209371_10096182 | 415 |
| 511 | 3300030500 | Ga0268256_1008087 | Ga0268256_10080873 | 415 |
| 512 | 3300030521 | Ga0307511_10000330 | Ga0307511_100003303 | 415 |
| 513 | 3300031456 | Ga0307513_10122524 | Ga0307513_101225242 | 415 |
| 514 | 3300031507 | Ga0307509_10070928 | Ga0307509_100709282 | 415 |
| 515 | 3300031616 | Ga0307508_10021674 | Ga0307508_100216744 | 415 |
| 516 | 3300031838 | Ga0307518_10081976 | Ga0307518_100819762 | 415 |
| 517 | 3300033180 | Ga0307510_10052245 | Ga0307510_100522453 | 415 |
| 518 | 3300037418 | Ga0395900_0079332 | Ga0395900_0079332_348_1595 | 415 |
| 519 | 3300037466 | Ga0395898_0004392 | Ga0395898_0004392_9595_10842 | 415 |
| 520 | 3300042005 | Ga0439448_0007983 | Ga0439448_0007983_1349_2596 | 415 |
| 521 | 3300042134 | Ga0450898_001885 | Ga0450898_001885_1179_2426 | 415 |
| 522 | 3300042135 | Ga0450899_001520 | Ga0450899_001520_519_1766 | 415 |
| 523 | 3300042138 | Ga0450903_000229 | Ga0450903_000229_3142_4389 | 415 |
| 524 | 3300042145 | Ga0450906_002805 | Ga0450906_002805_2206_3453 | 415 |
| 525 | 3300042157 | Ga0439458_0000860 | Ga0439458_0000860_3630_4877 | 415 |
| 526 | 3300042184 | Ga0450908_003464 | Ga0450908_003464_1522_2769 | 415 |
| 527 | 3300044706 | Ga0466964_0022528 | Ga0466964_0022528_402_1649 | 415 |
| 528 | 3300046452 | Ga0495617_008934 | Ga0495617_008934_1501_2748 | 415 |
| 529 | 3300046453 | Ga0495627_034414 | Ga0495627_034414_170_1417 | 415 |
| 530 | 3300046454 | Ga0495592_0012929 | Ga0495592_0012929_4872_6119 | 415 |
| 531 | 3300046454 | Ga0495592_0137942 | Ga0495592_0137942_328_1575 | 415 |
| 532 | 3300046455 | Ga0495603_0004681 | Ga0495603_0004681_6100_7401 | 415 |
| 533 | 3300046455 | Ga0495603_0006825 | Ga0495603_0006825_5179_6480 | 415 |
| 534 | 3300046455 | Ga0495603_0047483 | Ga0495603_0047483_83_1330 | 415 |
| 535 | 3300046459 | Ga0495629_0090933 | Ga0495629_0090933_694_1941 | 415 |
| 536 | 3300046459 | Ga0495629_0109659 | Ga0495629_0109659_348_1595 | 415 |
| 537 | 3300046460 | Ga0495638_0121436 | Ga0495638_0121436_68_1315 | 415 |
| 538 | 3300046472 | Ga0495580_0062764 | Ga0495580_0062764_56_1303 | 415 |
| 539 | 3300046474 | Ga0495605_0022625 | Ga0495605_0022625_1910_3157 | 415 |
| 540 | 3300046476 | Ga0495662_0021537 | Ga0495662_0021537_1384_2631 | 415 |
| 541 | 3300046499 | Ga0495594_0043213 | Ga0495594_0043213_1140_2387 | 415 |
| 542 | 3300046501 | Ga0495607_0029476 | Ga0495607_0029476_1766_3013 | 415 |
| 543 | 3300046507 | Ga0495606_0005398 | Ga0495606_0005398_7701_8948 | 415 |
| 544 | 3300046511 | Ga0495608_0023731 | Ga0495608_0023731_1097_2344 | 415 |
| 545 | 3300046512 | Ga0495610_0062417 | Ga0495610_0062417_132_1379 | 415 |
| 546 | 3300046513 | Ga0495616_0005334 | Ga0495616_0005334_225_1472 | 415 |
| 547 | 3300046514 | Ga0495618_0037235 | Ga0495618_0037235_1292_2539 | 415 |
| 548 | 3300046516 | Ga0495628_0098249 | Ga0495628_0098249_225_1472 | 415 |
| 549 | 3300046516 | Ga0495628_0193393 | Ga0495628_0193393_61_1308 | 415 |
| 550 | 3300046518 | Ga0495631_0003400 | Ga0495631_0003400_360_1607 | 415 |
| 551 | 3300046519 | Ga0495632_0079597 | Ga0495632_0079597_142_1389 | 415 |
| 552 | 3300046520 | Ga0495637_0052442 | Ga0495637_0052442_24_1271 | 415 |
| 553 | 3300046522 | Ga0495643_0001191 | Ga0495643_0001191_4897_6144 | 415 |
| 554 | 3300046526 | Ga0495666_0008192 | Ga0495666_0008192_1083_2330 | 415 |
| 555 | 3300046529 | Ga0495652_0075499 | Ga0495652_0075499_139_1386 | 415 |
| 556 | 3300046533 | Ga0495640_0016024 | Ga0495640_0016024_2694_3941 | 415 |
| 557 | 3300046533 | Ga0495640_0131522 | Ga0495640_0131522_137_1384 | 415 |
| 558 | 3300046538 | Ga0495609_0040017 | Ga0495609_0040017_660_1907 | 415 |
| 559 | 3300046538 | Ga0495609_0044593 | Ga0495609_0044593_402_1649 | 415 |
| 560 | 3300046557 | Ga0495622_0008154 | Ga0495622_0008154_2885_4132 | 415 |
| 561 | 3300046558 | Ga0495633_0007953 | Ga0495633_0007953_4083_5330 | 415 |
| 562 | 3300046558 | Ga0495633_0034957 | Ga0495633_0034957_19_1266 | 415 |
| 563 | 3300046642 | Ga0495634_0011594 | Ga0495634_0011594_969_2216 | 415 |
| 564 | 3300046648 | Ga0495611_0036800 | Ga0495611_0036800_116_1363 | 415 |
| 565 | 3300046675 | Ga0495657_0077732 | Ga0495657_0077732_678_1925 | 415 |
| 566 | 3300046675 | Ga0495657_0090009 | Ga0495657_0090009_108_1355 | 415 |
| 567 | 3300046679 | Ga0495623_0086170 | Ga0495623_0086170_216_1463 | 415 |
| 568 | 3300046689 | Ga0495613_0094258 | Ga0495613_0094258_28_1275 | 415 |
| 569 | 3300046690 | Ga0495624_0027902 | Ga0495624_0027902_1462_2709 | 415 |
| 570 | 3300046691 | Ga0495670_0052499 | Ga0495670_0052499_31_1278 | 415 |
| 571 | 3300046794 | Ga0495589_0008202 | Ga0495589_0008202_150_1397 | 415 |
| 572 | 3300046794 | Ga0495589_0016235 | Ga0495589_0016235_1665_2912 | 415 |
| 573 | 3300047315 | Ga0495581_0013192 | Ga0495581_0013192_3130_4377 | 415 |
| 574 | 3300047317 | Ga0495604_0024466 | Ga0495604_0024466_1161_2408 | 415 |
| 575 | 3300047318 | Ga0495636_0004033 | Ga0495636_0004033_1273_2520 | 415 |
| 576 | 3300047318 | Ga0495636_0006112 | Ga0495636_0006112_3395_4642 | 415 |
| 577 | 3300047319 | Ga0495674_0164277 | Ga0495674_0164277_492_1739 | 415 |
| 578 | 3300047320 | Ga0495672_0043031 | Ga0495672_0043031_499_1746 | 415 |
| 579 | 3300047321 | Ga0495676_0030482 | Ga0495676_0030482_385_1632 | 415 |
| 580 | 3300047321 | Ga0495676_0036997 | Ga0495676_0036997_2508_3755 | 415 |
| 581 | 3300047321 | Ga0495676_0067798 | Ga0495676_0067798_399_1646 | 415 |
| 582 | 3300047322 | Ga0495680_0043182 | Ga0495680_0043182_2144_3391 | 415 |
| 583 | 3300047323 | Ga0495683_0035402 | Ga0495683_0035402_768_2015 | 415 |
| 584 | 3300047444 | Ga0495675_0011550 | Ga0495675_0011550_2342_3589 | 415 |
| 585 | 3300047447 | Ga0495685_007714 | Ga0495685_007714_1674_2921 | 415 |
| 586 | 3300047447 | Ga0495685_041360 | Ga0495685_041360_266_1513 | 415 |
| 587 | 3300048089 | Ga0495614_0043536 | Ga0495614_0043536_200_1447 | 415 |
| 588 | 3300048911 | Ga0496108_0048312 | Ga0496108_0048312_45_1292 | 415 |
| 589 | 3300048912 | Ga0496109_0200231 | Ga0496109_0200231_361_1608 | 415 |
| 590 | 3300049586 | Ga0501070_0142896 | Ga0501070_0142896_587_1834 | 415 |
| 591 | 3300049586 | Ga0501070_0188183 | Ga0501070_0188183_70_1317 | 415 |
| 592 | 3300050490 | nmdc:mga03n38_6903_c1 | nmdc:mga03n38_6903_c1_2247_3494 | 415 |
| 593 | 3300053088 | Ga0500644_0021429 | Ga0500644_0021429_389_1636 | 415 |
| 594 | iso_pu_bacteria | 2582581314 | 2585316791 | 415 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eqb-assembly2.cif.gz_B | 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes | 0.8969 | 74 | 412 |
| 4eqb-assembly2.cif.gz_B | 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes | 0.8814 | 74 | 412 |
| 2v84-assembly1.cif.gz_A | crystal structure of the tp0655 (tppotd) lipoprotein of treponema pallidum | 0.8575 | 76 | 415 |
| 4gl0-assembly1.cif.gz_A | putative spermidine/putrescine abc transporter from listeria monocytogenes | 0.8566 | 74 | 412 |
| 3ttk-assembly3.cif.gz_C | crystal structure of apo-spud | 0.8542 | 75 | 413 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ttnB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9232 | 77 | 378 | 3.40.190.10 |
| af_Q2G2A8_33_356_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9033 | 73 | 414 | 3.40.190.10 |
| 2v84A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8978 | 76 | 367 | 3.40.190.10 |
| af_Q2G2A8_33_356_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8955 | 73 | 414 | 3.40.190.10 |
| 3ttnB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8954 | 77 | 378 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K2ZPR5-F1-model_v4 | Extracellular solute-binding protein | 0.9733 | 69 | 415 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A1C4NP67-F1-model_v4 | deleted | 0.9692 | 237 | 415 |
|
| AF-A0A1C4NP67-F1-model_v4 | deleted | 0.964 | 237 | 415 |
|
| AF-A0A7V8YAI9-F1-model_v4 | Spermidine/putrescine ABC transporter substrate-binding protein | 0.9639 | 85 | 415 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A7K2ZPR5-F1-model_v4 | Extracellular solute-binding protein | 0.9623 | 69 | 415 |
GO:0015846
GO:0019808 GO:0042597 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar