F467316
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 594 | 312 | 583 | 376 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10022587|Ga0075366_100225872 |
| Length | 393 |
| Sequence | MTSATRPAPMNVAFEKPSLLQRVLPMFTGFDGPLLCAVLLLAGAGLVTMYSAGFDHGTRFVDHGRNMLIALAVLFAVAQVPPQRLMSLALPLYALGVGLLVATALFGITKKGATRWLNVGMVIQPSEMLKIAMPLMLAWWFQRREGQLRVPDFLVGGLILALPVGLIVKQPDLGTAILVLSSGLYVIFFAGLSWRLIVPVLLLGAVAITALVLSGDAICEPEVKWPVLREYQKHRVCTLLDPTKDPLGKGFHTIQGMIAIGSGGLEGKGFMKGTQTHLEFIPERTTDFVFAAFSEEFGLYGCAALVLGFVFLIFRGLVIAADAPTVFTRLLAGAITLSFFTYAFVNMGMVSGILPVVGVPLPFISYGGTAMVTLGLGLGILMSIAKSRRLVQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 9 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 10 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 11 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 85 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 212 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 231 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 232 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 233 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 236 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 239 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 240 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 303 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 305 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 306 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 307 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 309 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 312 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.15 |
| Metatranscriptomes | 0 |
| Isolates | 1.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.35 |
| Nodule | 0.84 |
| Rhizoplane | 2.53 |
| Rhizosphere | 67.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004614 | 3300001979 | Bacteria | 5915 |
| 2 | JGI24740J21852_10044089 | 3300001979 | Bacteria | 1326 |
| 3 | JGI25154J39366_1000937 | 3300002738 | Bacteria | 12133 |
| 4 | JGI25157J39369_1000361 | 3300002741 | Bacteria | 31616 |
| 5 | JGI25164J39214_1005709 | 3300002772 | Bacteria | 1336 |
| 6 | JGI25152J39213_1001024 | 3300002773 | Bacteria | 13383 |
| 7 | JGI25153J46596_10000904 | 3300003215 | Bacteria | 18024 |
| 8 | JGI25153J46596_10012019 | 3300003215 | Bacteria | 3780 |
| 9 | rootL2_10059169 | 3300003322 | Bacteria | 7994 |
| 10 | rootH1_10029562 | 3300003323 | Bacteria | 4459 |
| 11 | Ga0055533_1000048 | 3300003756 | Bacteria | 212106 |
| 12 | Ga0055533_1000068 | 3300003756 | Bacteria | 155215 |
| 13 | Ga0055525_1001441 | 3300003759 | Bacteria | 4331 |
| 14 | Ga0055535_1000917 | 3300003761 | Bacteria | 19899 |
| 15 | Ga0055529_1000291 | 3300003763 | Bacteria | 58444 |
| 16 | Ga0055526_1001136 | 3300003771 | Bacteria | 19296 |
| 17 | Ga0055524_1000137 | 3300003775 | Bacteria | 87107 |
| 18 | Ga0055524_1001779 | 3300003775 | Bacteria | 11839 |
| 19 | Ga0055524_1005390 | 3300003775 | Bacteria | 5719 |
| 20 | Ga0055530_10001713 | 3300003791 | Bacteria | 15454 |
| 21 | Ga0055530_10017992 | 3300003791 | Bacteria | 2195 |
| 22 | Ga0055540_1000042 | 3300003792 | Bacteria | 156410 |
| 23 | Ga0055531_10004981 | 3300003794 | Bacteria | 7882 |
| 24 | Ga0055531_10010420 | 3300003794 | Bacteria | 4620 |
| 25 | Ga0055531_10012094 | 3300003794 | Bacteria | 4088 |
| 26 | Ga0065165_1000079 | 3300005262 | Bacteria | 162095 |
| 27 | Ga0065165_1001510 | 3300005262 | Bacteria | 24595 |
| 28 | Ga0065165_1002283 | 3300005262 | Bacteria | 16845 |
| 29 | Ga0065707_10090986 | 3300005295 | Bacteria | 4027 |
| 30 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 31 | Ga0070658_10042789 | 3300005327 | Bacteria | 3658 |
| 32 | Ga0070676_10048150 | 3300005328 | Bacteria | 2492 |
| 33 | Ga0070670_100047892 | 3300005331 | Bacteria | 3679 |
| 34 | Ga0070670_100103908 | 3300005331 | Bacteria | 2447 |
| 35 | Ga0070670_100285891 | 3300005331 | Bacteria | 1440 |
| 36 | Ga0068869_100045478 | 3300005334 | Bacteria | 3161 |
| 37 | Ga0068869_100065020 | 3300005334 | Bacteria | 2684 |
| 38 | Ga0070680_100072767 | 3300005336 | Bacteria | 2826 |
| 39 | Ga0068868_100004682 | 3300005338 | Bacteria | 9609 |
| 40 | Ga0068868_100022229 | 3300005338 | Bacteria | 4785 |
| 41 | Ga0068868_100030420 | 3300005338 | Bacteria | 4140 |
| 42 | Ga0070660_100002455 | 3300005339 | Bacteria | 12717 |
| 43 | Ga0070660_100025624 | 3300005339 | Bacteria | 4384 |
| 44 | Ga0070660_100026263 | 3300005339 | Bacteria | 4333 |
| 45 | Ga0070660_100090110 | 3300005339 | Bacteria | 2417 |
| 46 | Ga0070661_100000143 | 3300005344 | Bacteria | 58391 |
| 47 | Ga0070661_100068331 | 3300005344 | Bacteria | 2611 |
| 48 | Ga0070692_10001641 | 3300005345 | Bacteria | 8249 |
| 49 | Ga0070692_10067713 | 3300005345 | Bacteria | 1896 |
| 50 | Ga0070668_100089302 | 3300005347 | Bacteria | 2427 |
| 51 | Ga0070675_100016355 | 3300005354 | Bacteria | 5887 |
| 52 | Ga0070675_100023702 | 3300005354 | Bacteria | 4910 |
| 53 | Ga0070675_100092899 | 3300005354 | Bacteria | 2530 |
| 54 | Ga0070671_100075394 | 3300005355 | Bacteria | 2817 |
| 55 | Ga0070671_100163491 | 3300005355 | Bacteria | 1881 |
| 56 | Ga0070674_100002334 | 3300005356 | Bacteria | 10472 |
| 57 | Ga0070673_100028817 | 3300005364 | Bacteria | 4134 |
| 58 | Ga0070673_100145175 | 3300005364 | Bacteria | 2005 |
| 59 | Ga0070673_100168574 | 3300005364 | Bacteria | 1867 |
| 60 | Ga0070673_100346518 | 3300005364 | Bacteria | 1317 |
| 61 | Ga0070659_100001187 | 3300005366 | Bacteria | 18994 |
| 62 | Ga0070659_100011514 | 3300005366 | Bacteria | 6544 |
| 63 | Ga0070659_100050123 | 3300005366 | Bacteria | 3284 |
| 64 | Ga0070659_100084405 | 3300005366 | Bacteria | 2539 |
| 65 | Ga0070667_100008278 | 3300005367 | Bacteria | 8619 |
| 66 | Ga0070667_100066028 | 3300005367 | Bacteria | 3073 |
| 67 | Ga0070667_100224342 | 3300005367 | Bacteria | 1673 |
| 68 | Ga0070700_100215683 | 3300005441 | Bacteria | 1357 |
| 69 | Ga0070663_100046195 | 3300005455 | Bacteria | 3080 |
| 70 | Ga0070663_100068556 | 3300005455 | Bacteria | 2575 |
| 71 | Ga0070678_100037378 | 3300005456 | Bacteria | 3409 |
| 72 | Ga0070678_100095910 | 3300005456 | Bacteria | 2287 |
| 73 | Ga0070662_100001972 | 3300005457 | Bacteria | 12605 |
| 74 | Ga0070662_100002087 | 3300005457 | Bacteria | 12250 |
| 75 | Ga0070662_100111891 | 3300005457 | Bacteria | 2081 |
| 76 | Ga0070662_100173843 | 3300005457 | Bacteria | 1693 |
| 77 | Ga0068867_100000074 | 3300005459 | Bacteria | 61448 |
| 78 | Ga0068867_100016932 | 3300005459 | Bacteria | 5179 |
| 79 | Ga0068867_100019791 | 3300005459 | Bacteria | 4797 |
| 80 | Ga0068867_100050890 | 3300005459 | Bacteria | 3055 |
| 81 | Ga0068867_100100750 | 3300005459 | Bacteria | 2206 |
| 82 | Ga0070706_100001812 | 3300005467 | Bacteria | 22146 |
| 83 | Ga0070707_100065034 | 3300005468 | Bacteria | 3503 |
| 84 | Ga0070679_100061522 | 3300005530 | Bacteria | 3742 |
| 85 | Ga0068853_100077897 | 3300005539 | Bacteria | 2896 |
| 86 | Ga0068853_100222775 | 3300005539 | Bacteria | 1723 |
| 87 | Ga0070672_100150107 | 3300005543 | Bacteria | 1927 |
| 88 | Ga0070665_100038822 | 3300005548 | Bacteria | 4787 |
| 89 | Ga0068855_100056191 | 3300005563 | Bacteria | 4619 |
| 90 | Ga0068855_100076382 | 3300005563 | Bacteria | 3888 |
| 91 | Ga0070664_100012445 | 3300005564 | Bacteria | 6916 |
| 92 | Ga0070664_100134325 | 3300005564 | Bacteria | 2174 |
| 93 | Ga0068857_100004217 | 3300005577 | Bacteria | 12113 |
| 94 | Ga0068857_100013612 | 3300005577 | Bacteria | 7087 |
| 95 | Ga0068857_100048921 | 3300005577 | Bacteria | 3751 |
| 96 | Ga0068854_100045107 | 3300005578 | Bacteria | 3133 |
| 97 | Ga0068854_100047902 | 3300005578 | Bacteria | 3047 |
| 98 | Ga0068856_100001787 | 3300005614 | Bacteria | 22472 |
| 99 | Ga0068856_100037290 | 3300005614 | Bacteria | 4770 |
| 100 | Ga0068856_100116430 | 3300005614 | Bacteria | 2673 |
| 101 | Ga0068852_100092002 | 3300005616 | Bacteria | 2715 |
| 102 | Ga0068852_100126431 | 3300005616 | Bacteria | 2348 |
| 103 | Ga0068852_100173945 | 3300005616 | Bacteria | 2020 |
| 104 | Ga0068852_100233945 | 3300005616 | Bacteria | 1753 |
| 105 | Ga0068852_100481171 | 3300005616 | Bacteria | 1234 |
| 106 | Ga0068859_100004106 | 3300005617 | Bacteria | 14852 |
| 107 | Ga0068864_100015752 | 3300005618 | Bacteria | 6289 |
| 108 | Ga0068864_100132919 | 3300005618 | Bacteria | 2237 |
| 109 | Ga0068864_100184437 | 3300005618 | Bacteria | 1909 |
| 110 | Ga0068864_100185634 | 3300005618 | Bacteria | 1903 |
| 111 | Ga0068864_100315504 | 3300005618 | Bacteria | 1467 |
| 112 | Ga0068861_100012599 | 3300005719 | Bacteria | 5900 |
| 113 | Ga0068861_100169659 | 3300005719 | Bacteria | 1807 |
| 114 | Ga0068863_100018149 | 3300005841 | Bacteria | 6737 |
| 115 | Ga0068863_100155000 | 3300005841 | Bacteria | 2193 |
| 116 | Ga0068863_100214598 | 3300005841 | Bacteria | 1853 |
| 117 | Ga0068858_100012096 | 3300005842 | Bacteria | 8135 |
| 118 | Ga0068858_100212585 | 3300005842 | Bacteria | 1830 |
| 119 | Ga0068860_100036624 | 3300005843 | Bacteria | 4700 |
| 120 | Ga0068860_100095196 | 3300005843 | Bacteria | 2838 |
| 121 | Ga0068862_100016050 | 3300005844 | Bacteria | 6228 |
| 122 | Ga0068862_100050997 | 3300005844 | Bacteria | 3538 |
| 123 | Ga0075365_10044946 | 3300006038 | Bacteria | 2896 |
| 124 | Ga0075368_10007764 | 3300006042 | Bacteria | 3799 |
| 125 | Ga0075363_100027136 | 3300006048 | Bacteria | 2934 |
| 126 | Ga0075362_10005083 | 3300006177 | Bacteria | 4783 |
| 127 | Ga0075367_10003757 | 3300006178 | Bacteria | 7312 |
| 128 | Ga0075367_10008433 | 3300006178 | Bacteria | 5339 |
| 129 | Ga0075367_10015315 | 3300006178 | Bacteria | 4164 |
| 130 | Ga0075367_10094174 | 3300006178 | Bacteria | 1825 |
| 131 | Ga0075367_10173251 | 3300006178 | Bacteria | 1344 |
| 132 | Ga0075369_10001649 | 3300006186 | Bacteria | 7693 |
| 133 | Ga0075366_10003901 | 3300006195 | Bacteria | 7952 |
| 134 | Ga0075366_10014272 | 3300006195 | Bacteria | 4536 |
| 135 | Ga0075366_10022587 | 3300006195 | Bacteria | 3661 |
| 136 | Ga0075366_10034757 | 3300006195 | Bacteria | 2970 |
| 137 | Ga0075366_10137035 | 3300006195 | Bacteria | 1478 |
| 138 | Ga0097621_100051214 | 3300006237 | Bacteria | 3359 |
| 139 | Ga0097621_100064663 | 3300006237 | Bacteria | 3009 |
| 140 | Ga0097621_100098542 | 3300006237 | Bacteria | 2455 |
| 141 | Ga0075370_10002473 | 3300006353 | Bacteria | 8571 |
| 142 | Ga0075370_10003868 | 3300006353 | Bacteria | 7175 |
| 143 | Ga0075370_10008355 | 3300006353 | Bacteria | 5324 |
| 144 | Ga0075370_10010033 | 3300006353 | Bacteria | 4939 |
| 145 | Ga0075370_10035225 | 3300006353 | Bacteria | 2809 |
| 146 | Ga0075370_10045413 | 3300006353 | Bacteria | 2485 |
| 147 | Ga0068871_100066434 | 3300006358 | Bacteria | 2956 |
| 148 | Ga0075430_100012408 | 3300006846 | Bacteria | 7250 |
| 149 | Ga0075430_100081406 | 3300006846 | Bacteria | 2713 |
| 150 | Ga0075429_100000549 | 3300006880 | Bacteria | 28660 |
| 151 | Ga0097620_100004106 | 3300006931 | Bacteria | 14852 |
| 152 | Ga0099823_1000002 | 3300006944 | Bacteria | 212272 |
| 153 | Ga0079104_1000012 | 3300006946 | Bacteria | 355143 |
| 154 | Ga0105240_10050356 | 3300009093 | Bacteria | 5252 |
| 155 | Ga0111539_10278603 | 3300009094 | Bacteria | 1946 |
| 156 | Ga0105245_10098671 | 3300009098 | Bacteria | 2699 |
| 157 | Ga0105245_10155639 | 3300009098 | Bacteria | 2164 |
| 158 | Ga0105245_10168911 | 3300009098 | Bacteria | 2081 |
| 159 | Ga0105247_10160782 | 3300009101 | Bacteria | 1487 |
| 160 | Ga0114129_10067923 | 3300009147 | Bacteria | 4971 |
| 161 | Ga0105243_10013068 | 3300009148 | Bacteria | 6273 |
| 162 | Ga0105243_10070295 | 3300009148 | Bacteria | 2826 |
| 163 | Ga0105241_10034699 | 3300009174 | Bacteria | 3792 |
| 164 | Ga0105242_10065208 | 3300009176 | Bacteria | 3004 |
| 165 | Ga0105248_10001875 | 3300009177 | Bacteria | 23322 |
| 166 | Ga0105248_10091586 | 3300009177 | Bacteria | 3424 |
| 167 | Ga0105248_10217212 | 3300009177 | Bacteria | 2153 |
| 168 | Ga0105237_10083448 | 3300009545 | Bacteria | 3186 |
| 169 | Ga0105237_10314085 | 3300009545 | Bacteria | 1570 |
| 170 | Ga0105239_10037165 | 3300010375 | Bacteria | 5340 |
| 171 | Ga0105239_10055004 | 3300010375 | Bacteria | 4365 |
| 172 | Ga0105239_10155046 | 3300010375 | Bacteria | 2557 |
| 173 | Ga0105239_10369365 | 3300010375 | Bacteria | 1621 |
| 174 | Ga0105239_10502885 | 3300010375 | Bacteria | 1378 |
| 175 | Ga0105246_10052639 | 3300011119 | Bacteria | 2799 |
| 176 | Ga0157319_1000007 | 3300012497 | Bacteria | 318528 |
| 177 | Ga0157373_10056067 | 3300013100 | Bacteria | 2798 |
| 178 | Ga0157369_10005527 | 3300013105 | Bacteria | 14673 |
| 179 | Ga0157369_10113559 | 3300013105 | Bacteria | 2878 |
| 180 | Ga0157374_10146598 | 3300013296 | Bacteria | 2293 |
| 181 | Ga0157374_10168961 | 3300013296 | Bacteria | 2132 |
| 182 | Ga0157378_10216026 | 3300013297 | Bacteria | 1821 |
| 183 | Ga0163162_10151886 | 3300013306 | Bacteria | 2434 |
| 184 | Ga0157372_10332061 | 3300013307 | Bacteria | 1771 |
| 185 | Ga0157375_10034091 | 3300013308 | Bacteria | 4846 |
| 186 | Ga0157375_10246415 | 3300013308 | Bacteria | 1947 |
| 187 | Ga0157375_10387732 | 3300013308 | Bacteria | 1564 |
| 188 | Ga0163163_10010636 | 3300014325 | Bacteria | 8291 |
| 189 | Ga0157380_10159123 | 3300014326 | Bacteria | 1961 |
| 190 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 191 | Ga0157379_10058377 | 3300014968 | Bacteria | 3450 |
| 192 | Ga0157379_10241264 | 3300014968 | Bacteria | 1639 |
| 193 | Ga0157376_10031404 | 3300014969 | Bacteria | 4252 |
| 194 | Ga0157376_10160211 | 3300014969 | Bacteria | 2039 |
| 195 | Ga0157376_10161544 | 3300014969 | Bacteria | 2031 |
| 196 | Ga0163161_10096385 | 3300017792 | Bacteria | 2195 |
| 197 | Ga0213872_10000286 | 3300021361 | Bacteria | 43221 |
| 198 | Ga0213872_10000510 | 3300021361 | Bacteria | 30659 |
| 199 | Ga0213876_10000234 | 3300021384 | Bacteria | 54188 |
| 200 | Ga0213876_10015405 | 3300021384 | Bacteria | 4047 |
| 201 | Ga0209674_100024 | 3300025226 | Bacteria | 535481 |
| 202 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 203 | Ga0209563_100101 | 3300025230 | Bacteria | 152297 |
| 204 | Ga0209258_100180 | 3300025242 | Bacteria | 137306 |
| 205 | Ga0209258_100777 | 3300025242 | Bacteria | 19410 |
| 206 | Ga0209646_1000012 | 3300025246 | Bacteria | 573300 |
| 207 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 208 | Ga0209677_100091 | 3300025253 | Bacteria | 106743 |
| 209 | Ga0209677_101750 | 3300025253 | Bacteria | 9018 |
| 210 | Ga0209677_105636 | 3300025253 | Bacteria | 3208 |
| 211 | Ga0209148_1006729 | 3300025254 | Bacteria | 2461 |
| 212 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 213 | Ga0209759_1000067 | 3300025256 | Bacteria | 183764 |
| 214 | Ga0209759_1001906 | 3300025256 | Bacteria | 10240 |
| 215 | Ga0209759_1008275 | 3300025256 | Bacteria | 3255 |
| 216 | Ga0209759_1013534 | 3300025256 | Bacteria | 2202 |
| 217 | Ga0209129_1000035 | 3300025258 | Bacteria | 329303 |
| 218 | Ga0209565_1002606 | 3300025263 | Bacteria | 6385 |
| 219 | Ga0209455_1000144 | 3300025272 | Bacteria | 137313 |
| 220 | Ga0209673_1014757 | 3300025273 | Bacteria | 3010 |
| 221 | Ga0209673_1022702 | 3300025273 | Bacteria | 2156 |
| 222 | Ga0209673_1022780 | 3300025273 | Bacteria | 2151 |
| 223 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 224 | Ga0209564_1000030 | 3300025295 | Bacteria | 503296 |
| 225 | Ga0209758_1000066 | 3300025297 | Bacteria | 298620 |
| 226 | Ga0209758_1000248 | 3300025297 | Bacteria | 110671 |
| 227 | Ga0209050_1000556 | 3300025298 | Bacteria | 61372 |
| 228 | Ga0209050_1000614 | 3300025298 | Bacteria | 56080 |
| 229 | Ga0209050_1008170 | 3300025298 | Bacteria | 5663 |
| 230 | Ga0209050_1008250 | 3300025298 | Bacteria | 5615 |
| 231 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 232 | Ga0209256_1000197 | 3300025299 | Bacteria | 114432 |
| 233 | Ga0209256_1003387 | 3300025299 | Bacteria | 11247 |
| 234 | Ga0209256_1027942 | 3300025299 | Bacteria | 1600 |
| 235 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 236 | Ga0209051_1002061 | 3300025303 | Bacteria | 15247 |
| 237 | Ga0209051_1002964 | 3300025303 | Bacteria | 11563 |
| 238 | Ga0209051_1003541 | 3300025303 | Bacteria | 10175 |
| 239 | Ga0209257_1000063 | 3300025304 | Bacteria | 359089 |
| 240 | Ga0209257_1002434 | 3300025304 | Bacteria | 18517 |
| 241 | Ga0209257_1004130 | 3300025304 | Bacteria | 11575 |
| 242 | Ga0207656_10020347 | 3300025321 | Bacteria | 2637 |
| 243 | Ga0207682_10007238 | 3300025893 | Bacteria | 4435 |
| 244 | Ga0207688_10123664 | 3300025901 | Bacteria | 1511 |
| 245 | Ga0207680_10025545 | 3300025903 | Bacteria | 3259 |
| 246 | Ga0207647_10009993 | 3300025904 | Bacteria | 6718 |
| 247 | Ga0207645_10153507 | 3300025907 | Bacteria | 1504 |
| 248 | Ga0207643_10117579 | 3300025908 | Bacteria | 1572 |
| 249 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 250 | Ga0207705_10041865 | 3300025909 | Bacteria | 3286 |
| 251 | Ga0207684_10005403 | 3300025910 | Bacteria | 11797 |
| 252 | Ga0207695_10026886 | 3300025913 | Bacteria | 6415 |
| 253 | Ga0207695_10071453 | 3300025913 | Bacteria | 3545 |
| 254 | Ga0207695_10075293 | 3300025913 | Bacteria | 3435 |
| 255 | Ga0207671_10034414 | 3300025914 | Bacteria | 3763 |
| 256 | Ga0207671_10034539 | 3300025914 | Bacteria | 3756 |
| 257 | Ga0207662_10078340 | 3300025918 | Bacteria | 2011 |
| 258 | Ga0207657_10021758 | 3300025919 | Bacteria | 6026 |
| 259 | Ga0207657_10036415 | 3300025919 | Bacteria | 4404 |
| 260 | Ga0207657_10149925 | 3300025919 | Bacteria | 1900 |
| 261 | Ga0207657_10300196 | 3300025919 | Bacteria | 1272 |
| 262 | Ga0207649_10007131 | 3300025920 | Bacteria | 6077 |
| 263 | Ga0207649_10082794 | 3300025920 | Bacteria | 2081 |
| 264 | Ga0207649_10099654 | 3300025920 | Bacteria | 1920 |
| 265 | Ga0207646_10025442 | 3300025922 | Bacteria | 5414 |
| 266 | Ga0207681_10040776 | 3300025923 | Bacteria | 3091 |
| 267 | Ga0207694_10113511 | 3300025924 | Bacteria | 2157 |
| 268 | Ga0207650_10011535 | 3300025925 | Bacteria | 6085 |
| 269 | Ga0207659_10053395 | 3300025926 | Bacteria | 2882 |
| 270 | Ga0207659_10062520 | 3300025926 | Bacteria | 2687 |
| 271 | Ga0207687_10077378 | 3300025927 | Bacteria | 2392 |
| 272 | Ga0207687_10235178 | 3300025927 | Bacteria | 1449 |
| 273 | Ga0207644_10008982 | 3300025931 | Bacteria | 6548 |
| 274 | Ga0207644_10010832 | 3300025931 | Bacteria | 6019 |
| 275 | Ga0207644_10021081 | 3300025931 | Bacteria | 4437 |
| 276 | Ga0207644_10044828 | 3300025931 | Bacteria | 3144 |
| 277 | Ga0207644_10151195 | 3300025931 | Bacteria | 1796 |
| 278 | Ga0207690_10001085 | 3300025932 | Bacteria | 17371 |
| 279 | Ga0207690_10007044 | 3300025932 | Bacteria | 6670 |
| 280 | Ga0207690_10069004 | 3300025932 | Bacteria | 2431 |
| 281 | Ga0207690_10087560 | 3300025932 | Bacteria | 2192 |
| 282 | Ga0207690_10155333 | 3300025932 | Bacteria | 1700 |
| 283 | Ga0207706_10002326 | 3300025933 | Bacteria | 18551 |
| 284 | Ga0207706_10025882 | 3300025933 | Bacteria | 5254 |
| 285 | Ga0207706_10029294 | 3300025933 | Bacteria | 4916 |
| 286 | Ga0207706_10066743 | 3300025933 | Bacteria | 3166 |
| 287 | Ga0207706_10078639 | 3300025933 | Bacteria | 2901 |
| 288 | Ga0207686_10046424 | 3300025934 | Bacteria | 2679 |
| 289 | Ga0207686_10162051 | 3300025934 | Bacteria | 1568 |
| 290 | Ga0207709_10007745 | 3300025935 | Bacteria | 5953 |
| 291 | Ga0207709_10208528 | 3300025935 | Bacteria | 1401 |
| 292 | Ga0207691_10047060 | 3300025940 | Bacteria | 3961 |
| 293 | Ga0207711_10001495 | 3300025941 | Bacteria | 21766 |
| 294 | Ga0207711_10008941 | 3300025941 | Bacteria | 8373 |
| 295 | Ga0207711_10127636 | 3300025941 | Bacteria | 2277 |
| 296 | Ga0207689_10018619 | 3300025942 | Bacteria | 5858 |
| 297 | Ga0207689_10133268 | 3300025942 | Bacteria | 2045 |
| 298 | Ga0207661_10105194 | 3300025944 | Bacteria | 2377 |
| 299 | Ga0207679_10000107 | 3300025945 | Bacteria | 68403 |
| 300 | Ga0207679_10010126 | 3300025945 | Bacteria | 6063 |
| 301 | Ga0207667_10021849 | 3300025949 | Bacteria | 7082 |
| 302 | Ga0207651_10018533 | 3300025960 | Bacteria | 4146 |
| 303 | Ga0207651_10072443 | 3300025960 | Bacteria | 2446 |
| 304 | Ga0207651_10090072 | 3300025960 | Bacteria | 2241 |
| 305 | Ga0207651_10126081 | 3300025960 | Bacteria | 1951 |
| 306 | Ga0207651_10210910 | 3300025960 | Bacteria | 1563 |
| 307 | Ga0207712_10032071 | 3300025961 | Bacteria | 3544 |
| 308 | Ga0207640_10007735 | 3300025981 | Bacteria | 5938 |
| 309 | Ga0207640_10263626 | 3300025981 | Bacteria | 1344 |
| 310 | Ga0207658_10012649 | 3300025986 | Bacteria | 5764 |
| 311 | Ga0207658_10043256 | 3300025986 | Bacteria | 3273 |
| 312 | Ga0207658_10244092 | 3300025986 | Bacteria | 1523 |
| 313 | Ga0207677_10001235 | 3300026023 | Bacteria | 13778 |
| 314 | Ga0207677_10014267 | 3300026023 | Bacteria | 4634 |
| 315 | Ga0207677_10125475 | 3300026023 | Bacteria | 1939 |
| 316 | Ga0207703_10003592 | 3300026035 | Bacteria | 12959 |
| 317 | Ga0207639_10299319 | 3300026041 | Bacteria | 1421 |
| 318 | Ga0207678_10074445 | 3300026067 | Bacteria | 2910 |
| 319 | Ga0207678_10083994 | 3300026067 | Bacteria | 2724 |
| 320 | Ga0207678_10124281 | 3300026067 | Bacteria | 2201 |
| 321 | Ga0207708_10094440 | 3300026075 | Bacteria | 2309 |
| 322 | Ga0207708_10173994 | 3300026075 | Bacteria | 1706 |
| 323 | Ga0207702_10000033 | 3300026078 | Bacteria | 166621 |
| 324 | Ga0207702_10056893 | 3300026078 | Bacteria | 3322 |
| 325 | Ga0207641_10091127 | 3300026088 | Bacteria | 2667 |
| 326 | Ga0207648_10000039 | 3300026089 | Bacteria | 118860 |
| 327 | Ga0207648_10051426 | 3300026089 | Bacteria | 3601 |
| 328 | Ga0207648_10060172 | 3300026089 | Bacteria | 3312 |
| 329 | Ga0207648_10068722 | 3300026089 | Bacteria | 3087 |
| 330 | Ga0207676_10011369 | 3300026095 | Bacteria | 6362 |
| 331 | Ga0207676_10020271 | 3300026095 | Bacteria | 4862 |
| 332 | Ga0207676_10071455 | 3300026095 | Bacteria | 2786 |
| 333 | Ga0207674_10004849 | 3300026116 | Bacteria | 16110 |
| 334 | Ga0207674_10017935 | 3300026116 | Bacteria | 7714 |
| 335 | Ga0207674_10039358 | 3300026116 | Bacteria | 4902 |
| 336 | Ga0207674_10084515 | 3300026116 | Bacteria | 3171 |
| 337 | Ga0207674_10184103 | 3300026116 | Bacteria | 2039 |
| 338 | Ga0207675_100018234 | 3300026118 | Bacteria | 6544 |
| 339 | Ga0207675_100022435 | 3300026118 | Bacteria | 5879 |
| 340 | Ga0207683_10124007 | 3300026121 | Bacteria | 2321 |
| 341 | Ga0207683_10151917 | 3300026121 | Bacteria | 2090 |
| 342 | Ga0207698_10033942 | 3300026142 | Bacteria | 3713 |
| 343 | Ga0207698_10320971 | 3300026142 | Bacteria | 1450 |
| 344 | Ga0207698_10365989 | 3300026142 | Bacteria | 1367 |
| 345 | Ga0209281_1000039 | 3300027111 | Bacteria | 355150 |
| 346 | Ga0209389_1031075 | 3300027296 | Bacteria | 4482 |
| 347 | Ga0268266_10201755 | 3300028379 | Bacteria | 1820 |
| 348 | Ga0268266_10368889 | 3300028379 | Bacteria | 1352 |
| 349 | Ga0268265_10055489 | 3300028380 | Bacteria | 3010 |
| 350 | Ga0268265_10137353 | 3300028380 | Bacteria | 2041 |
| 351 | Ga0268264_10053035 | 3300028381 | Bacteria | 3383 |
| 352 | Ga0268264_10109071 | 3300028381 | Bacteria | 2421 |
| 353 | Ga0265336_10000030 | 3300028666 | Bacteria | 169335 |
| 354 | Ga0265336_10000260 | 3300028666 | Bacteria | 37415 |
| 355 | Ga0307517_10003885 | 3300028786 | Bacteria | 23168 |
| 356 | Ga0307517_10103686 | 3300028786 | Bacteria | 2221 |
| 357 | Ga0307517_10117758 | 3300028786 | Bacteria | 1981 |
| 358 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 359 | Ga0307515_10000179 | 3300028794 | Bacteria | 156716 |
| 360 | Ga0307515_10000239 | 3300028794 | Bacteria | 135971 |
| 361 | Ga0307515_10001166 | 3300028794 | Bacteria | 60153 |
| 362 | Ga0307515_10019026 | 3300028794 | Bacteria | 12392 |
| 363 | Ga0307515_10021584 | 3300028794 | Bacteria | 11405 |
| 364 | Ga0307515_10034662 | 3300028794 | Bacteria | 8248 |
| 365 | Ga0307515_10038409 | 3300028794 | Bacteria | 7659 |
| 366 | Ga0307515_10061615 | 3300028794 | Bacteria | 5317 |
| 367 | Ga0307515_10074489 | 3300028794 | Bacteria | 4540 |
| 368 | Ga0307515_10075820 | 3300028794 | Bacteria | 4472 |
| 369 | Ga0265338_10059826 | 3300028800 | Bacteria | 3354 |
| 370 | Ga0265324_10000004 | 3300029957 | Bacteria | 356972 |
| 371 | Ga0265324_10000109 | 3300029957 | Bacteria | 65395 |
| 372 | Ga0265324_10000522 | 3300029957 | Bacteria | 26385 |
| 373 | Ga0265324_10060151 | 3300029957 | Bacteria | 1299 |
| 374 | Ga0307512_10029280 | 3300030522 | Bacteria | 4815 |
| 375 | Ga0265325_10000084 | 3300031241 | Bacteria | 66026 |
| 376 | Ga0265325_10025694 | 3300031241 | Bacteria | 3196 |
| 377 | Ga0307513_10079132 | 3300031456 | Bacteria | 3397 |
| 378 | Ga0307513_10110681 | 3300031456 | Bacteria | 2741 |
| 379 | Ga0307509_10000135 | 3300031507 | Bacteria | 109066 |
| 380 | Ga0307509_10045186 | 3300031507 | Bacteria | 4752 |
| 381 | Ga0307509_10046455 | 3300031507 | Bacteria | 4674 |
| 382 | Ga0307509_10075676 | 3300031507 | Bacteria | 3496 |
| 383 | Ga0307509_10080732 | 3300031507 | Bacteria | 3362 |
| 384 | Ga0307509_10082225 | 3300031507 | Bacteria | 3323 |
| 385 | Ga0307509_10083895 | 3300031507 | Bacteria | 3283 |
| 386 | Ga0307509_10143228 | 3300031507 | Bacteria | 2321 |
| 387 | Ga0307408_100002033 | 3300031548 | Bacteria | 14565 |
| 388 | Ga0307408_100035791 | 3300031548 | Bacteria | 3486 |
| 389 | Ga0307408_100271452 | 3300031548 | Bacteria | 1408 |
| 390 | Ga0307508_10000048 | 3300031616 | Bacteria | 137587 |
| 391 | Ga0307508_10000122 | 3300031616 | Bacteria | 92612 |
| 392 | Ga0307508_10157944 | 3300031616 | Bacteria | 1871 |
| 393 | Ga0307514_10000595 | 3300031649 | Bacteria | 67797 |
| 394 | Ga0307514_10144322 | 3300031649 | Bacteria | 1611 |
| 395 | Ga0265314_10000134 | 3300031711 | Bacteria | 111395 |
| 396 | Ga0265314_10003721 | 3300031711 | Bacteria | 14593 |
| 397 | Ga0265314_10023534 | 3300031711 | Bacteria | 4693 |
| 398 | Ga0307516_10000243 | 3300031730 | Bacteria | 70407 |
| 399 | Ga0307516_10000942 | 3300031730 | Bacteria | 40129 |
| 400 | Ga0307516_10005879 | 3300031730 | Bacteria | 14519 |
| 401 | Ga0307516_10049504 | 3300031730 | Bacteria | 4129 |
| 402 | Ga0307405_10006527 | 3300031731 | Bacteria | 5746 |
| 403 | Ga0307405_10052799 | 3300031731 | Bacteria | 2529 |
| 404 | Ga0307413_10152474 | 3300031824 | Bacteria | 1612 |
| 405 | Ga0307410_10006677 | 3300031852 | Bacteria | 6247 |
| 406 | Ga0307406_10004814 | 3300031901 | Bacteria | 7355 |
| 407 | Ga0307406_10086629 | 3300031901 | Bacteria | 2098 |
| 408 | Ga0307412_10007849 | 3300031911 | Bacteria | 6076 |
| 409 | Ga0307412_10025572 | 3300031911 | Bacteria | 3658 |
| 410 | Ga0307409_100000263 | 3300031995 | Bacteria | 21269 |
| 411 | Ga0307416_100010747 | 3300032002 | Bacteria | 6064 |
| 412 | Ga0307416_100046031 | 3300032002 | Bacteria | 3440 |
| 413 | Ga0307416_100212879 | 3300032002 | Bacteria | 1845 |
| 414 | Ga0307414_10021756 | 3300032004 | Bacteria | 4033 |
| 415 | Ga0307414_10191882 | 3300032004 | Bacteria | 1654 |
| 416 | Ga0307411_10144737 | 3300032005 | Bacteria | 1757 |
| 417 | Ga0307411_10302992 | 3300032005 | Bacteria | 1282 |
| 418 | Ga0307415_100002117 | 3300032126 | Bacteria | 9826 |
| 419 | Ga0307507_10014209 | 3300033179 | Bacteria | 9527 |
| 420 | Ga0307510_10019100 | 3300033180 | Bacteria | 8040 |
| 421 | Ga0307510_10024531 | 3300033180 | Bacteria | 6966 |
| 422 | Ga0307510_10033752 | 3300033180 | Bacteria | 5742 |
| 423 | Ga0373938_0004483 | 3300034957 | Bacteria | 2336 |
| 424 | Ga0373951_0012000 | 3300035091 | Bacteria | 1948 |
| 425 | Ga0373939_0000003 | 3300035114 | Bacteria | 111914 |
| 426 | Ga0373945_0017245 | 3300035116 | Bacteria | 2444 |
| 427 | Ga0373960_0001502 | 3300035121 | Bacteria | 5186 |
| 428 | Ga0373955_0071005 | 3300035172 | Bacteria | 1947 |
| 429 | Ga0373931_0001000 | 3300035691 | Bacteria | 11954 |
| 430 | Ga0373931_0001994 | 3300035691 | Bacteria | 8980 |
| 431 | Ga0373931_0034620 | 3300035691 | Bacteria | 2622 |
| 432 | Ga0373935_0161176 | 3300035692 | Bacteria | 1529 |
| 433 | Ga0373927_0041637 | 3300035695 | Bacteria | 2979 |
| 434 | Ga0373927_0067846 | 3300035695 | Bacteria | 2308 |
| 435 | Ga0373947_0181787 | 3300035725 | Bacteria | 1369 |
| 436 | Ga0373937_0083668 | 3300036401 | Bacteria | 2952 |
| 437 | Ga0373937_0158361 | 3300036401 | Bacteria | 2123 |
| 438 | Ga0373937_0171685 | 3300036401 | Bacteria | 2035 |
| 439 | Ga0373937_0177245 | 3300036401 | Bacteria | 2001 |
| 440 | Ga0373925_0006787 | 3300037068 | Bacteria | 8388 |
| 441 | Ga0373925_0020505 | 3300037068 | Bacteria | 4812 |
| 442 | Ga0395899_0260823 | 3300037312 | Bacteria | 1185 |
| 443 | Ga0395898_0120447 | 3300037466 | Bacteria | 2514 |
| 444 | Ga0395905_0004009 | 3300037471 | Bacteria | 15476 |
| 445 | Ga0395905_0027724 | 3300037471 | Bacteria | 5341 |
| 446 | Ga0395901_0022909 | 3300038443 | Bacteria | 6403 |
| 447 | Ga0436365_0730430 | 3300039437 | Bacteria | 4930 |
| 448 | Ga0436365_1041421 | 3300039437 | Bacteria | 61116 |
| 449 | Ga0436361_0147565 | 3300039447 | Bacteria | 50932 |
| 450 | Ga0436361_0372090 | 3300039447 | Bacteria | 55323 |
| 451 | Ga0436361_0602459 | 3300039447 | Bacteria | 3783 |
| 452 | Ga0436361_1129825 | 3300039447 | Bacteria | 3838 |
| 453 | Ga0436363_1578616 | 3300039450 | Bacteria | 3164 |
| 454 | Ga0436363_1720631 | 3300039450 | Bacteria | 2595 |
| 455 | Ga0439448_0003000 | 3300042005 | Bacteria | 4634 |
| 456 | Ga0439448_0029024 | 3300042005 | Bacteria | 1749 |
| 457 | Ga0439455_0001540 | 3300042012 | Bacteria | 3895 |
| 458 | Ga0439455_0008451 | 3300042012 | Bacteria | 2208 |
| 459 | Ga0439455_0015604 | 3300042012 | Bacteria | 1747 |
| 460 | Ga0450923_002188 | 3300042125 | Bacteria | 2760 |
| 461 | Ga0450890_000303 | 3300042127 | Bacteria | 7127 |
| 462 | Ga0439458_0003441 | 3300042157 | Bacteria | 3702 |
| 463 | Ga0439459_0000614 | 3300042438 | Bacteria | 4782 |
| 464 | Ga0450918_000035 | 3300042531 | Bacteria | 27883 |
| 465 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 466 | Ga0451577_0005990 | 3300042876 | Bacteria | 12244 |
| 467 | Ga0451577_0011641 | 3300042876 | Bacteria | 8305 |
| 468 | Ga0451577_0021420 | 3300042876 | Bacteria | 5916 |
| 469 | Ga0451577_0228983 | 3300042876 | Bacteria | 1680 |
| 470 | Ga0466969_0000009 | 3300044656 | Bacteria | 125464 |
| 471 | Ga0466969_0007097 | 3300044656 | Bacteria | 5962 |
| 472 | Ga0466969_0027851 | 3300044656 | Bacteria | 2891 |
| 473 | Ga0466972_0005323 | 3300044658 | Bacteria | 6444 |
| 474 | Ga0453683_0000013 | 3300044673 | Bacteria | 371932 |
| 475 | Ga0466965_0097007 | 3300044683 | Bacteria | 1504 |
| 476 | Ga0466966_0000566 | 3300044684 | Bacteria | 23589 |
| 477 | Ga0466961_0008485 | 3300044693 | Bacteria | 6545 |
| 478 | Ga0466963_0023171 | 3300044694 | Bacteria | 3939 |
| 479 | Ga0466963_0197183 | 3300044694 | Bacteria | 1408 |
| 480 | Ga0466964_0002753 | 3300044706 | Bacteria | 6309 |
| 481 | Ga0466964_0038300 | 3300044706 | Bacteria | 1927 |
| 482 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 483 | Ga0453684_0040217 | 3300044712 | Bacteria | 6356 |
| 484 | Ga0453684_0293421 | 3300044712 | Bacteria | 1851 |
| 485 | Ga0466971_0069364 | 3300044719 | Bacteria | 1599 |
| 486 | Ga0466970_0132918 | 3300044765 | Bacteria | 1367 |
| 487 | Ga0466957_0096502 | 3300044842 | Bacteria | 1858 |
| 488 | Ga0466959_0014467 | 3300045049 | Bacteria | 5734 |
| 489 | Ga0466959_0019638 | 3300045049 | Bacteria | 4969 |
| 490 | Ga0466959_0155875 | 3300045049 | Bacteria | 1607 |
| 491 | Ga0451576_0000037 | 3300045051 | Bacteria | 372173 |
| 492 | Ga0451576_0011961 | 3300045051 | Bacteria | 9807 |
| 493 | Ga0495592_0000185 | 3300046454 | Bacteria | 54711 |
| 494 | Ga0495590_0003929 | 3300046457 | Bacteria | 6044 |
| 495 | Ga0495583_0000022 | 3300046506 | Bacteria | 282544 |
| 496 | Ga0495606_0006644 | 3300046507 | Bacteria | 10606 |
| 497 | Ga0495606_0089597 | 3300046507 | Bacteria | 1895 |
| 498 | Ga0495610_0040794 | 3300046512 | Bacteria | 2336 |
| 499 | Ga0495632_0004037 | 3300046519 | Bacteria | 10131 |
| 500 | Ga0495632_0005415 | 3300046519 | Bacteria | 8442 |
| 501 | Ga0495632_0072991 | 3300046519 | Bacteria | 1646 |
| 502 | Ga0495597_0003643 | 3300046542 | Bacteria | 8851 |
| 503 | Ga0495668_0056332 | 3300046616 | Bacteria | 2170 |
| 504 | Ga0495625_0006884 | 3300046660 | Bacteria | 10036 |
| 505 | Ga0495625_0028632 | 3300046660 | Bacteria | 4176 |
| 506 | Ga0495625_0036327 | 3300046660 | Bacteria | 3622 |
| 507 | Ga0495647_0059919 | 3300046681 | Bacteria | 1499 |
| 508 | Ga0495658_0049639 | 3300046683 | Bacteria | 2371 |
| 509 | Ga0495658_0057116 | 3300046683 | Bacteria | 2228 |
| 510 | Ga0495669_0102301 | 3300046684 | Bacteria | 1331 |
| 511 | Ga0495624_0024292 | 3300046690 | Bacteria | 3989 |
| 512 | Ga0495671_0045836 | 3300046692 | Bacteria | 2188 |
| 513 | Ga0495649_0000276 | 3300046694 | Bacteria | 45246 |
| 514 | Ga0495649_0019858 | 3300046694 | Bacteria | 3772 |
| 515 | Ga0495687_001929 | 3300047443 | Bacteria | 17770 |
| 516 | Ga0495687_004091 | 3300047443 | Bacteria | 10090 |
| 517 | Ga0495686_0020115 | 3300047472 | Bacteria | 4454 |
| 518 | Ga0496101_0068118 | 3300048904 | Bacteria | 2601 |
| 519 | Ga0496101_0134419 | 3300048904 | Bacteria | 1881 |
| 520 | Ga0496102_0004774 | 3300048905 | Bacteria | 11465 |
| 521 | Ga0496102_0035825 | 3300048905 | Bacteria | 4469 |
| 522 | Ga0496104_0362367 | 3300048907 | Bacteria | 1362 |
| 523 | Ga0496105_0235722 | 3300048908 | Bacteria | 1486 |
| 524 | Ga0496108_0030449 | 3300048911 | Bacteria | 4473 |
| 525 | Ga0496110_0176928 | 3300048913 | Bacteria | 1937 |
| 526 | Ga0496110_0298336 | 3300048913 | Bacteria | 1468 |
| 527 | Ga0496112_0016698 | 3300048915 | Bacteria | 6882 |
| 528 | Ga0496113_0007231 | 3300048916 | Bacteria | 7118 |
| 529 | Ga0496113_0063585 | 3300048916 | Bacteria | 2789 |
| 530 | Ga0496114_0038403 | 3300048917 | Bacteria | 3962 |
| 531 | Ga0496114_0169368 | 3300048917 | Bacteria | 1903 |
| 532 | Ga0496115_0109451 | 3300048918 | Bacteria | 2269 |
| 533 | Ga0496121_0048421 | 3300048924 | Bacteria | 3616 |
| 534 | Ga0496124_0000273 | 3300048927 | Bacteria | 99505 |
| 535 | Ga0496125_0025441 | 3300048928 | Bacteria | 5419 |
| 536 | Ga0501298_023927 | 3300049521 | Bacteria | 1160 |
| 537 | Ga0501043_0000024 | 3300049579 | Bacteria | 154045 |
| 538 | Ga0501046_0000107 | 3300049580 | Bacteria | 88655 |
| 539 | Ga0501047_0000051 | 3300049581 | Bacteria | 154281 |
| 540 | Ga0501048_0001157 | 3300049582 | Bacteria | 19854 |
| 541 | Ga0501198_000003 | 3300049649 | Bacteria | 175301 |
| 542 | Ga0501222_000001 | 3300049662 | Bacteria | 307689 |
| 543 | Ga0501045_0020912 | 3300049824 | Bacteria | 4678 |
| 544 | nmdc:mga00v17_146225_c1 | 3300050491 | Bacteria | 1517 |
| 545 | nmdc:mga0yw44_12790_c1 | 3300050492 | Bacteria | 4389 |
| 546 | nmdc:mga0k408_10101_c1 | 3300050493 | Bacteria | 5100 |
| 547 | nmdc:mga0k408_23966_c1 | 3300050493 | Bacteria | 3447 |
| 548 | nmdc:mga0k408_4060_c1 | 3300050493 | Bacteria | 7766 |
| 549 | nmdc:mga0k408_5915_c1 | 3300050493 | Bacteria | 6525 |
| 550 | nmdc:mga0k408_7565_c1 | 3300050493 | Bacteria | 5802 |
| 551 | nmdc:mga06z11_25204_c1 | 3300050494 | Bacteria | 2816 |
| 552 | nmdc:mga06z11_31232_c1 | 3300050494 | Bacteria | 2586 |
| 553 | nmdc:mga04h51_2001_c1 | 3300050495 | Bacteria | 4768 |
| 554 | nmdc:mga04h51_9983_c1 | 3300050495 | Bacteria | 2593 |
| 555 | nmdc:mga07m45_13510_c2 | 3300050496 | Bacteria | 1983 |
| 556 | nmdc:mga07m45_17727_c1 | 3300050496 | Bacteria | 3831 |
| 557 | nmdc:mga07m45_22678_c1 | 3300050496 | Bacteria | 3430 |
| 558 | nmdc:mga07m45_23433_c1 | 3300050496 | Bacteria | 3375 |
| 559 | nmdc:mga07m45_3941_c1 | 3300050496 | Bacteria | 7214 |
| 560 | nmdc:mga07m45_41830_c1 | 3300050496 | Bacteria | 1859 |
| 561 | nmdc:mga07m45_5755_c1 | 3300050496 | Bacteria | 6204 |
| 562 | nmdc:mga07m45_63703_c1 | 3300050496 | Bacteria | 2091 |
| 563 | nmdc:mga07m45_638_c1 | 3300050496 | Bacteria | 14916 |
| 564 | nmdc:mga05p37_147209_c1 | 3300050507 | Bacteria | 2882 |
| 565 | nmdc:mga0qj67_10567_c1 | 3300050509 | Bacteria | 6896 |
| 566 | nmdc:mga0qj67_12586_c1 | 3300050509 | Bacteria | 6377 |
| 567 | nmdc:mga08y16_167558_c1 | 3300050511 | Bacteria | 2282 |
| 568 | Ga0495601_0082724 | 3300053077 | Bacteria | 2061 |
| 569 | Ga0500635_0000318 | 3300053080 | Bacteria | 16609 |
| 570 | Ga0495619_0252430 | 3300053085 | Bacteria | 1222 |
| 571 | Ga0500578_0003965 | 3300053086 | Bacteria | 10723 |
| 572 | Ga0500644_0016764 | 3300053088 | Bacteria | 2114 |
| 573 | Ga0500646_0014455 | 3300053090 | Bacteria | 2049 |
| 574 | Ga0500651_0019099 | 3300053093 | Bacteria | 4253 |
| 575 | Ga0500594_0001006 | 3300053118 | Bacteria | 6047 |
| 576 | Ga0500642_0028248 | 3300053130 | Bacteria | 2311 |
| 577 | Ga0500652_003226 | 3300053131 | Bacteria | 4930 |
| 578 | Ga0500559_0000207 | 3300053136 | Bacteria | 46949 |
| 579 | Ga0500619_000179 | 3300053154 | Bacteria | 15172 |
| 580 | Ga0500622_0005558 | 3300053156 | Bacteria | 7531 |
| 581 | Ga0500622_0008903 | 3300053156 | Bacteria | 5585 |
| 582 | Ga0466962_0004424 | 3300061719 | Bacteria | 6733 |
| 583 | Ga0466962_0008417 | 3300061719 | Bacteria | 4942 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042005 | Ga0439448_0029024 | Ga0439448_0029024_840_1739 | 283 |
| 2 | 3300035116 | Ga0373945_0017245 | Ga0373945_0017245_29_1018 | 293 |
| 3 | 3300013105 | Ga0157369_10005527 | Ga0157369_100055272 | 303 |
| 4 | 3300005366 | Ga0070659_100011514 | Ga0070659_1000115146 | 307 |
| 5 | 3300025932 | Ga0207690_10087560 | Ga0207690_100875602 | 307 |
| 6 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001739 | 314 |
| 7 | 3300005339 | Ga0070660_100002455 | Ga0070660_1000024553 | 314 |
| 8 | 3300005366 | Ga0070659_100050123 | Ga0070659_1000501232 | 314 |
| 9 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021143 | 314 |
| 10 | 3300025919 | Ga0207657_10021758 | Ga0207657_100217583 | 314 |
| 11 | 3300025932 | Ga0207690_10007044 | Ga0207690_100070442 | 314 |
| 12 | 3300039450 | Ga0436363_1720631 | Ga0436363_1720631_1274_2389 | 315 |
| 13 | 3300005345 | Ga0070692_10001641 | Ga0070692_100016411 | 316 |
| 14 | 3300005345 | Ga0070692_10067713 | Ga0070692_100677132 | 316 |
| 15 | 3300021384 | Ga0213876_10000234 | Ga0213876_1000023448 | 321 |
| 16 | 3300039437 | Ga0436365_1041421 | Ga0436365_1041421_44400_45515 | 321 |
| 17 | 3300049824 | Ga0501045_0020912 | Ga0501045_0020912_250_1233 | 322 |
| 18 | 3300049521 | Ga0501298_023927 | Ga0501298_023927_76_1146 | 324 |
| 19 | 3300046684 | Ga0495669_0102301 | Ga0495669_0102301_14_1051 | 327 |
| 20 | 3300037312 | Ga0395899_0260823 | Ga0395899_0260823_24_1061 | 329 |
| 21 | 3300047472 | Ga0495686_0020115 | Ga0495686_0020115_779_1897 | 329 |
| 22 | 3300005366 | Ga0070659_100084405 | Ga0070659_1000844052 | 331 |
| 23 | 3300005457 | Ga0070662_100111891 | Ga0070662_1001118912 | 331 |
| 24 | 3300042012 | Ga0439455_0001540 | Ga0439455_0001540_2307_3374 | 331 |
| 25 | 3300042127 | Ga0450890_000303 | Ga0450890_000303_6060_7097 | 340 |
| 26 | 3300005457 | Ga0070662_100173843 | Ga0070662_1001738432 | 342 |
| 27 | 3300006353 | Ga0075370_10045413 | Ga0075370_100454132 | 342 |
| 28 | 3300013307 | Ga0157372_10332061 | Ga0157372_103320612 | 342 |
| 29 | 3300025904 | Ga0207647_10009993 | Ga0207647_100099932 | 342 |
| 30 | 3300025932 | Ga0207690_10069004 | Ga0207690_100690042 | 342 |
| 31 | 3300025933 | Ga0207706_10078639 | Ga0207706_100786392 | 342 |
| 32 | 3300042005 | Ga0439448_0003000 | Ga0439448_0003000_2602_3708 | 342 |
| 33 | 3300042012 | Ga0439455_0008451 | Ga0439455_0008451_266_1372 | 342 |
| 34 | 3300042157 | Ga0439458_0003441 | Ga0439458_0003441_217_1323 | 342 |
| 35 | 3300050496 | nmdc:mga07m45_41830_c1 | nmdc:mga07m45_41830_c1_634_1740 | 342 |
| 36 | 3300006846 | Ga0075430_100081406 | Ga0075430_1000814062 | 345 |
| 37 | 3300050509 | nmdc:mga0qj67_10567_c1 | nmdc:mga0qj67_10567_c1_1828_2961 | 345 |
| 38 | 3300026067 | Ga0207678_10074445 | Ga0207678_100744452 | 348 |
| 39 | 3300048913 | Ga0496110_0298336 | Ga0496110_0298336_260_1420 | 348 |
| 40 | 3300005841 | Ga0068863_100214598 | Ga0068863_1002145982 | 349 |
| 41 | 3300013308 | Ga0157375_10246415 | Ga0157375_102464152 | 349 |
| 42 | 3300026088 | Ga0207641_10091127 | Ga0207641_100911272 | 349 |
| 43 | 3300028666 | Ga0265336_10000260 | Ga0265336_100002605 | 349 |
| 44 | 3300029957 | Ga0265324_10000004 | Ga0265324_1000000472 | 349 |
| 45 | 3300031241 | Ga0265325_10000084 | Ga0265325_1000008417 | 349 |
| 46 | 3300031711 | Ga0265314_10003721 | Ga0265314_1000372112 | 349 |
| 47 | 3300031711 | Ga0265314_10023534 | Ga0265314_100235344 | 349 |
| 48 | 3300009094 | Ga0111539_10278603 | Ga0111539_102786032 | 350 |
| 49 | 3300009176 | Ga0105242_10065208 | Ga0105242_100652082 | 350 |
| 50 | 3300014326 | Ga0157380_10159123 | Ga0157380_101591232 | 350 |
| 51 | 3300025901 | Ga0207688_10123664 | Ga0207688_101236642 | 350 |
| 52 | 3300025934 | Ga0207686_10162051 | Ga0207686_101620512 | 350 |
| 53 | 3300028380 | Ga0268265_10137353 | Ga0268265_101373531 | 350 |
| 54 | 3300050511 | nmdc:mga08y16_167558_c1 | nmdc:mga08y16_167558_c1_508_1668 | 350 |
| 55 | 3300005331 | Ga0070670_100047892 | Ga0070670_1000478923 | 351 |
| 56 | 3300005364 | Ga0070673_100145175 | Ga0070673_1001451751 | 351 |
| 57 | 3300005618 | Ga0068864_100185634 | Ga0068864_1001856342 | 351 |
| 58 | 3300025925 | Ga0207650_10011535 | Ga0207650_100115355 | 351 |
| 59 | 3300005328 | Ga0070676_10048150 | Ga0070676_100481501 | 354 |
| 60 | 3300005334 | Ga0068869_100045478 | Ga0068869_1000454782 | 354 |
| 61 | 3300005338 | Ga0068868_100004682 | Ga0068868_1000046829 | 354 |
| 62 | 3300005347 | Ga0070668_100089302 | Ga0070668_1000893022 | 354 |
| 63 | 3300005354 | Ga0070675_100023702 | Ga0070675_1000237024 | 354 |
| 64 | 3300005355 | Ga0070671_100163491 | Ga0070671_1001634912 | 354 |
| 65 | 3300005364 | Ga0070673_100168574 | Ga0070673_1001685742 | 354 |
| 66 | 3300005367 | Ga0070667_100008278 | Ga0070667_1000082785 | 354 |
| 67 | 3300005456 | Ga0070678_100037378 | Ga0070678_1000373782 | 354 |
| 68 | 3300005617 | Ga0068859_100004106 | Ga0068859_1000041065 | 354 |
| 69 | 3300005618 | Ga0068864_100015752 | Ga0068864_1000157522 | 354 |
| 70 | 3300005719 | Ga0068861_100169659 | Ga0068861_1001696592 | 354 |
| 71 | 3300005842 | Ga0068858_100012096 | Ga0068858_1000120962 | 354 |
| 72 | 3300006237 | Ga0097621_100098542 | Ga0097621_1000985421 | 354 |
| 73 | 3300006931 | Ga0097620_100004106 | Ga0097620_1000041065 | 354 |
| 74 | 3300009177 | Ga0105248_10217212 | Ga0105248_102172122 | 354 |
| 75 | 3300014325 | Ga0163163_10010636 | Ga0163163_100106364 | 354 |
| 76 | 3300014969 | Ga0157376_10160211 | Ga0157376_101602112 | 354 |
| 77 | 3300025903 | Ga0207680_10025545 | Ga0207680_100255452 | 354 |
| 78 | 3300025926 | Ga0207659_10062520 | Ga0207659_100625202 | 354 |
| 79 | 3300025931 | Ga0207644_10010832 | Ga0207644_100108322 | 354 |
| 80 | 3300025933 | Ga0207706_10029294 | Ga0207706_100292944 | 354 |
| 81 | 3300025934 | Ga0207686_10046424 | Ga0207686_100464242 | 354 |
| 82 | 3300025940 | Ga0207691_10047060 | Ga0207691_100470604 | 354 |
| 83 | 3300025941 | Ga0207711_10127636 | Ga0207711_101276362 | 354 |
| 84 | 3300025942 | Ga0207689_10133268 | Ga0207689_101332682 | 354 |
| 85 | 3300025960 | Ga0207651_10072443 | Ga0207651_100724432 | 354 |
| 86 | 3300025960 | Ga0207651_10090072 | Ga0207651_100900722 | 354 |
| 87 | 3300025986 | Ga0207658_10012649 | Ga0207658_100126491 | 354 |
| 88 | 3300026023 | Ga0207677_10001235 | Ga0207677_100012355 | 354 |
| 89 | 3300026035 | Ga0207703_10003592 | Ga0207703_1000359212 | 354 |
| 90 | 3300026095 | Ga0207676_10071455 | Ga0207676_100714552 | 354 |
| 91 | 3300028379 | Ga0268266_10368889 | Ga0268266_103688891 | 354 |
| 92 | 3300028381 | Ga0268264_10109071 | Ga0268264_101090712 | 354 |
| 93 | 3300048911 | Ga0496108_0030449 | Ga0496108_0030449_1217_2377 | 354 |
| 94 | 3300005331 | Ga0070670_100103908 | Ga0070670_1001039082 | 355 |
| 95 | 3300005364 | Ga0070673_100346518 | Ga0070673_1003465181 | 355 |
| 96 | 3300005367 | Ga0070667_100066028 | Ga0070667_1000660282 | 355 |
| 97 | 3300005843 | Ga0068860_100095196 | Ga0068860_1000951962 | 355 |
| 98 | 3300006237 | Ga0097621_100051214 | Ga0097621_1000512142 | 355 |
| 99 | 3300006358 | Ga0068871_100066434 | Ga0068871_1000664342 | 355 |
| 100 | 3300009098 | Ga0105245_10168911 | Ga0105245_101689112 | 355 |
| 101 | 3300009101 | Ga0105247_10160782 | Ga0105247_101607821 | 355 |
| 102 | 3300009177 | Ga0105248_10091586 | Ga0105248_100915862 | 355 |
| 103 | 3300014968 | Ga0157379_10241264 | Ga0157379_102412642 | 355 |
| 104 | 3300025931 | Ga0207644_10008982 | Ga0207644_100089823 | 355 |
| 105 | 3300025941 | Ga0207711_10008941 | Ga0207711_100089412 | 355 |
| 106 | 3300025960 | Ga0207651_10210910 | Ga0207651_102109102 | 355 |
| 107 | 3300025986 | Ga0207658_10043256 | Ga0207658_100432563 | 355 |
| 108 | 3300026075 | Ga0207708_10094440 | Ga0207708_100944402 | 355 |
| 109 | 3300035725 | Ga0373947_0181787 | Ga0373947_0181787_48_1154 | 356 |
| 110 | 3300005441 | Ga0070700_100215683 | Ga0070700_1002156832 | 357 |
| 111 | 3300009098 | Ga0105245_10155639 | Ga0105245_101556392 | 357 |
| 112 | 3300010375 | Ga0105239_10155046 | Ga0105239_101550462 | 357 |
| 113 | 3300010375 | Ga0105239_10502885 | Ga0105239_105028851 | 357 |
| 114 | 3300013296 | Ga0157374_10146598 | Ga0157374_101465982 | 357 |
| 115 | 3300013297 | Ga0157378_10216026 | Ga0157378_102160262 | 357 |
| 116 | 3300013308 | Ga0157375_10034091 | Ga0157375_100340914 | 357 |
| 117 | 3300025927 | Ga0207687_10077378 | Ga0207687_100773782 | 357 |
| 118 | 3300026075 | Ga0207708_10173994 | Ga0207708_101739942 | 357 |
| 119 | 3300025961 | Ga0207712_10032071 | Ga0207712_100320712 | 358 |
| 120 | 3300003323 | rootH1_10029562 | rootH1_100295622 | 359 |
| 121 | 3300003775 | Ga0055524_1005390 | Ga0055524_10053903 | 359 |
| 122 | 3300003794 | Ga0055531_10004981 | Ga0055531_100049817 | 359 |
| 123 | 3300006944 | Ga0099823_1000002 | Ga0099823_1000002118 | 359 |
| 124 | 3300025273 | Ga0209673_1022780 | Ga0209673_10227802 | 359 |
| 125 | 3300025298 | Ga0209050_1008250 | Ga0209050_10082504 | 359 |
| 126 | 3300025299 | Ga0209256_1003387 | Ga0209256_10033876 | 359 |
| 127 | 3300025303 | Ga0209051_1003541 | Ga0209051_10035413 | 359 |
| 128 | 3300025304 | Ga0209257_1002434 | Ga0209257_10024345 | 359 |
| 129 | 3300027296 | Ga0209389_1031075 | Ga0209389_10310752 | 359 |
| 130 | 3300044694 | Ga0466963_0023171 | Ga0466963_0023171_2446_3600 | 359 |
| 131 | 3300046681 | Ga0495647_0059919 | Ga0495647_0059919_324_1484 | 359 |
| 132 | 3300053156 | Ga0500622_0005558 | Ga0500622_0005558_2881_4035 | 359 |
| 133 | 3300005262 | Ga0065165_1000079 | Ga0065165_100007924 | 360 |
| 134 | 3300025273 | Ga0209673_1022702 | Ga0209673_10227022 | 360 |
| 135 | 3300025295 | Ga0209564_1000030 | Ga0209564_1000030151 | 360 |
| 136 | 3300028800 | Ga0265338_10059826 | Ga0265338_100598264 | 360 |
| 137 | 3300029957 | Ga0265324_10000109 | Ga0265324_1000010925 | 360 |
| 138 | 3300031241 | Ga0265325_10025694 | Ga0265325_100256942 | 360 |
| 139 | 3300031711 | Ga0265314_10000134 | Ga0265314_1000013473 | 360 |
| 140 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_1504265_1505368 | 360 |
| 141 | 3300044673 | Ga0453683_0000013 | Ga0453683_0000013_144822_145925 | 360 |
| 142 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_226008_227111 | 360 |
| 143 | 3300045051 | Ga0451576_0000037 | Ga0451576_0000037_145063_146166 | 360 |
| 144 | 3300048917 | Ga0496114_0169368 | Ga0496114_0169368_338_1498 | 360 |
| 145 | 3300042876 | Ga0451577_0011641 | Ga0451577_0011641_4064_5221 | 361 |
| 146 | 3300005339 | Ga0070660_100025624 | Ga0070660_1000256242 | 362 |
| 147 | 3300025907 | Ga0207645_10153507 | Ga0207645_101535072 | 362 |
| 148 | 3300025909 | Ga0207705_10041865 | Ga0207705_100418652 | 362 |
| 149 | 3300028666 | Ga0265336_10000030 | Ga0265336_10000030135 | 362 |
| 150 | 3300029957 | Ga0265324_10000522 | Ga0265324_1000052211 | 362 |
| 151 | 3300005618 | Ga0068864_100132919 | Ga0068864_1001329192 | 363 |
| 152 | 3300042012 | Ga0439455_0015604 | Ga0439455_0015604_478_1635 | 363 |
| 153 | 3300044712 | Ga0453684_0293421 | Ga0453684_0293421_706_1812 | 363 |
| 154 | 3300009147 | Ga0114129_10067923 | Ga0114129_100679234 | 364 |
| 155 | 3300025919 | Ga0207657_10036415 | Ga0207657_100364154 | 364 |
| 156 | 3300032004 | Ga0307414_10191882 | Ga0307414_101918822 | 364 |
| 157 | 3300044712 | Ga0453684_0040217 | Ga0453684_0040217_3245_4399 | 364 |
| 158 | 3300050507 | nmdc:mga05p37_147209_c1 | nmdc:mga05p37_147209_c1_1015_2172 | 364 |
| 159 | 3300025253 | Ga0209677_105636 | Ga0209677_1056362 | 365 |
| 160 | 3300028794 | Ga0307515_10061615 | Ga0307515_100616152 | 365 |
| 161 | 3300035172 | Ga0373955_0071005 | Ga0373955_0071005_144_1304 | 365 |
| 162 | 3300035695 | Ga0373927_0067846 | Ga0373927_0067846_388_1548 | 365 |
| 163 | 3300053085 | Ga0495619_0252430 | Ga0495619_0252430_50_1210 | 365 |
| 164 | 3300025256 | Ga0209759_1013534 | Ga0209759_10135342 | 366 |
| 165 | 3300046506 | Ga0495583_0000022 | Ga0495583_0000022_276536_277690 | 366 |
| 166 | 3300046507 | Ga0495606_0006644 | Ga0495606_0006644_4702_5856 | 366 |
| 167 | 3300046660 | Ga0495625_0028632 | Ga0495625_0028632_2963_4117 | 366 |
| 168 | 3300046694 | Ga0495649_0000276 | Ga0495649_0000276_5401_6555 | 366 |
| 169 | 3300048918 | Ga0496115_0109451 | Ga0496115_0109451_1075_2229 | 366 |
| 170 | 3300005327 | Ga0070658_10042789 | Ga0070658_100427892 | 367 |
| 171 | 3300021361 | Ga0213872_10000286 | Ga0213872_1000028628 | 367 |
| 172 | 3300025908 | Ga0207643_10117579 | Ga0207643_101175792 | 367 |
| 173 | 3300039447 | Ga0436361_0147565 | Ga0436361_0147565_47046_48200 | 367 |
| 174 | 3300039447 | Ga0436361_1129825 | Ga0436361_1129825_1914_3068 | 367 |
| 175 | 3300005614 | Ga0068856_100037290 | Ga0068856_1000372902 | 368 |
| 176 | 3300026078 | Ga0207702_10056893 | Ga0207702_100568932 | 368 |
| 177 | 3300031548 | Ga0307408_100035791 | Ga0307408_1000357912 | 368 |
| 178 | 3300031901 | Ga0307406_10086629 | Ga0307406_100866292 | 368 |
| 179 | 3300032002 | Ga0307416_100212879 | Ga0307416_1002128791 | 368 |
| 180 | 3300032005 | Ga0307411_10302992 | Ga0307411_103029921 | 368 |
| 181 | 3300037466 | Ga0395898_0120447 | Ga0395898_0120447_333_1487 | 368 |
| 182 | 3300038443 | Ga0395901_0022909 | Ga0395901_0022909_4946_6100 | 368 |
| 183 | 3300031731 | Ga0307405_10006527 | Ga0307405_100065275 | 370 |
| 184 | 3300031824 | Ga0307413_10152474 | Ga0307413_101524742 | 370 |
| 185 | 3300031852 | Ga0307410_10006677 | Ga0307410_100066773 | 370 |
| 186 | 3300031901 | Ga0307406_10004814 | Ga0307406_100048144 | 370 |
| 187 | 3300031911 | Ga0307412_10007849 | Ga0307412_100078492 | 370 |
| 188 | 3300032002 | Ga0307416_100046031 | Ga0307416_1000460311 | 370 |
| 189 | 3300032004 | Ga0307414_10021756 | Ga0307414_100217562 | 370 |
| 190 | 3300032005 | Ga0307411_10144737 | Ga0307411_101447372 | 370 |
| 191 | 3300036401 | Ga0373937_0158361 | Ga0373937_0158361_234_1394 | 370 |
| 192 | 3300048904 | Ga0496101_0134419 | Ga0496101_0134419_538_1698 | 370 |
| 193 | 3300005457 | Ga0070662_100002087 | Ga0070662_1000020872 | 371 |
| 194 | 3300025920 | Ga0207649_10099654 | Ga0207649_100996542 | 371 |
| 195 | 3300025933 | Ga0207706_10002326 | Ga0207706_100023262 | 371 |
| 196 | 3300028794 | Ga0307515_10075820 | Ga0307515_100758203 | 371 |
| 197 | 3300031456 | Ga0307513_10079132 | Ga0307513_100791322 | 371 |
| 198 | 3300042125 | Ga0450923_002188 | Ga0450923_002188_1615_2745 | 371 |
| 199 | 3300035695 | Ga0373927_0041637 | Ga0373927_0041637_1649_2803 | 372 |
| 200 | 3300037068 | Ga0373925_0020505 | Ga0373925_0020505_1790_2944 | 372 |
| 201 | 3300006353 | Ga0075370_10035225 | Ga0075370_100352253 | 373 |
| 202 | 3300025893 | Ga0207682_10007238 | Ga0207682_100072384 | 373 |
| 203 | 3300028794 | Ga0307515_10034662 | Ga0307515_100346628 | 373 |
| 204 | 3300031507 | Ga0307509_10045186 | Ga0307509_100451864 | 373 |
| 205 | 3300031507 | Ga0307509_10046455 | Ga0307509_100464555 | 373 |
| 206 | 3300031507 | Ga0307509_10075676 | Ga0307509_100756762 | 373 |
| 207 | 3300031507 | Ga0307509_10080732 | Ga0307509_100807322 | 373 |
| 208 | 3300031616 | Ga0307508_10000048 | Ga0307508_1000004837 | 373 |
| 209 | 3300031616 | Ga0307508_10157944 | Ga0307508_101579442 | 373 |
| 210 | 3300044656 | Ga0466969_0007097 | Ga0466969_0007097_1838_2989 | 373 |
| 211 | 3300044693 | Ga0466961_0008485 | Ga0466961_0008485_1616_2767 | 373 |
| 212 | 3300044706 | Ga0466964_0038300 | Ga0466964_0038300_568_1719 | 373 |
| 213 | 3300045049 | Ga0466959_0019638 | Ga0466959_0019638_2829_3980 | 373 |
| 214 | 3300046519 | Ga0495632_0004037 | Ga0495632_0004037_6006_7160 | 373 |
| 215 | 3300050496 | nmdc:mga07m45_13510_c2 | nmdc:mga07m45_13510_c2_371_1525 | 373 |
| 216 | 3300053088 | Ga0500644_0016764 | Ga0500644_0016764_243_1397 | 373 |
| 217 | 3300053131 | Ga0500652_003226 | Ga0500652_003226_1059_2213 | 373 |
| 218 | 3300061719 | Ga0466962_0004424 | Ga0466962_0004424_5571_6722 | 373 |
| 219 | 3300025931 | Ga0207644_10151195 | Ga0207644_101511952 | 374 |
| 220 | 3300028794 | Ga0307515_10000013 | Ga0307515_10000013515 | 374 |
| 221 | 3300028794 | Ga0307515_10000239 | Ga0307515_10000239114 | 374 |
| 222 | 3300003791 | Ga0055530_10017992 | Ga0055530_100179922 | 375 |
| 223 | 3300005262 | Ga0065165_1001510 | Ga0065165_100151018 | 375 |
| 224 | iso_pu_bacteria | 2585428057 | 2587727311 | 375 |
| 225 | iso_pu_bacteria | 2585428058 | 2587735939 | 375 |
| 226 | iso_pu_bacteria | 2585428062 | 2587757847 | 375 |
| 227 | iso_pu_bacteria | 2588253510 | 2588292660 | 375 |
| 228 | iso_pu_bacteria | 2643221592 | 2643967240 | 375 |
| 229 | iso_pu_bacteria | 2643221625 | 2644140071 | 375 |
| 230 | iso_pu_bacteria | 2643221648 | 2644271311 | 375 |
| 231 | iso_pu_bacteria | 2831864461 | 2831865442 | 375 |
| 232 | iso_pu_bacteria | 2886848708 | 2886849919 | 375 |
| 233 | 3300025298 | Ga0209050_1000614 | Ga0209050_100061439 | 376 |
| 234 | 3300031507 | Ga0307509_10000135 | Ga0307509_1000013522 | 376 |
| 235 | 3300033180 | Ga0307510_10024531 | Ga0307510_100245312 | 376 |
| 236 | 3300033180 | Ga0307510_10033752 | Ga0307510_100337524 | 376 |
| 237 | 3300046454 | Ga0495592_0000185 | Ga0495592_0000185_36926_38080 | 376 |
| 238 | 3300053086 | Ga0500578_0003965 | Ga0500578_0003965_8355_9509 | 376 |
| 239 | 3300053093 | Ga0500651_0019099 | Ga0500651_0019099_2243_3397 | 376 |
| 240 | 3300053118 | Ga0500594_0001006 | Ga0500594_0001006_2540_3694 | 376 |
| 241 | 3300053130 | Ga0500642_0028248 | Ga0500642_0028248_128_1282 | 376 |
| 242 | 3300053136 | Ga0500559_0000207 | Ga0500559_0000207_41311_42465 | 376 |
| 243 | 3300053156 | Ga0500622_0008903 | Ga0500622_0008903_4382_5536 | 376 |
| 244 | iso_pu_bacteria | 2643221644 | 2644245983 | 376 |
| 245 | iso_pu_bacteria | 2643221654 | 2644305520 | 376 |
| 246 | 3300001979 | JGI24740J21852_10044089 | JGI24740J21852_100440891 | 377 |
| 247 | 3300025981 | Ga0207640_10263626 | Ga0207640_102636261 | 377 |
| 248 | 3300005354 | Ga0070675_100092899 | Ga0070675_1000928992 | 378 |
| 249 | 3300005543 | Ga0070672_100150107 | Ga0070672_1001501072 | 378 |
| 250 | 3300006178 | Ga0075367_10094174 | Ga0075367_100941742 | 378 |
| 251 | 3300014969 | Ga0157376_10031404 | Ga0157376_100314043 | 378 |
| 252 | 3300021361 | Ga0213872_10000510 | Ga0213872_100005109 | 378 |
| 253 | 3300025230 | Ga0209563_100014 | Ga0209563_100014765 | 378 |
| 254 | 3300025321 | Ga0207656_10020347 | Ga0207656_100203472 | 378 |
| 255 | 3300026095 | Ga0207676_10020271 | Ga0207676_100202712 | 378 |
| 256 | 3300028794 | Ga0307515_10000179 | Ga0307515_10000179124 | 378 |
| 257 | 3300028794 | Ga0307515_10001166 | Ga0307515_1000116628 | 378 |
| 258 | 3300028794 | Ga0307515_10019026 | Ga0307515_100190269 | 378 |
| 259 | 3300030522 | Ga0307512_10029280 | Ga0307512_100292802 | 378 |
| 260 | 3300031456 | Ga0307513_10110681 | Ga0307513_101106811 | 378 |
| 261 | 3300031507 | Ga0307509_10082225 | Ga0307509_100822252 | 378 |
| 262 | 3300031616 | Ga0307508_10000122 | Ga0307508_1000012266 | 378 |
| 263 | 3300031730 | Ga0307516_10005879 | Ga0307516_1000587912 | 378 |
| 264 | 3300033179 | Ga0307507_10014209 | Ga0307507_100142091 | 378 |
| 265 | 3300035091 | Ga0373951_0012000 | Ga0373951_0012000_711_1865 | 378 |
| 266 | 3300035114 | Ga0373939_0000003 | Ga0373939_0000003_71825_72979 | 378 |
| 267 | 3300035121 | Ga0373960_0001502 | Ga0373960_0001502_3061_4215 | 378 |
| 268 | 3300035691 | Ga0373931_0001000 | Ga0373931_0001000_3250_4404 | 378 |
| 269 | 3300035692 | Ga0373935_0161176 | Ga0373935_0161176_12_1172 | 378 |
| 270 | 3300036401 | Ga0373937_0177245 | Ga0373937_0177245_514_1674 | 378 |
| 271 | 3300037471 | Ga0395905_0004009 | Ga0395905_0004009_4427_5578 | 378 |
| 272 | 3300039447 | Ga0436361_0372090 | Ga0436361_0372090_19511_20665 | 378 |
| 273 | 3300044656 | Ga0466969_0000009 | Ga0466969_0000009_103785_104936 | 378 |
| 274 | 3300045049 | Ga0466959_0014467 | Ga0466959_0014467_460_1611 | 378 |
| 275 | 3300046660 | Ga0495625_0006884 | Ga0495625_0006884_4715_5869 | 378 |
| 276 | 3300046683 | Ga0495658_0057116 | Ga0495658_0057116_55_1215 | 378 |
| 277 | 3300053077 | Ga0495601_0082724 | Ga0495601_0082724_316_1476 | 378 |
| 278 | 3300002738 | JGI25154J39366_1000937 | JGI25154J39366_100093711 | 379 |
| 279 | 3300002741 | JGI25157J39369_1000361 | JGI25157J39369_100036128 | 379 |
| 280 | 3300002772 | JGI25164J39214_1005709 | JGI25164J39214_10057091 | 379 |
| 281 | 3300002773 | JGI25152J39213_1001024 | JGI25152J39213_10010248 | 379 |
| 282 | 3300003215 | JGI25153J46596_10000904 | JGI25153J46596_100009042 | 379 |
| 283 | 3300003215 | JGI25153J46596_10012019 | JGI25153J46596_100120192 | 379 |
| 284 | 3300003322 | rootL2_10059169 | rootL2_100591693 | 379 |
| 285 | 3300003756 | Ga0055533_1000048 | Ga0055533_100004877 | 379 |
| 286 | 3300003756 | Ga0055533_1000068 | Ga0055533_10000686 | 379 |
| 287 | 3300003759 | Ga0055525_1001441 | Ga0055525_10014413 | 379 |
| 288 | 3300003761 | Ga0055535_1000917 | Ga0055535_10009172 | 379 |
| 289 | 3300003763 | Ga0055529_1000291 | Ga0055529_100029118 | 379 |
| 290 | 3300003771 | Ga0055526_1001136 | Ga0055526_10011369 | 379 |
| 291 | 3300003775 | Ga0055524_1001779 | Ga0055524_10017795 | 379 |
| 292 | 3300003794 | Ga0055531_10012094 | Ga0055531_100120942 | 379 |
| 293 | 3300005262 | Ga0065165_1002283 | Ga0065165_100228311 | 379 |
| 294 | 3300005295 | Ga0065707_10090986 | Ga0065707_100909862 | 379 |
| 295 | 3300005334 | Ga0068869_100065020 | Ga0068869_1000650202 | 379 |
| 296 | 3300005336 | Ga0070680_100072767 | Ga0070680_1000727672 | 379 |
| 297 | 3300005338 | Ga0068868_100022229 | Ga0068868_1000222292 | 379 |
| 298 | 3300005338 | Ga0068868_100030420 | Ga0068868_1000304205 | 379 |
| 299 | 3300005339 | Ga0070660_100026263 | Ga0070660_1000262633 | 379 |
| 300 | 3300005339 | Ga0070660_100090110 | Ga0070660_1000901102 | 379 |
| 301 | 3300005344 | Ga0070661_100068331 | Ga0070661_1000683312 | 379 |
| 302 | 3300005354 | Ga0070675_100016355 | Ga0070675_1000163555 | 379 |
| 303 | 3300005355 | Ga0070671_100075394 | Ga0070671_1000753942 | 379 |
| 304 | 3300005364 | Ga0070673_100028817 | Ga0070673_1000288173 | 379 |
| 305 | 3300005367 | Ga0070667_100224342 | Ga0070667_1002243422 | 379 |
| 306 | 3300005455 | Ga0070663_100046195 | Ga0070663_1000461952 | 379 |
| 307 | 3300005455 | Ga0070663_100068556 | Ga0070663_1000685561 | 379 |
| 308 | 3300005456 | Ga0070678_100095910 | Ga0070678_1000959101 | 379 |
| 309 | 3300005457 | Ga0070662_100001972 | Ga0070662_10000197214 | 379 |
| 310 | 3300005459 | Ga0068867_100000074 | Ga0068867_10000007417 | 379 |
| 311 | 3300005459 | Ga0068867_100016932 | Ga0068867_1000169324 | 379 |
| 312 | 3300005459 | Ga0068867_100019791 | Ga0068867_1000197913 | 379 |
| 313 | 3300005459 | Ga0068867_100100750 | Ga0068867_1001007502 | 379 |
| 314 | 3300005467 | Ga0070706_100001812 | Ga0070706_10000181215 | 379 |
| 315 | 3300005468 | Ga0070707_100065034 | Ga0070707_1000650342 | 379 |
| 316 | 3300005530 | Ga0070679_100061522 | Ga0070679_1000615221 | 379 |
| 317 | 3300005539 | Ga0068853_100077897 | Ga0068853_1000778972 | 379 |
| 318 | 3300005539 | Ga0068853_100222775 | Ga0068853_1002227752 | 379 |
| 319 | 3300005548 | Ga0070665_100038822 | Ga0070665_1000388224 | 379 |
| 320 | 3300005563 | Ga0068855_100056191 | Ga0068855_1000561913 | 379 |
| 321 | 3300005563 | Ga0068855_100076382 | Ga0068855_1000763822 | 379 |
| 322 | 3300005564 | Ga0070664_100134325 | Ga0070664_1001343251 | 379 |
| 323 | 3300005577 | Ga0068857_100004217 | Ga0068857_1000042175 | 379 |
| 324 | 3300005577 | Ga0068857_100013612 | Ga0068857_1000136124 | 379 |
| 325 | 3300005577 | Ga0068857_100048921 | Ga0068857_1000489213 | 379 |
| 326 | 3300005578 | Ga0068854_100045107 | Ga0068854_1000451072 | 379 |
| 327 | 3300005578 | Ga0068854_100047902 | Ga0068854_1000479022 | 379 |
| 328 | 3300005614 | Ga0068856_100001787 | Ga0068856_10000178717 | 379 |
| 329 | 3300005614 | Ga0068856_100116430 | Ga0068856_1001164302 | 379 |
| 330 | 3300005616 | Ga0068852_100092002 | Ga0068852_1000920022 | 379 |
| 331 | 3300005616 | Ga0068852_100126431 | Ga0068852_1001264312 | 379 |
| 332 | 3300005616 | Ga0068852_100173945 | Ga0068852_1001739452 | 379 |
| 333 | 3300005616 | Ga0068852_100233945 | Ga0068852_1002339452 | 379 |
| 334 | 3300005616 | Ga0068852_100481171 | Ga0068852_1004811711 | 379 |
| 335 | 3300005618 | Ga0068864_100315504 | Ga0068864_1003155042 | 379 |
| 336 | 3300005719 | Ga0068861_100012599 | Ga0068861_1000125995 | 379 |
| 337 | 3300005841 | Ga0068863_100018149 | Ga0068863_1000181495 | 379 |
| 338 | 3300005842 | Ga0068858_100212585 | Ga0068858_1002125852 | 379 |
| 339 | 3300005843 | Ga0068860_100036624 | Ga0068860_1000366242 | 379 |
| 340 | 3300005844 | Ga0068862_100016050 | Ga0068862_1000160503 | 379 |
| 341 | 3300005844 | Ga0068862_100050997 | Ga0068862_1000509974 | 379 |
| 342 | 3300006038 | Ga0075365_10044946 | Ga0075365_100449463 | 379 |
| 343 | 3300006042 | Ga0075368_10007764 | Ga0075368_100077642 | 379 |
| 344 | 3300006048 | Ga0075363_100027136 | Ga0075363_1000271362 | 379 |
| 345 | 3300006177 | Ga0075362_10005083 | Ga0075362_100050834 | 379 |
| 346 | 3300006178 | Ga0075367_10003757 | Ga0075367_100037575 | 379 |
| 347 | 3300006178 | Ga0075367_10008433 | Ga0075367_100084332 | 379 |
| 348 | 3300006178 | Ga0075367_10015315 | Ga0075367_100153153 | 379 |
| 349 | 3300006178 | Ga0075367_10173251 | Ga0075367_101732512 | 379 |
| 350 | 3300006186 | Ga0075369_10001649 | Ga0075369_100016492 | 379 |
| 351 | 3300006195 | Ga0075366_10014272 | Ga0075366_100142722 | 379 |
| 352 | 3300006195 | Ga0075366_10034757 | Ga0075366_100347572 | 379 |
| 353 | 3300006195 | Ga0075366_10137035 | Ga0075366_101370352 | 379 |
| 354 | 3300006237 | Ga0097621_100064663 | Ga0097621_1000646632 | 379 |
| 355 | 3300006353 | Ga0075370_10002473 | Ga0075370_100024738 | 379 |
| 356 | 3300006353 | Ga0075370_10003868 | Ga0075370_100038683 | 379 |
| 357 | 3300006353 | Ga0075370_10008355 | Ga0075370_100083552 | 379 |
| 358 | 3300006353 | Ga0075370_10010033 | Ga0075370_100100332 | 379 |
| 359 | 3300006846 | Ga0075430_100012408 | Ga0075430_1000124084 | 379 |
| 360 | 3300006880 | Ga0075429_100000549 | Ga0075429_10000054918 | 379 |
| 361 | 3300009093 | Ga0105240_10050356 | Ga0105240_100503562 | 379 |
| 362 | 3300009098 | Ga0105245_10098671 | Ga0105245_100986712 | 379 |
| 363 | 3300009148 | Ga0105243_10013068 | Ga0105243_100130683 | 379 |
| 364 | 3300009148 | Ga0105243_10070295 | Ga0105243_100702953 | 379 |
| 365 | 3300009174 | Ga0105241_10034699 | Ga0105241_100346992 | 379 |
| 366 | 3300009545 | Ga0105237_10083448 | Ga0105237_100834482 | 379 |
| 367 | 3300009545 | Ga0105237_10314085 | Ga0105237_103140852 | 379 |
| 368 | 3300010375 | Ga0105239_10037165 | Ga0105239_100371654 | 379 |
| 369 | 3300010375 | Ga0105239_10055004 | Ga0105239_100550042 | 379 |
| 370 | 3300010375 | Ga0105239_10369365 | Ga0105239_103693652 | 379 |
| 371 | 3300011119 | Ga0105246_10052639 | Ga0105246_100526392 | 379 |
| 372 | 3300012497 | Ga0157319_1000007 | Ga0157319_100000784 | 379 |
| 373 | 3300013100 | Ga0157373_10056067 | Ga0157373_100560672 | 379 |
| 374 | 3300013105 | Ga0157369_10113559 | Ga0157369_101135592 | 379 |
| 375 | 3300013296 | Ga0157374_10168961 | Ga0157374_101689612 | 379 |
| 376 | 3300013306 | Ga0163162_10151886 | Ga0163162_101518862 | 379 |
| 377 | 3300013308 | Ga0157375_10387732 | Ga0157375_103877322 | 379 |
| 378 | 3300014745 | Ga0157377_10000006 | Ga0157377_100000068 | 379 |
| 379 | 3300014968 | Ga0157379_10058377 | Ga0157379_100583773 | 379 |
| 380 | 3300014969 | Ga0157376_10161544 | Ga0157376_101615442 | 379 |
| 381 | 3300017792 | Ga0163161_10096385 | Ga0163161_100963852 | 379 |
| 382 | 3300021384 | Ga0213876_10015405 | Ga0213876_100154051 | 379 |
| 383 | 3300025226 | Ga0209674_100024 | Ga0209674_100024374 | 379 |
| 384 | 3300025230 | Ga0209563_100101 | Ga0209563_1001016 | 379 |
| 385 | 3300025242 | Ga0209258_100180 | Ga0209258_10018066 | 379 |
| 386 | 3300025242 | Ga0209258_100777 | Ga0209258_1007772 | 379 |
| 387 | 3300025246 | Ga0209646_1000012 | Ga0209646_1000012134 | 379 |
| 388 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004483 | 379 |
| 389 | 3300025253 | Ga0209677_100091 | Ga0209677_100091106 | 379 |
| 390 | 3300025253 | Ga0209677_101750 | Ga0209677_1017505 | 379 |
| 391 | 3300025254 | Ga0209148_1006729 | Ga0209148_10067292 | 379 |
| 392 | 3300025256 | Ga0209759_1000003 | Ga0209759_1000003242 | 379 |
| 393 | 3300025256 | Ga0209759_1000067 | Ga0209759_1000067173 | 379 |
| 394 | 3300025256 | Ga0209759_1001906 | Ga0209759_10019062 | 379 |
| 395 | 3300025256 | Ga0209759_1008275 | Ga0209759_10082752 | 379 |
| 396 | 3300025258 | Ga0209129_1000035 | Ga0209129_1000035217 | 379 |
| 397 | 3300025272 | Ga0209455_1000144 | Ga0209455_100014466 | 379 |
| 398 | 3300025273 | Ga0209673_1014757 | Ga0209673_10147572 | 379 |
| 399 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024411 | 379 |
| 400 | 3300025297 | Ga0209758_1000066 | Ga0209758_1000066101 | 379 |
| 401 | 3300025297 | Ga0209758_1000248 | Ga0209758_100024865 | 379 |
| 402 | 3300025299 | Ga0209256_1000197 | Ga0209256_10001977 | 379 |
| 403 | 3300025299 | Ga0209256_1027942 | Ga0209256_10279421 | 379 |
| 404 | 3300025303 | Ga0209051_1002061 | Ga0209051_100206111 | 379 |
| 405 | 3300025303 | Ga0209051_1002964 | Ga0209051_10029647 | 379 |
| 406 | 3300025304 | Ga0209257_1004130 | Ga0209257_10041307 | 379 |
| 407 | 3300025910 | Ga0207684_10005403 | Ga0207684_1000540312 | 379 |
| 408 | 3300025913 | Ga0207695_10026886 | Ga0207695_100268865 | 379 |
| 409 | 3300025913 | Ga0207695_10071453 | Ga0207695_100714532 | 379 |
| 410 | 3300025913 | Ga0207695_10075293 | Ga0207695_100752932 | 379 |
| 411 | 3300025914 | Ga0207671_10034414 | Ga0207671_100344143 | 379 |
| 412 | 3300025914 | Ga0207671_10034539 | Ga0207671_100345392 | 379 |
| 413 | 3300025918 | Ga0207662_10078340 | Ga0207662_100783402 | 379 |
| 414 | 3300025919 | Ga0207657_10149925 | Ga0207657_101499252 | 379 |
| 415 | 3300025919 | Ga0207657_10300196 | Ga0207657_103001961 | 379 |
| 416 | 3300025920 | Ga0207649_10082794 | Ga0207649_100827942 | 379 |
| 417 | 3300025922 | Ga0207646_10025442 | Ga0207646_100254422 | 379 |
| 418 | 3300025923 | Ga0207681_10040776 | Ga0207681_100407762 | 379 |
| 419 | 3300025924 | Ga0207694_10113511 | Ga0207694_101135112 | 379 |
| 420 | 3300025926 | Ga0207659_10053395 | Ga0207659_100533952 | 379 |
| 421 | 3300025927 | Ga0207687_10235178 | Ga0207687_102351782 | 379 |
| 422 | 3300025931 | Ga0207644_10021081 | Ga0207644_100210813 | 379 |
| 423 | 3300025931 | Ga0207644_10044828 | Ga0207644_100448283 | 379 |
| 424 | 3300025932 | Ga0207690_10155333 | Ga0207690_101553331 | 379 |
| 425 | 3300025933 | Ga0207706_10025882 | Ga0207706_100258822 | 379 |
| 426 | 3300025933 | Ga0207706_10066743 | Ga0207706_100667432 | 379 |
| 427 | 3300025935 | Ga0207709_10007745 | Ga0207709_100077454 | 379 |
| 428 | 3300025935 | Ga0207709_10208528 | Ga0207709_102085282 | 379 |
| 429 | 3300025942 | Ga0207689_10018619 | Ga0207689_100186192 | 379 |
| 430 | 3300025944 | Ga0207661_10105194 | Ga0207661_101051942 | 379 |
| 431 | 3300025945 | Ga0207679_10010126 | Ga0207679_100101265 | 379 |
| 432 | 3300025949 | Ga0207667_10021849 | Ga0207667_100218492 | 379 |
| 433 | 3300025960 | Ga0207651_10018533 | Ga0207651_100185333 | 379 |
| 434 | 3300025981 | Ga0207640_10007735 | Ga0207640_100077353 | 379 |
| 435 | 3300025986 | Ga0207658_10244092 | Ga0207658_102440922 | 379 |
| 436 | 3300026023 | Ga0207677_10014267 | Ga0207677_100142674 | 379 |
| 437 | 3300026023 | Ga0207677_10125475 | Ga0207677_101254752 | 379 |
| 438 | 3300026041 | Ga0207639_10299319 | Ga0207639_102993192 | 379 |
| 439 | 3300026067 | Ga0207678_10083994 | Ga0207678_100839941 | 379 |
| 440 | 3300026067 | Ga0207678_10124281 | Ga0207678_101242812 | 379 |
| 441 | 3300026078 | Ga0207702_10000033 | Ga0207702_1000003310 | 379 |
| 442 | 3300026089 | Ga0207648_10000039 | Ga0207648_1000003960 | 379 |
| 443 | 3300026089 | Ga0207648_10051426 | Ga0207648_100514263 | 379 |
| 444 | 3300026089 | Ga0207648_10060172 | Ga0207648_100601722 | 379 |
| 445 | 3300026089 | Ga0207648_10068722 | Ga0207648_100687222 | 379 |
| 446 | 3300026095 | Ga0207676_10011369 | Ga0207676_100113694 | 379 |
| 447 | 3300026116 | Ga0207674_10004849 | Ga0207674_1000484916 | 379 |
| 448 | 3300026116 | Ga0207674_10017935 | Ga0207674_100179352 | 379 |
| 449 | 3300026116 | Ga0207674_10039358 | Ga0207674_100393585 | 379 |
| 450 | 3300026116 | Ga0207674_10084515 | Ga0207674_100845152 | 379 |
| 451 | 3300026116 | Ga0207674_10184103 | Ga0207674_101841032 | 379 |
| 452 | 3300026118 | Ga0207675_100018234 | Ga0207675_1000182342 | 379 |
| 453 | 3300026118 | Ga0207675_100022435 | Ga0207675_1000224355 | 379 |
| 454 | 3300026121 | Ga0207683_10124007 | Ga0207683_101240071 | 379 |
| 455 | 3300026142 | Ga0207698_10033942 | Ga0207698_100339423 | 379 |
| 456 | 3300026142 | Ga0207698_10320971 | Ga0207698_103209712 | 379 |
| 457 | 3300026142 | Ga0207698_10365989 | Ga0207698_103659891 | 379 |
| 458 | 3300028379 | Ga0268266_10201755 | Ga0268266_102017552 | 379 |
| 459 | 3300028380 | Ga0268265_10055489 | Ga0268265_100554891 | 379 |
| 460 | 3300028381 | Ga0268264_10053035 | Ga0268264_100530352 | 379 |
| 461 | 3300028786 | Ga0307517_10003885 | Ga0307517_1000388519 | 379 |
| 462 | 3300028786 | Ga0307517_10103686 | Ga0307517_101036862 | 379 |
| 463 | 3300028786 | Ga0307517_10117758 | Ga0307517_101177582 | 379 |
| 464 | 3300028794 | Ga0307515_10021584 | Ga0307515_100215842 | 379 |
| 465 | 3300028794 | Ga0307515_10074489 | Ga0307515_100744892 | 379 |
| 466 | 3300029957 | Ga0265324_10060151 | Ga0265324_100601511 | 379 |
| 467 | 3300031507 | Ga0307509_10083895 | Ga0307509_100838952 | 379 |
| 468 | 3300031507 | Ga0307509_10143228 | Ga0307509_101432282 | 379 |
| 469 | 3300031548 | Ga0307408_100002033 | Ga0307408_1000020337 | 379 |
| 470 | 3300031548 | Ga0307408_100271452 | Ga0307408_1002714521 | 379 |
| 471 | 3300031649 | Ga0307514_10000595 | Ga0307514_1000059518 | 379 |
| 472 | 3300031649 | Ga0307514_10144322 | Ga0307514_101443222 | 379 |
| 473 | 3300031730 | Ga0307516_10000243 | Ga0307516_1000024314 | 379 |
| 474 | 3300031730 | Ga0307516_10000942 | Ga0307516_100009425 | 379 |
| 475 | 3300031730 | Ga0307516_10049504 | Ga0307516_100495042 | 379 |
| 476 | 3300031731 | Ga0307405_10052799 | Ga0307405_100527992 | 379 |
| 477 | 3300031911 | Ga0307412_10025572 | Ga0307412_100255722 | 379 |
| 478 | 3300031995 | Ga0307409_100000263 | Ga0307409_1000002632 | 379 |
| 479 | 3300032002 | Ga0307416_100010747 | Ga0307416_1000107475 | 379 |
| 480 | 3300032126 | Ga0307415_100002117 | Ga0307415_1000021172 | 379 |
| 481 | 3300033180 | Ga0307510_10019100 | Ga0307510_100191007 | 379 |
| 482 | 3300034957 | Ga0373938_0004483 | Ga0373938_0004483_352_1506 | 379 |
| 483 | 3300035691 | Ga0373931_0001994 | Ga0373931_0001994_3755_4918 | 379 |
| 484 | 3300035691 | Ga0373931_0034620 | Ga0373931_0034620_73_1227 | 379 |
| 485 | 3300036401 | Ga0373937_0083668 | Ga0373937_0083668_82_1236 | 379 |
| 486 | 3300036401 | Ga0373937_0171685 | Ga0373937_0171685_347_1501 | 379 |
| 487 | 3300037068 | Ga0373925_0006787 | Ga0373925_0006787_7147_8301 | 379 |
| 488 | 3300037471 | Ga0395905_0027724 | Ga0395905_0027724_499_1656 | 379 |
| 489 | 3300039437 | Ga0436365_0730430 | Ga0436365_0730430_2105_3268 | 379 |
| 490 | 3300039447 | Ga0436361_0602459 | Ga0436361_0602459_1907_3061 | 379 |
| 491 | 3300039450 | Ga0436363_1578616 | Ga0436363_1578616_695_1858 | 379 |
| 492 | 3300042438 | Ga0439459_0000614 | Ga0439459_0000614_270_1424 | 379 |
| 493 | 3300042876 | Ga0451577_0005990 | Ga0451577_0005990_4140_5294 | 379 |
| 494 | 3300042876 | Ga0451577_0021420 | Ga0451577_0021420_416_1576 | 379 |
| 495 | 3300042876 | Ga0451577_0228983 | Ga0451577_0228983_190_1350 | 379 |
| 496 | 3300044656 | Ga0466969_0027851 | Ga0466969_0027851_134_1288 | 379 |
| 497 | 3300044658 | Ga0466972_0005323 | Ga0466972_0005323_1471_2625 | 379 |
| 498 | 3300044683 | Ga0466965_0097007 | Ga0466965_0097007_34_1188 | 379 |
| 499 | 3300044684 | Ga0466966_0000566 | Ga0466966_0000566_3877_5031 | 379 |
| 500 | 3300044694 | Ga0466963_0197183 | Ga0466963_0197183_51_1205 | 379 |
| 501 | 3300044706 | Ga0466964_0002753 | Ga0466964_0002753_4371_5525 | 379 |
| 502 | 3300044719 | Ga0466971_0069364 | Ga0466971_0069364_120_1274 | 379 |
| 503 | 3300044765 | Ga0466970_0132918 | Ga0466970_0132918_41_1195 | 379 |
| 504 | 3300044842 | Ga0466957_0096502 | Ga0466957_0096502_97_1251 | 379 |
| 505 | 3300045049 | Ga0466959_0155875 | Ga0466959_0155875_357_1511 | 379 |
| 506 | 3300045051 | Ga0451576_0011961 | Ga0451576_0011961_4044_5198 | 379 |
| 507 | 3300046457 | Ga0495590_0003929 | Ga0495590_0003929_4650_5804 | 379 |
| 508 | 3300046507 | Ga0495606_0089597 | Ga0495606_0089597_648_1802 | 379 |
| 509 | 3300046512 | Ga0495610_0040794 | Ga0495610_0040794_599_1753 | 379 |
| 510 | 3300046519 | Ga0495632_0005415 | Ga0495632_0005415_3961_5115 | 379 |
| 511 | 3300046519 | Ga0495632_0072991 | Ga0495632_0072991_21_1175 | 379 |
| 512 | 3300046542 | Ga0495597_0003643 | Ga0495597_0003643_4106_5260 | 379 |
| 513 | 3300046616 | Ga0495668_0056332 | Ga0495668_0056332_554_1708 | 379 |
| 514 | 3300046660 | Ga0495625_0036327 | Ga0495625_0036327_1832_2986 | 379 |
| 515 | 3300046683 | Ga0495658_0049639 | Ga0495658_0049639_802_1956 | 379 |
| 516 | 3300046690 | Ga0495624_0024292 | Ga0495624_0024292_727_1881 | 379 |
| 517 | 3300046692 | Ga0495671_0045836 | Ga0495671_0045836_777_1931 | 379 |
| 518 | 3300046694 | Ga0495649_0019858 | Ga0495649_0019858_1816_2970 | 379 |
| 519 | 3300047443 | Ga0495687_001929 | Ga0495687_001929_12345_13499 | 379 |
| 520 | 3300047443 | Ga0495687_004091 | Ga0495687_004091_5101_6255 | 379 |
| 521 | 3300048904 | Ga0496101_0068118 | Ga0496101_0068118_925_2088 | 379 |
| 522 | 3300048905 | Ga0496102_0004774 | Ga0496102_0004774_4497_5651 | 379 |
| 523 | 3300048905 | Ga0496102_0035825 | Ga0496102_0035825_1525_2679 | 379 |
| 524 | 3300048907 | Ga0496104_0362367 | Ga0496104_0362367_148_1302 | 379 |
| 525 | 3300048916 | Ga0496113_0063585 | Ga0496113_0063585_1018_2181 | 379 |
| 526 | 3300048917 | Ga0496114_0038403 | Ga0496114_0038403_936_2099 | 379 |
| 527 | 3300048924 | Ga0496121_0048421 | Ga0496121_0048421_1461_2615 | 379 |
| 528 | 3300048927 | Ga0496124_0000273 | Ga0496124_0000273_40980_42134 | 379 |
| 529 | 3300048928 | Ga0496125_0025441 | Ga0496125_0025441_2865_4019 | 379 |
| 530 | 3300049579 | Ga0501043_0000024 | Ga0501043_0000024_117942_119096 | 379 |
| 531 | 3300049580 | Ga0501046_0000107 | Ga0501046_0000107_52544_53698 | 379 |
| 532 | 3300049581 | Ga0501047_0000051 | Ga0501047_0000051_34940_36094 | 379 |
| 533 | 3300049582 | Ga0501048_0001157 | Ga0501048_0001157_3919_5073 | 379 |
| 534 | 3300049649 | Ga0501198_000003 | Ga0501198_000003_87057_88214 | 379 |
| 535 | 3300049662 | Ga0501222_000001 | Ga0501222_000001_302958_304115 | 379 |
| 536 | 3300050491 | nmdc:mga00v17_146225_c1 | nmdc:mga00v17_146225_c1_351_1505 | 379 |
| 537 | 3300050492 | nmdc:mga0yw44_12790_c1 | nmdc:mga0yw44_12790_c1_950_2104 | 379 |
| 538 | 3300050493 | nmdc:mga0k408_10101_c1 | nmdc:mga0k408_10101_c1_3765_4919 | 379 |
| 539 | 3300050493 | nmdc:mga0k408_23966_c1 | nmdc:mga0k408_23966_c1_952_2106 | 379 |
| 540 | 3300050493 | nmdc:mga0k408_4060_c1 | nmdc:mga0k408_4060_c1_2434_3588 | 379 |
| 541 | 3300050493 | nmdc:mga0k408_5915_c1 | nmdc:mga0k408_5915_c1_3734_4888 | 379 |
| 542 | 3300050493 | nmdc:mga0k408_7565_c1 | nmdc:mga0k408_7565_c1_1547_2701 | 379 |
| 543 | 3300050494 | nmdc:mga06z11_25204_c1 | nmdc:mga06z11_25204_c1_1407_2561 | 379 |
| 544 | 3300050494 | nmdc:mga06z11_31232_c1 | nmdc:mga06z11_31232_c1_1153_2307 | 379 |
| 545 | 3300050495 | nmdc:mga04h51_2001_c1 | nmdc:mga04h51_2001_c1_964_2118 | 379 |
| 546 | 3300050495 | nmdc:mga04h51_9983_c1 | nmdc:mga04h51_9983_c1_893_2047 | 379 |
| 547 | 3300050496 | nmdc:mga07m45_17727_c1 | nmdc:mga07m45_17727_c1_846_2000 | 379 |
| 548 | 3300050496 | nmdc:mga07m45_22678_c1 | nmdc:mga07m45_22678_c1_154_1308 | 379 |
| 549 | 3300050496 | nmdc:mga07m45_23433_c1 | nmdc:mga07m45_23433_c1_1408_2562 | 379 |
| 550 | 3300050496 | nmdc:mga07m45_3941_c1 | nmdc:mga07m45_3941_c1_4244_5398 | 379 |
| 551 | 3300050496 | nmdc:mga07m45_5755_c1 | nmdc:mga07m45_5755_c1_4364_5518 | 379 |
| 552 | 3300050496 | nmdc:mga07m45_63703_c1 | nmdc:mga07m45_63703_c1_748_1902 | 379 |
| 553 | 3300050496 | nmdc:mga07m45_638_c1 | nmdc:mga07m45_638_c1_950_2104 | 379 |
| 554 | 3300050509 | nmdc:mga0qj67_12586_c1 | nmdc:mga0qj67_12586_c1_3518_4672 | 379 |
| 555 | 3300053080 | Ga0500635_0000318 | Ga0500635_0000318_8784_9938 | 379 |
| 556 | 3300053090 | Ga0500646_0014455 | Ga0500646_0014455_661_1815 | 379 |
| 557 | 3300053154 | Ga0500619_000179 | Ga0500619_000179_4225_5379 | 379 |
| 558 | 3300061719 | Ga0466962_0008417 | Ga0466962_0008417_337_1491 | 379 |
| 559 | 3300003775 | Ga0055524_1000137 | Ga0055524_100013728 | 380 |
| 560 | 3300003791 | Ga0055530_10001713 | Ga0055530_100017138 | 380 |
| 561 | 3300003792 | Ga0055540_1000042 | Ga0055540_100004264 | 380 |
| 562 | 3300003794 | Ga0055531_10010420 | Ga0055531_100104202 | 380 |
| 563 | 3300005344 | Ga0070661_100000143 | Ga0070661_10000014348 | 380 |
| 564 | 3300005366 | Ga0070659_100001187 | Ga0070659_1000011879 | 380 |
| 565 | 3300005564 | Ga0070664_100012445 | Ga0070664_1000124455 | 380 |
| 566 | 3300005618 | Ga0068864_100184437 | Ga0068864_1001844372 | 380 |
| 567 | 3300005841 | Ga0068863_100155000 | Ga0068863_1001550001 | 380 |
| 568 | 3300006946 | Ga0079104_1000012 | Ga0079104_100001283 | 380 |
| 569 | 3300009177 | Ga0105248_10001875 | Ga0105248_100018753 | 380 |
| 570 | 3300025263 | Ga0209565_1002606 | Ga0209565_10026061 | 380 |
| 571 | 3300025298 | Ga0209050_1000556 | Ga0209050_100055656 | 380 |
| 572 | 3300025298 | Ga0209050_1008170 | Ga0209050_10081702 | 380 |
| 573 | 3300025299 | Ga0209256_1000030 | Ga0209256_1000030237 | 380 |
| 574 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004656 | 380 |
| 575 | 3300025304 | Ga0209257_1000063 | Ga0209257_1000063142 | 380 |
| 576 | 3300025920 | Ga0207649_10007131 | Ga0207649_100071313 | 380 |
| 577 | 3300025932 | Ga0207690_10001085 | Ga0207690_100010858 | 380 |
| 578 | 3300025941 | Ga0207711_10001495 | Ga0207711_100014952 | 380 |
| 579 | 3300025945 | Ga0207679_10000107 | Ga0207679_1000010714 | 380 |
| 580 | 3300027111 | Ga0209281_1000039 | Ga0209281_1000039243 | 380 |
| 581 | 3300028794 | Ga0307515_10038409 | Ga0307515_100384094 | 380 |
| 582 | 3300042531 | Ga0450918_000035 | Ga0450918_000035_26085_27242 | 380 |
| 583 | 3300048908 | Ga0496105_0235722 | Ga0496105_0235722_215_1375 | 380 |
| 584 | 3300048913 | Ga0496110_0176928 | Ga0496110_0176928_161_1321 | 380 |
| 585 | 3300048915 | Ga0496112_0016698 | Ga0496112_0016698_1494_2654 | 380 |
| 586 | 3300048916 | Ga0496113_0007231 | Ga0496113_0007231_126_1286 | 380 |
| 587 | 3300005331 | Ga0070670_100285891 | Ga0070670_1002858911 | 381 |
| 588 | 3300005356 | Ga0070674_100002334 | Ga0070674_1000023346 | 381 |
| 589 | 3300005459 | Ga0068867_100050890 | Ga0068867_1000508902 | 381 |
| 590 | 3300006195 | Ga0075366_10003901 | Ga0075366_100039017 | 381 |
| 591 | 3300025960 | Ga0207651_10126081 | Ga0207651_101260811 | 381 |
| 592 | 3300026121 | Ga0207683_10151917 | Ga0207683_101519171 | 381 |
| 593 | 3300006195 | Ga0075366_10022587 | Ga0075366_100225872 | 384 |
| 594 | 3300001979 | JGI24740J21852_10004614 | JGI24740J21852_100046144 | 385 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8tj3-assembly1.cif.gz_B | structural basis of peptidoglycan synthesis by e. coli roda-pbp2 complex | 0.8374 | 20 | 379 |
| 6bas-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) | 0.8323 | 24 | 381 |
| 8tj3-assembly1.cif.gz_B | structural basis of peptidoglycan synthesis by e. coli roda-pbp2 complex | 0.8285 | 20 | 379 |
| 6bar-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) | 0.8244 | 21 | 381 |
| 6pl5-assembly1.cif.gz_A | structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex | 0.8243 | 24 | 381 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57586_10_105_1.20.120.420 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);translation initiation factor eif-2b, domain 1 | 0.6723 | 122 | 186 | 1.20.120.420 |
| 1t5oA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);translation initiation factor eif-2b, domain 1 | 0.5458 | 116 | 182 | 1.20.120.420 |
| af_Q57586_10_105_1.20.120.420 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);translation initiation factor eif-2b, domain 1 | 0.4546 | 122 | 186 | 1.20.120.420 |
| af_K7MB47_65_296_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3486 | 79 | 186 | 1.25.40.10 |
| af_G3V955_44_182_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3254 | 81 | 204 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0T2YZ76-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.9316 | 7 | 385 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A521Z6H6-F1-model_v4 | Rod shape-determining protein RodA | 0.9305 | 9 | 198 |
GO:0005886
GO:0008360 GO:0015648 GO:0016740 GO:0032153 GO:0051301 |
| AF-A0A2N4XQP0-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.9243 | 17 | 381 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A5E4RNR2-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.9229 | 9 | 385 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
| AF-A0A0T2YZ76-F1-model_v4 | Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) | 0.9177 | 7 | 385 |
GO:0005886
GO:0008360 GO:0008955 GO:0009252 GO:0015648 GO:0032153 GO:0051301 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar