F467316

General Info

Members Datasets Scaffolds Average Seq Length
594 312 583 376

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10022587|Ga0075366_100225872
Length 393
Sequence MTSATRPAPMNVAFEKPSLLQRVLPMFTGFDGPLLCAVLLLAGAGLVTMYSAGFDHGTRFVDHGRNMLIALAVLFAVAQVPPQRLMSLALPLYALGVGLLVATALFGITKKGATRWLNVGMVIQPSEMLKIAMPLMLAWWFQRREGQLRVPDFLVGGLILALPVGLIVKQPDLGTAILVLSSGLYVIFFAGLSWRLIVPVLLLGAVAITALVLSGDAICEPEVKWPVLREYQKHRVCTLLDPTKDPLGKGFHTIQGMIAIGSGGLEGKGFMKGTQTHLEFIPERTTDFVFAAFSEEFGLYGCAALVLGFVFLIFRGLVIAADAPTVFTRLLAGAITLSFFTYAFVNMGMVSGILPVVGVPLPFISYGGTAMVTLGLGLGILMSIAKSRRLVQT

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
10 2831864461 Roseateles noduli HZ7 Isolate Nodule
11 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
85 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
181 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
231 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
232 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
233 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
236 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
288 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
307 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
308 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
311 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 0
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.35
Nodule 0.84
Rhizoplane 2.53
Rhizosphere 67.68
Stem 0
Stem Tuber 0
Unclassified 10.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004614 3300001979 Bacteria 5915
2 JGI24740J21852_10044089 3300001979 Bacteria 1326
3 JGI25154J39366_1000937 3300002738 Bacteria 12133
4 JGI25157J39369_1000361 3300002741 Bacteria 31616
5 JGI25164J39214_1005709 3300002772 Bacteria 1336
6 JGI25152J39213_1001024 3300002773 Bacteria 13383
7 JGI25153J46596_10000904 3300003215 Bacteria 18024
8 JGI25153J46596_10012019 3300003215 Bacteria 3780
9 rootL2_10059169 3300003322 Bacteria 7994
10 rootH1_10029562 3300003323 Bacteria 4459
11 Ga0055533_1000048 3300003756 Bacteria 212106
12 Ga0055533_1000068 3300003756 Bacteria 155215
13 Ga0055525_1001441 3300003759 Bacteria 4331
14 Ga0055535_1000917 3300003761 Bacteria 19899
15 Ga0055529_1000291 3300003763 Bacteria 58444
16 Ga0055526_1001136 3300003771 Bacteria 19296
17 Ga0055524_1000137 3300003775 Bacteria 87107
18 Ga0055524_1001779 3300003775 Bacteria 11839
19 Ga0055524_1005390 3300003775 Bacteria 5719
20 Ga0055530_10001713 3300003791 Bacteria 15454
21 Ga0055530_10017992 3300003791 Bacteria 2195
22 Ga0055540_1000042 3300003792 Bacteria 156410
23 Ga0055531_10004981 3300003794 Bacteria 7882
24 Ga0055531_10010420 3300003794 Bacteria 4620
25 Ga0055531_10012094 3300003794 Bacteria 4088
26 Ga0065165_1000079 3300005262 Bacteria 162095
27 Ga0065165_1001510 3300005262 Bacteria 24595
28 Ga0065165_1002283 3300005262 Bacteria 16845
29 Ga0065707_10090986 3300005295 Bacteria 4027
30 Ga0070658_10000001 3300005327 Bacteria 856789
31 Ga0070658_10042789 3300005327 Bacteria 3658
32 Ga0070676_10048150 3300005328 Bacteria 2492
33 Ga0070670_100047892 3300005331 Bacteria 3679
34 Ga0070670_100103908 3300005331 Bacteria 2447
35 Ga0070670_100285891 3300005331 Bacteria 1440
36 Ga0068869_100045478 3300005334 Bacteria 3161
37 Ga0068869_100065020 3300005334 Bacteria 2684
38 Ga0070680_100072767 3300005336 Bacteria 2826
39 Ga0068868_100004682 3300005338 Bacteria 9609
40 Ga0068868_100022229 3300005338 Bacteria 4785
41 Ga0068868_100030420 3300005338 Bacteria 4140
42 Ga0070660_100002455 3300005339 Bacteria 12717
43 Ga0070660_100025624 3300005339 Bacteria 4384
44 Ga0070660_100026263 3300005339 Bacteria 4333
45 Ga0070660_100090110 3300005339 Bacteria 2417
46 Ga0070661_100000143 3300005344 Bacteria 58391
47 Ga0070661_100068331 3300005344 Bacteria 2611
48 Ga0070692_10001641 3300005345 Bacteria 8249
49 Ga0070692_10067713 3300005345 Bacteria 1896
50 Ga0070668_100089302 3300005347 Bacteria 2427
51 Ga0070675_100016355 3300005354 Bacteria 5887
52 Ga0070675_100023702 3300005354 Bacteria 4910
53 Ga0070675_100092899 3300005354 Bacteria 2530
54 Ga0070671_100075394 3300005355 Bacteria 2817
55 Ga0070671_100163491 3300005355 Bacteria 1881
56 Ga0070674_100002334 3300005356 Bacteria 10472
57 Ga0070673_100028817 3300005364 Bacteria 4134
58 Ga0070673_100145175 3300005364 Bacteria 2005
59 Ga0070673_100168574 3300005364 Bacteria 1867
60 Ga0070673_100346518 3300005364 Bacteria 1317
61 Ga0070659_100001187 3300005366 Bacteria 18994
62 Ga0070659_100011514 3300005366 Bacteria 6544
63 Ga0070659_100050123 3300005366 Bacteria 3284
64 Ga0070659_100084405 3300005366 Bacteria 2539
65 Ga0070667_100008278 3300005367 Bacteria 8619
66 Ga0070667_100066028 3300005367 Bacteria 3073
67 Ga0070667_100224342 3300005367 Bacteria 1673
68 Ga0070700_100215683 3300005441 Bacteria 1357
69 Ga0070663_100046195 3300005455 Bacteria 3080
70 Ga0070663_100068556 3300005455 Bacteria 2575
71 Ga0070678_100037378 3300005456 Bacteria 3409
72 Ga0070678_100095910 3300005456 Bacteria 2287
73 Ga0070662_100001972 3300005457 Bacteria 12605
74 Ga0070662_100002087 3300005457 Bacteria 12250
75 Ga0070662_100111891 3300005457 Bacteria 2081
76 Ga0070662_100173843 3300005457 Bacteria 1693
77 Ga0068867_100000074 3300005459 Bacteria 61448
78 Ga0068867_100016932 3300005459 Bacteria 5179
79 Ga0068867_100019791 3300005459 Bacteria 4797
80 Ga0068867_100050890 3300005459 Bacteria 3055
81 Ga0068867_100100750 3300005459 Bacteria 2206
82 Ga0070706_100001812 3300005467 Bacteria 22146
83 Ga0070707_100065034 3300005468 Bacteria 3503
84 Ga0070679_100061522 3300005530 Bacteria 3742
85 Ga0068853_100077897 3300005539 Bacteria 2896
86 Ga0068853_100222775 3300005539 Bacteria 1723
87 Ga0070672_100150107 3300005543 Bacteria 1927
88 Ga0070665_100038822 3300005548 Bacteria 4787
89 Ga0068855_100056191 3300005563 Bacteria 4619
90 Ga0068855_100076382 3300005563 Bacteria 3888
91 Ga0070664_100012445 3300005564 Bacteria 6916
92 Ga0070664_100134325 3300005564 Bacteria 2174
93 Ga0068857_100004217 3300005577 Bacteria 12113
94 Ga0068857_100013612 3300005577 Bacteria 7087
95 Ga0068857_100048921 3300005577 Bacteria 3751
96 Ga0068854_100045107 3300005578 Bacteria 3133
97 Ga0068854_100047902 3300005578 Bacteria 3047
98 Ga0068856_100001787 3300005614 Bacteria 22472
99 Ga0068856_100037290 3300005614 Bacteria 4770
100 Ga0068856_100116430 3300005614 Bacteria 2673
101 Ga0068852_100092002 3300005616 Bacteria 2715
102 Ga0068852_100126431 3300005616 Bacteria 2348
103 Ga0068852_100173945 3300005616 Bacteria 2020
104 Ga0068852_100233945 3300005616 Bacteria 1753
105 Ga0068852_100481171 3300005616 Bacteria 1234
106 Ga0068859_100004106 3300005617 Bacteria 14852
107 Ga0068864_100015752 3300005618 Bacteria 6289
108 Ga0068864_100132919 3300005618 Bacteria 2237
109 Ga0068864_100184437 3300005618 Bacteria 1909
110 Ga0068864_100185634 3300005618 Bacteria 1903
111 Ga0068864_100315504 3300005618 Bacteria 1467
112 Ga0068861_100012599 3300005719 Bacteria 5900
113 Ga0068861_100169659 3300005719 Bacteria 1807
114 Ga0068863_100018149 3300005841 Bacteria 6737
115 Ga0068863_100155000 3300005841 Bacteria 2193
116 Ga0068863_100214598 3300005841 Bacteria 1853
117 Ga0068858_100012096 3300005842 Bacteria 8135
118 Ga0068858_100212585 3300005842 Bacteria 1830
119 Ga0068860_100036624 3300005843 Bacteria 4700
120 Ga0068860_100095196 3300005843 Bacteria 2838
121 Ga0068862_100016050 3300005844 Bacteria 6228
122 Ga0068862_100050997 3300005844 Bacteria 3538
123 Ga0075365_10044946 3300006038 Bacteria 2896
124 Ga0075368_10007764 3300006042 Bacteria 3799
125 Ga0075363_100027136 3300006048 Bacteria 2934
126 Ga0075362_10005083 3300006177 Bacteria 4783
127 Ga0075367_10003757 3300006178 Bacteria 7312
128 Ga0075367_10008433 3300006178 Bacteria 5339
129 Ga0075367_10015315 3300006178 Bacteria 4164
130 Ga0075367_10094174 3300006178 Bacteria 1825
131 Ga0075367_10173251 3300006178 Bacteria 1344
132 Ga0075369_10001649 3300006186 Bacteria 7693
133 Ga0075366_10003901 3300006195 Bacteria 7952
134 Ga0075366_10014272 3300006195 Bacteria 4536
135 Ga0075366_10022587 3300006195 Bacteria 3661
136 Ga0075366_10034757 3300006195 Bacteria 2970
137 Ga0075366_10137035 3300006195 Bacteria 1478
138 Ga0097621_100051214 3300006237 Bacteria 3359
139 Ga0097621_100064663 3300006237 Bacteria 3009
140 Ga0097621_100098542 3300006237 Bacteria 2455
141 Ga0075370_10002473 3300006353 Bacteria 8571
142 Ga0075370_10003868 3300006353 Bacteria 7175
143 Ga0075370_10008355 3300006353 Bacteria 5324
144 Ga0075370_10010033 3300006353 Bacteria 4939
145 Ga0075370_10035225 3300006353 Bacteria 2809
146 Ga0075370_10045413 3300006353 Bacteria 2485
147 Ga0068871_100066434 3300006358 Bacteria 2956
148 Ga0075430_100012408 3300006846 Bacteria 7250
149 Ga0075430_100081406 3300006846 Bacteria 2713
150 Ga0075429_100000549 3300006880 Bacteria 28660
151 Ga0097620_100004106 3300006931 Bacteria 14852
152 Ga0099823_1000002 3300006944 Bacteria 212272
153 Ga0079104_1000012 3300006946 Bacteria 355143
154 Ga0105240_10050356 3300009093 Bacteria 5252
155 Ga0111539_10278603 3300009094 Bacteria 1946
156 Ga0105245_10098671 3300009098 Bacteria 2699
157 Ga0105245_10155639 3300009098 Bacteria 2164
158 Ga0105245_10168911 3300009098 Bacteria 2081
159 Ga0105247_10160782 3300009101 Bacteria 1487
160 Ga0114129_10067923 3300009147 Bacteria 4971
161 Ga0105243_10013068 3300009148 Bacteria 6273
162 Ga0105243_10070295 3300009148 Bacteria 2826
163 Ga0105241_10034699 3300009174 Bacteria 3792
164 Ga0105242_10065208 3300009176 Bacteria 3004
165 Ga0105248_10001875 3300009177 Bacteria 23322
166 Ga0105248_10091586 3300009177 Bacteria 3424
167 Ga0105248_10217212 3300009177 Bacteria 2153
168 Ga0105237_10083448 3300009545 Bacteria 3186
169 Ga0105237_10314085 3300009545 Bacteria 1570
170 Ga0105239_10037165 3300010375 Bacteria 5340
171 Ga0105239_10055004 3300010375 Bacteria 4365
172 Ga0105239_10155046 3300010375 Bacteria 2557
173 Ga0105239_10369365 3300010375 Bacteria 1621
174 Ga0105239_10502885 3300010375 Bacteria 1378
175 Ga0105246_10052639 3300011119 Bacteria 2799
176 Ga0157319_1000007 3300012497 Bacteria 318528
177 Ga0157373_10056067 3300013100 Bacteria 2798
178 Ga0157369_10005527 3300013105 Bacteria 14673
179 Ga0157369_10113559 3300013105 Bacteria 2878
180 Ga0157374_10146598 3300013296 Bacteria 2293
181 Ga0157374_10168961 3300013296 Bacteria 2132
182 Ga0157378_10216026 3300013297 Bacteria 1821
183 Ga0163162_10151886 3300013306 Bacteria 2434
184 Ga0157372_10332061 3300013307 Bacteria 1771
185 Ga0157375_10034091 3300013308 Bacteria 4846
186 Ga0157375_10246415 3300013308 Bacteria 1947
187 Ga0157375_10387732 3300013308 Bacteria 1564
188 Ga0163163_10010636 3300014325 Bacteria 8291
189 Ga0157380_10159123 3300014326 Bacteria 1961
190 Ga0157377_10000006 3300014745 Bacteria 419853
191 Ga0157379_10058377 3300014968 Bacteria 3450
192 Ga0157379_10241264 3300014968 Bacteria 1639
193 Ga0157376_10031404 3300014969 Bacteria 4252
194 Ga0157376_10160211 3300014969 Bacteria 2039
195 Ga0157376_10161544 3300014969 Bacteria 2031
196 Ga0163161_10096385 3300017792 Bacteria 2195
197 Ga0213872_10000286 3300021361 Bacteria 43221
198 Ga0213872_10000510 3300021361 Bacteria 30659
199 Ga0213876_10000234 3300021384 Bacteria 54188
200 Ga0213876_10015405 3300021384 Bacteria 4047
201 Ga0209674_100024 3300025226 Bacteria 535481
202 Ga0209563_100014 3300025230 Bacteria 940582
203 Ga0209563_100101 3300025230 Bacteria 152297
204 Ga0209258_100180 3300025242 Bacteria 137306
205 Ga0209258_100777 3300025242 Bacteria 19410
206 Ga0209646_1000012 3300025246 Bacteria 573300
207 Ga0209026_1000004 3300025250 Bacteria 949012
208 Ga0209677_100091 3300025253 Bacteria 106743
209 Ga0209677_101750 3300025253 Bacteria 9018
210 Ga0209677_105636 3300025253 Bacteria 3208
211 Ga0209148_1006729 3300025254 Bacteria 2461
212 Ga0209759_1000003 3300025256 Bacteria 792130
213 Ga0209759_1000067 3300025256 Bacteria 183764
214 Ga0209759_1001906 3300025256 Bacteria 10240
215 Ga0209759_1008275 3300025256 Bacteria 3255
216 Ga0209759_1013534 3300025256 Bacteria 2202
217 Ga0209129_1000035 3300025258 Bacteria 329303
218 Ga0209565_1002606 3300025263 Bacteria 6385
219 Ga0209455_1000144 3300025272 Bacteria 137313
220 Ga0209673_1014757 3300025273 Bacteria 3010
221 Ga0209673_1022702 3300025273 Bacteria 2156
222 Ga0209673_1022780 3300025273 Bacteria 2151
223 Ga0209564_1000024 3300025295 Bacteria 535041
224 Ga0209564_1000030 3300025295 Bacteria 503296
225 Ga0209758_1000066 3300025297 Bacteria 298620
226 Ga0209758_1000248 3300025297 Bacteria 110671
227 Ga0209050_1000556 3300025298 Bacteria 61372
228 Ga0209050_1000614 3300025298 Bacteria 56080
229 Ga0209050_1008170 3300025298 Bacteria 5663
230 Ga0209050_1008250 3300025298 Bacteria 5615
231 Ga0209256_1000030 3300025299 Bacteria 414828
232 Ga0209256_1000197 3300025299 Bacteria 114432
233 Ga0209256_1003387 3300025299 Bacteria 11247
234 Ga0209256_1027942 3300025299 Bacteria 1600
235 Ga0209051_1000004 3300025303 Bacteria 1155596
236 Ga0209051_1002061 3300025303 Bacteria 15247
237 Ga0209051_1002964 3300025303 Bacteria 11563
238 Ga0209051_1003541 3300025303 Bacteria 10175
239 Ga0209257_1000063 3300025304 Bacteria 359089
240 Ga0209257_1002434 3300025304 Bacteria 18517
241 Ga0209257_1004130 3300025304 Bacteria 11575
242 Ga0207656_10020347 3300025321 Bacteria 2637
243 Ga0207682_10007238 3300025893 Bacteria 4435
244 Ga0207688_10123664 3300025901 Bacteria 1511
245 Ga0207680_10025545 3300025903 Bacteria 3259
246 Ga0207647_10009993 3300025904 Bacteria 6718
247 Ga0207645_10153507 3300025907 Bacteria 1504
248 Ga0207643_10117579 3300025908 Bacteria 1572
249 Ga0207705_10000002 3300025909 Bacteria 2046852
250 Ga0207705_10041865 3300025909 Bacteria 3286
251 Ga0207684_10005403 3300025910 Bacteria 11797
252 Ga0207695_10026886 3300025913 Bacteria 6415
253 Ga0207695_10071453 3300025913 Bacteria 3545
254 Ga0207695_10075293 3300025913 Bacteria 3435
255 Ga0207671_10034414 3300025914 Bacteria 3763
256 Ga0207671_10034539 3300025914 Bacteria 3756
257 Ga0207662_10078340 3300025918 Bacteria 2011
258 Ga0207657_10021758 3300025919 Bacteria 6026
259 Ga0207657_10036415 3300025919 Bacteria 4404
260 Ga0207657_10149925 3300025919 Bacteria 1900
261 Ga0207657_10300196 3300025919 Bacteria 1272
262 Ga0207649_10007131 3300025920 Bacteria 6077
263 Ga0207649_10082794 3300025920 Bacteria 2081
264 Ga0207649_10099654 3300025920 Bacteria 1920
265 Ga0207646_10025442 3300025922 Bacteria 5414
266 Ga0207681_10040776 3300025923 Bacteria 3091
267 Ga0207694_10113511 3300025924 Bacteria 2157
268 Ga0207650_10011535 3300025925 Bacteria 6085
269 Ga0207659_10053395 3300025926 Bacteria 2882
270 Ga0207659_10062520 3300025926 Bacteria 2687
271 Ga0207687_10077378 3300025927 Bacteria 2392
272 Ga0207687_10235178 3300025927 Bacteria 1449
273 Ga0207644_10008982 3300025931 Bacteria 6548
274 Ga0207644_10010832 3300025931 Bacteria 6019
275 Ga0207644_10021081 3300025931 Bacteria 4437
276 Ga0207644_10044828 3300025931 Bacteria 3144
277 Ga0207644_10151195 3300025931 Bacteria 1796
278 Ga0207690_10001085 3300025932 Bacteria 17371
279 Ga0207690_10007044 3300025932 Bacteria 6670
280 Ga0207690_10069004 3300025932 Bacteria 2431
281 Ga0207690_10087560 3300025932 Bacteria 2192
282 Ga0207690_10155333 3300025932 Bacteria 1700
283 Ga0207706_10002326 3300025933 Bacteria 18551
284 Ga0207706_10025882 3300025933 Bacteria 5254
285 Ga0207706_10029294 3300025933 Bacteria 4916
286 Ga0207706_10066743 3300025933 Bacteria 3166
287 Ga0207706_10078639 3300025933 Bacteria 2901
288 Ga0207686_10046424 3300025934 Bacteria 2679
289 Ga0207686_10162051 3300025934 Bacteria 1568
290 Ga0207709_10007745 3300025935 Bacteria 5953
291 Ga0207709_10208528 3300025935 Bacteria 1401
292 Ga0207691_10047060 3300025940 Bacteria 3961
293 Ga0207711_10001495 3300025941 Bacteria 21766
294 Ga0207711_10008941 3300025941 Bacteria 8373
295 Ga0207711_10127636 3300025941 Bacteria 2277
296 Ga0207689_10018619 3300025942 Bacteria 5858
297 Ga0207689_10133268 3300025942 Bacteria 2045
298 Ga0207661_10105194 3300025944 Bacteria 2377
299 Ga0207679_10000107 3300025945 Bacteria 68403
300 Ga0207679_10010126 3300025945 Bacteria 6063
301 Ga0207667_10021849 3300025949 Bacteria 7082
302 Ga0207651_10018533 3300025960 Bacteria 4146
303 Ga0207651_10072443 3300025960 Bacteria 2446
304 Ga0207651_10090072 3300025960 Bacteria 2241
305 Ga0207651_10126081 3300025960 Bacteria 1951
306 Ga0207651_10210910 3300025960 Bacteria 1563
307 Ga0207712_10032071 3300025961 Bacteria 3544
308 Ga0207640_10007735 3300025981 Bacteria 5938
309 Ga0207640_10263626 3300025981 Bacteria 1344
310 Ga0207658_10012649 3300025986 Bacteria 5764
311 Ga0207658_10043256 3300025986 Bacteria 3273
312 Ga0207658_10244092 3300025986 Bacteria 1523
313 Ga0207677_10001235 3300026023 Bacteria 13778
314 Ga0207677_10014267 3300026023 Bacteria 4634
315 Ga0207677_10125475 3300026023 Bacteria 1939
316 Ga0207703_10003592 3300026035 Bacteria 12959
317 Ga0207639_10299319 3300026041 Bacteria 1421
318 Ga0207678_10074445 3300026067 Bacteria 2910
319 Ga0207678_10083994 3300026067 Bacteria 2724
320 Ga0207678_10124281 3300026067 Bacteria 2201
321 Ga0207708_10094440 3300026075 Bacteria 2309
322 Ga0207708_10173994 3300026075 Bacteria 1706
323 Ga0207702_10000033 3300026078 Bacteria 166621
324 Ga0207702_10056893 3300026078 Bacteria 3322
325 Ga0207641_10091127 3300026088 Bacteria 2667
326 Ga0207648_10000039 3300026089 Bacteria 118860
327 Ga0207648_10051426 3300026089 Bacteria 3601
328 Ga0207648_10060172 3300026089 Bacteria 3312
329 Ga0207648_10068722 3300026089 Bacteria 3087
330 Ga0207676_10011369 3300026095 Bacteria 6362
331 Ga0207676_10020271 3300026095 Bacteria 4862
332 Ga0207676_10071455 3300026095 Bacteria 2786
333 Ga0207674_10004849 3300026116 Bacteria 16110
334 Ga0207674_10017935 3300026116 Bacteria 7714
335 Ga0207674_10039358 3300026116 Bacteria 4902
336 Ga0207674_10084515 3300026116 Bacteria 3171
337 Ga0207674_10184103 3300026116 Bacteria 2039
338 Ga0207675_100018234 3300026118 Bacteria 6544
339 Ga0207675_100022435 3300026118 Bacteria 5879
340 Ga0207683_10124007 3300026121 Bacteria 2321
341 Ga0207683_10151917 3300026121 Bacteria 2090
342 Ga0207698_10033942 3300026142 Bacteria 3713
343 Ga0207698_10320971 3300026142 Bacteria 1450
344 Ga0207698_10365989 3300026142 Bacteria 1367
345 Ga0209281_1000039 3300027111 Bacteria 355150
346 Ga0209389_1031075 3300027296 Bacteria 4482
347 Ga0268266_10201755 3300028379 Bacteria 1820
348 Ga0268266_10368889 3300028379 Bacteria 1352
349 Ga0268265_10055489 3300028380 Bacteria 3010
350 Ga0268265_10137353 3300028380 Bacteria 2041
351 Ga0268264_10053035 3300028381 Bacteria 3383
352 Ga0268264_10109071 3300028381 Bacteria 2421
353 Ga0265336_10000030 3300028666 Bacteria 169335
354 Ga0265336_10000260 3300028666 Bacteria 37415
355 Ga0307517_10003885 3300028786 Bacteria 23168
356 Ga0307517_10103686 3300028786 Bacteria 2221
357 Ga0307517_10117758 3300028786 Bacteria 1981
358 Ga0307515_10000013 3300028794 Bacteria 568456
359 Ga0307515_10000179 3300028794 Bacteria 156716
360 Ga0307515_10000239 3300028794 Bacteria 135971
361 Ga0307515_10001166 3300028794 Bacteria 60153
362 Ga0307515_10019026 3300028794 Bacteria 12392
363 Ga0307515_10021584 3300028794 Bacteria 11405
364 Ga0307515_10034662 3300028794 Bacteria 8248
365 Ga0307515_10038409 3300028794 Bacteria 7659
366 Ga0307515_10061615 3300028794 Bacteria 5317
367 Ga0307515_10074489 3300028794 Bacteria 4540
368 Ga0307515_10075820 3300028794 Bacteria 4472
369 Ga0265338_10059826 3300028800 Bacteria 3354
370 Ga0265324_10000004 3300029957 Bacteria 356972
371 Ga0265324_10000109 3300029957 Bacteria 65395
372 Ga0265324_10000522 3300029957 Bacteria 26385
373 Ga0265324_10060151 3300029957 Bacteria 1299
374 Ga0307512_10029280 3300030522 Bacteria 4815
375 Ga0265325_10000084 3300031241 Bacteria 66026
376 Ga0265325_10025694 3300031241 Bacteria 3196
377 Ga0307513_10079132 3300031456 Bacteria 3397
378 Ga0307513_10110681 3300031456 Bacteria 2741
379 Ga0307509_10000135 3300031507 Bacteria 109066
380 Ga0307509_10045186 3300031507 Bacteria 4752
381 Ga0307509_10046455 3300031507 Bacteria 4674
382 Ga0307509_10075676 3300031507 Bacteria 3496
383 Ga0307509_10080732 3300031507 Bacteria 3362
384 Ga0307509_10082225 3300031507 Bacteria 3323
385 Ga0307509_10083895 3300031507 Bacteria 3283
386 Ga0307509_10143228 3300031507 Bacteria 2321
387 Ga0307408_100002033 3300031548 Bacteria 14565
388 Ga0307408_100035791 3300031548 Bacteria 3486
389 Ga0307408_100271452 3300031548 Bacteria 1408
390 Ga0307508_10000048 3300031616 Bacteria 137587
391 Ga0307508_10000122 3300031616 Bacteria 92612
392 Ga0307508_10157944 3300031616 Bacteria 1871
393 Ga0307514_10000595 3300031649 Bacteria 67797
394 Ga0307514_10144322 3300031649 Bacteria 1611
395 Ga0265314_10000134 3300031711 Bacteria 111395
396 Ga0265314_10003721 3300031711 Bacteria 14593
397 Ga0265314_10023534 3300031711 Bacteria 4693
398 Ga0307516_10000243 3300031730 Bacteria 70407
399 Ga0307516_10000942 3300031730 Bacteria 40129
400 Ga0307516_10005879 3300031730 Bacteria 14519
401 Ga0307516_10049504 3300031730 Bacteria 4129
402 Ga0307405_10006527 3300031731 Bacteria 5746
403 Ga0307405_10052799 3300031731 Bacteria 2529
404 Ga0307413_10152474 3300031824 Bacteria 1612
405 Ga0307410_10006677 3300031852 Bacteria 6247
406 Ga0307406_10004814 3300031901 Bacteria 7355
407 Ga0307406_10086629 3300031901 Bacteria 2098
408 Ga0307412_10007849 3300031911 Bacteria 6076
409 Ga0307412_10025572 3300031911 Bacteria 3658
410 Ga0307409_100000263 3300031995 Bacteria 21269
411 Ga0307416_100010747 3300032002 Bacteria 6064
412 Ga0307416_100046031 3300032002 Bacteria 3440
413 Ga0307416_100212879 3300032002 Bacteria 1845
414 Ga0307414_10021756 3300032004 Bacteria 4033
415 Ga0307414_10191882 3300032004 Bacteria 1654
416 Ga0307411_10144737 3300032005 Bacteria 1757
417 Ga0307411_10302992 3300032005 Bacteria 1282
418 Ga0307415_100002117 3300032126 Bacteria 9826
419 Ga0307507_10014209 3300033179 Bacteria 9527
420 Ga0307510_10019100 3300033180 Bacteria 8040
421 Ga0307510_10024531 3300033180 Bacteria 6966
422 Ga0307510_10033752 3300033180 Bacteria 5742
423 Ga0373938_0004483 3300034957 Bacteria 2336
424 Ga0373951_0012000 3300035091 Bacteria 1948
425 Ga0373939_0000003 3300035114 Bacteria 111914
426 Ga0373945_0017245 3300035116 Bacteria 2444
427 Ga0373960_0001502 3300035121 Bacteria 5186
428 Ga0373955_0071005 3300035172 Bacteria 1947
429 Ga0373931_0001000 3300035691 Bacteria 11954
430 Ga0373931_0001994 3300035691 Bacteria 8980
431 Ga0373931_0034620 3300035691 Bacteria 2622
432 Ga0373935_0161176 3300035692 Bacteria 1529
433 Ga0373927_0041637 3300035695 Bacteria 2979
434 Ga0373927_0067846 3300035695 Bacteria 2308
435 Ga0373947_0181787 3300035725 Bacteria 1369
436 Ga0373937_0083668 3300036401 Bacteria 2952
437 Ga0373937_0158361 3300036401 Bacteria 2123
438 Ga0373937_0171685 3300036401 Bacteria 2035
439 Ga0373937_0177245 3300036401 Bacteria 2001
440 Ga0373925_0006787 3300037068 Bacteria 8388
441 Ga0373925_0020505 3300037068 Bacteria 4812
442 Ga0395899_0260823 3300037312 Bacteria 1185
443 Ga0395898_0120447 3300037466 Bacteria 2514
444 Ga0395905_0004009 3300037471 Bacteria 15476
445 Ga0395905_0027724 3300037471 Bacteria 5341
446 Ga0395901_0022909 3300038443 Bacteria 6403
447 Ga0436365_0730430 3300039437 Bacteria 4930
448 Ga0436365_1041421 3300039437 Bacteria 61116
449 Ga0436361_0147565 3300039447 Bacteria 50932
450 Ga0436361_0372090 3300039447 Bacteria 55323
451 Ga0436361_0602459 3300039447 Bacteria 3783
452 Ga0436361_1129825 3300039447 Bacteria 3838
453 Ga0436363_1578616 3300039450 Bacteria 3164
454 Ga0436363_1720631 3300039450 Bacteria 2595
455 Ga0439448_0003000 3300042005 Bacteria 4634
456 Ga0439448_0029024 3300042005 Bacteria 1749
457 Ga0439455_0001540 3300042012 Bacteria 3895
458 Ga0439455_0008451 3300042012 Bacteria 2208
459 Ga0439455_0015604 3300042012 Bacteria 1747
460 Ga0450923_002188 3300042125 Bacteria 2760
461 Ga0450890_000303 3300042127 Bacteria 7127
462 Ga0439458_0003441 3300042157 Bacteria 3702
463 Ga0439459_0000614 3300042438 Bacteria 4782
464 Ga0450918_000035 3300042531 Bacteria 27883
465 Ga0451577_0000002 3300042876 Bacteria 1731375
466 Ga0451577_0005990 3300042876 Bacteria 12244
467 Ga0451577_0011641 3300042876 Bacteria 8305
468 Ga0451577_0021420 3300042876 Bacteria 5916
469 Ga0451577_0228983 3300042876 Bacteria 1680
470 Ga0466969_0000009 3300044656 Bacteria 125464
471 Ga0466969_0007097 3300044656 Bacteria 5962
472 Ga0466969_0027851 3300044656 Bacteria 2891
473 Ga0466972_0005323 3300044658 Bacteria 6444
474 Ga0453683_0000013 3300044673 Bacteria 371932
475 Ga0466965_0097007 3300044683 Bacteria 1504
476 Ga0466966_0000566 3300044684 Bacteria 23589
477 Ga0466961_0008485 3300044693 Bacteria 6545
478 Ga0466963_0023171 3300044694 Bacteria 3939
479 Ga0466963_0197183 3300044694 Bacteria 1408
480 Ga0466964_0002753 3300044706 Bacteria 6309
481 Ga0466964_0038300 3300044706 Bacteria 1927
482 Ga0453684_0000002 3300044712 Bacteria 1731375
483 Ga0453684_0040217 3300044712 Bacteria 6356
484 Ga0453684_0293421 3300044712 Bacteria 1851
485 Ga0466971_0069364 3300044719 Bacteria 1599
486 Ga0466970_0132918 3300044765 Bacteria 1367
487 Ga0466957_0096502 3300044842 Bacteria 1858
488 Ga0466959_0014467 3300045049 Bacteria 5734
489 Ga0466959_0019638 3300045049 Bacteria 4969
490 Ga0466959_0155875 3300045049 Bacteria 1607
491 Ga0451576_0000037 3300045051 Bacteria 372173
492 Ga0451576_0011961 3300045051 Bacteria 9807
493 Ga0495592_0000185 3300046454 Bacteria 54711
494 Ga0495590_0003929 3300046457 Bacteria 6044
495 Ga0495583_0000022 3300046506 Bacteria 282544
496 Ga0495606_0006644 3300046507 Bacteria 10606
497 Ga0495606_0089597 3300046507 Bacteria 1895
498 Ga0495610_0040794 3300046512 Bacteria 2336
499 Ga0495632_0004037 3300046519 Bacteria 10131
500 Ga0495632_0005415 3300046519 Bacteria 8442
501 Ga0495632_0072991 3300046519 Bacteria 1646
502 Ga0495597_0003643 3300046542 Bacteria 8851
503 Ga0495668_0056332 3300046616 Bacteria 2170
504 Ga0495625_0006884 3300046660 Bacteria 10036
505 Ga0495625_0028632 3300046660 Bacteria 4176
506 Ga0495625_0036327 3300046660 Bacteria 3622
507 Ga0495647_0059919 3300046681 Bacteria 1499
508 Ga0495658_0049639 3300046683 Bacteria 2371
509 Ga0495658_0057116 3300046683 Bacteria 2228
510 Ga0495669_0102301 3300046684 Bacteria 1331
511 Ga0495624_0024292 3300046690 Bacteria 3989
512 Ga0495671_0045836 3300046692 Bacteria 2188
513 Ga0495649_0000276 3300046694 Bacteria 45246
514 Ga0495649_0019858 3300046694 Bacteria 3772
515 Ga0495687_001929 3300047443 Bacteria 17770
516 Ga0495687_004091 3300047443 Bacteria 10090
517 Ga0495686_0020115 3300047472 Bacteria 4454
518 Ga0496101_0068118 3300048904 Bacteria 2601
519 Ga0496101_0134419 3300048904 Bacteria 1881
520 Ga0496102_0004774 3300048905 Bacteria 11465
521 Ga0496102_0035825 3300048905 Bacteria 4469
522 Ga0496104_0362367 3300048907 Bacteria 1362
523 Ga0496105_0235722 3300048908 Bacteria 1486
524 Ga0496108_0030449 3300048911 Bacteria 4473
525 Ga0496110_0176928 3300048913 Bacteria 1937
526 Ga0496110_0298336 3300048913 Bacteria 1468
527 Ga0496112_0016698 3300048915 Bacteria 6882
528 Ga0496113_0007231 3300048916 Bacteria 7118
529 Ga0496113_0063585 3300048916 Bacteria 2789
530 Ga0496114_0038403 3300048917 Bacteria 3962
531 Ga0496114_0169368 3300048917 Bacteria 1903
532 Ga0496115_0109451 3300048918 Bacteria 2269
533 Ga0496121_0048421 3300048924 Bacteria 3616
534 Ga0496124_0000273 3300048927 Bacteria 99505
535 Ga0496125_0025441 3300048928 Bacteria 5419
536 Ga0501298_023927 3300049521 Bacteria 1160
537 Ga0501043_0000024 3300049579 Bacteria 154045
538 Ga0501046_0000107 3300049580 Bacteria 88655
539 Ga0501047_0000051 3300049581 Bacteria 154281
540 Ga0501048_0001157 3300049582 Bacteria 19854
541 Ga0501198_000003 3300049649 Bacteria 175301
542 Ga0501222_000001 3300049662 Bacteria 307689
543 Ga0501045_0020912 3300049824 Bacteria 4678
544 nmdc:mga00v17_146225_c1 3300050491 Bacteria 1517
545 nmdc:mga0yw44_12790_c1 3300050492 Bacteria 4389
546 nmdc:mga0k408_10101_c1 3300050493 Bacteria 5100
547 nmdc:mga0k408_23966_c1 3300050493 Bacteria 3447
548 nmdc:mga0k408_4060_c1 3300050493 Bacteria 7766
549 nmdc:mga0k408_5915_c1 3300050493 Bacteria 6525
550 nmdc:mga0k408_7565_c1 3300050493 Bacteria 5802
551 nmdc:mga06z11_25204_c1 3300050494 Bacteria 2816
552 nmdc:mga06z11_31232_c1 3300050494 Bacteria 2586
553 nmdc:mga04h51_2001_c1 3300050495 Bacteria 4768
554 nmdc:mga04h51_9983_c1 3300050495 Bacteria 2593
555 nmdc:mga07m45_13510_c2 3300050496 Bacteria 1983
556 nmdc:mga07m45_17727_c1 3300050496 Bacteria 3831
557 nmdc:mga07m45_22678_c1 3300050496 Bacteria 3430
558 nmdc:mga07m45_23433_c1 3300050496 Bacteria 3375
559 nmdc:mga07m45_3941_c1 3300050496 Bacteria 7214
560 nmdc:mga07m45_41830_c1 3300050496 Bacteria 1859
561 nmdc:mga07m45_5755_c1 3300050496 Bacteria 6204
562 nmdc:mga07m45_63703_c1 3300050496 Bacteria 2091
563 nmdc:mga07m45_638_c1 3300050496 Bacteria 14916
564 nmdc:mga05p37_147209_c1 3300050507 Bacteria 2882
565 nmdc:mga0qj67_10567_c1 3300050509 Bacteria 6896
566 nmdc:mga0qj67_12586_c1 3300050509 Bacteria 6377
567 nmdc:mga08y16_167558_c1 3300050511 Bacteria 2282
568 Ga0495601_0082724 3300053077 Bacteria 2061
569 Ga0500635_0000318 3300053080 Bacteria 16609
570 Ga0495619_0252430 3300053085 Bacteria 1222
571 Ga0500578_0003965 3300053086 Bacteria 10723
572 Ga0500644_0016764 3300053088 Bacteria 2114
573 Ga0500646_0014455 3300053090 Bacteria 2049
574 Ga0500651_0019099 3300053093 Bacteria 4253
575 Ga0500594_0001006 3300053118 Bacteria 6047
576 Ga0500642_0028248 3300053130 Bacteria 2311
577 Ga0500652_003226 3300053131 Bacteria 4930
578 Ga0500559_0000207 3300053136 Bacteria 46949
579 Ga0500619_000179 3300053154 Bacteria 15172
580 Ga0500622_0005558 3300053156 Bacteria 7531
581 Ga0500622_0008903 3300053156 Bacteria 5585
582 Ga0466962_0004424 3300061719 Bacteria 6733
583 Ga0466962_0008417 3300061719 Bacteria 4942

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0029024 Ga0439448_0029024_840_1739 283
2 3300035116 Ga0373945_0017245 Ga0373945_0017245_29_1018 293
3 3300013105 Ga0157369_10005527 Ga0157369_100055272 303
4 3300005366 Ga0070659_100011514 Ga0070659_1000115146 307
5 3300025932 Ga0207690_10087560 Ga0207690_100875602 307
6 3300005327 Ga0070658_10000001 Ga0070658_10000001739 314
7 3300005339 Ga0070660_100002455 Ga0070660_1000024553 314
8 3300005366 Ga0070659_100050123 Ga0070659_1000501232 314
9 3300025909 Ga0207705_10000002 Ga0207705_100000021143 314
10 3300025919 Ga0207657_10021758 Ga0207657_100217583 314
11 3300025932 Ga0207690_10007044 Ga0207690_100070442 314
12 3300039450 Ga0436363_1720631 Ga0436363_1720631_1274_2389 315
13 3300005345 Ga0070692_10001641 Ga0070692_100016411 316
14 3300005345 Ga0070692_10067713 Ga0070692_100677132 316
15 3300021384 Ga0213876_10000234 Ga0213876_1000023448 321
16 3300039437 Ga0436365_1041421 Ga0436365_1041421_44400_45515 321
17 3300049824 Ga0501045_0020912 Ga0501045_0020912_250_1233 322
18 3300049521 Ga0501298_023927 Ga0501298_023927_76_1146 324
19 3300046684 Ga0495669_0102301 Ga0495669_0102301_14_1051 327
20 3300037312 Ga0395899_0260823 Ga0395899_0260823_24_1061 329
21 3300047472 Ga0495686_0020115 Ga0495686_0020115_779_1897 329
22 3300005366 Ga0070659_100084405 Ga0070659_1000844052 331
23 3300005457 Ga0070662_100111891 Ga0070662_1001118912 331
24 3300042012 Ga0439455_0001540 Ga0439455_0001540_2307_3374 331
25 3300042127 Ga0450890_000303 Ga0450890_000303_6060_7097 340
26 3300005457 Ga0070662_100173843 Ga0070662_1001738432 342
27 3300006353 Ga0075370_10045413 Ga0075370_100454132 342
28 3300013307 Ga0157372_10332061 Ga0157372_103320612 342
29 3300025904 Ga0207647_10009993 Ga0207647_100099932 342
30 3300025932 Ga0207690_10069004 Ga0207690_100690042 342
31 3300025933 Ga0207706_10078639 Ga0207706_100786392 342
32 3300042005 Ga0439448_0003000 Ga0439448_0003000_2602_3708 342
33 3300042012 Ga0439455_0008451 Ga0439455_0008451_266_1372 342
34 3300042157 Ga0439458_0003441 Ga0439458_0003441_217_1323 342
35 3300050496 nmdc:mga07m45_41830_c1 nmdc:mga07m45_41830_c1_634_1740 342
36 3300006846 Ga0075430_100081406 Ga0075430_1000814062 345
37 3300050509 nmdc:mga0qj67_10567_c1 nmdc:mga0qj67_10567_c1_1828_2961 345
38 3300026067 Ga0207678_10074445 Ga0207678_100744452 348
39 3300048913 Ga0496110_0298336 Ga0496110_0298336_260_1420 348
40 3300005841 Ga0068863_100214598 Ga0068863_1002145982 349
41 3300013308 Ga0157375_10246415 Ga0157375_102464152 349
42 3300026088 Ga0207641_10091127 Ga0207641_100911272 349
43 3300028666 Ga0265336_10000260 Ga0265336_100002605 349
44 3300029957 Ga0265324_10000004 Ga0265324_1000000472 349
45 3300031241 Ga0265325_10000084 Ga0265325_1000008417 349
46 3300031711 Ga0265314_10003721 Ga0265314_1000372112 349
47 3300031711 Ga0265314_10023534 Ga0265314_100235344 349
48 3300009094 Ga0111539_10278603 Ga0111539_102786032 350
49 3300009176 Ga0105242_10065208 Ga0105242_100652082 350
50 3300014326 Ga0157380_10159123 Ga0157380_101591232 350
51 3300025901 Ga0207688_10123664 Ga0207688_101236642 350
52 3300025934 Ga0207686_10162051 Ga0207686_101620512 350
53 3300028380 Ga0268265_10137353 Ga0268265_101373531 350
54 3300050511 nmdc:mga08y16_167558_c1 nmdc:mga08y16_167558_c1_508_1668 350
55 3300005331 Ga0070670_100047892 Ga0070670_1000478923 351
56 3300005364 Ga0070673_100145175 Ga0070673_1001451751 351
57 3300005618 Ga0068864_100185634 Ga0068864_1001856342 351
58 3300025925 Ga0207650_10011535 Ga0207650_100115355 351
59 3300005328 Ga0070676_10048150 Ga0070676_100481501 354
60 3300005334 Ga0068869_100045478 Ga0068869_1000454782 354
61 3300005338 Ga0068868_100004682 Ga0068868_1000046829 354
62 3300005347 Ga0070668_100089302 Ga0070668_1000893022 354
63 3300005354 Ga0070675_100023702 Ga0070675_1000237024 354
64 3300005355 Ga0070671_100163491 Ga0070671_1001634912 354
65 3300005364 Ga0070673_100168574 Ga0070673_1001685742 354
66 3300005367 Ga0070667_100008278 Ga0070667_1000082785 354
67 3300005456 Ga0070678_100037378 Ga0070678_1000373782 354
68 3300005617 Ga0068859_100004106 Ga0068859_1000041065 354
69 3300005618 Ga0068864_100015752 Ga0068864_1000157522 354
70 3300005719 Ga0068861_100169659 Ga0068861_1001696592 354
71 3300005842 Ga0068858_100012096 Ga0068858_1000120962 354
72 3300006237 Ga0097621_100098542 Ga0097621_1000985421 354
73 3300006931 Ga0097620_100004106 Ga0097620_1000041065 354
74 3300009177 Ga0105248_10217212 Ga0105248_102172122 354
75 3300014325 Ga0163163_10010636 Ga0163163_100106364 354
76 3300014969 Ga0157376_10160211 Ga0157376_101602112 354
77 3300025903 Ga0207680_10025545 Ga0207680_100255452 354
78 3300025926 Ga0207659_10062520 Ga0207659_100625202 354
79 3300025931 Ga0207644_10010832 Ga0207644_100108322 354
80 3300025933 Ga0207706_10029294 Ga0207706_100292944 354
81 3300025934 Ga0207686_10046424 Ga0207686_100464242 354
82 3300025940 Ga0207691_10047060 Ga0207691_100470604 354
83 3300025941 Ga0207711_10127636 Ga0207711_101276362 354
84 3300025942 Ga0207689_10133268 Ga0207689_101332682 354
85 3300025960 Ga0207651_10072443 Ga0207651_100724432 354
86 3300025960 Ga0207651_10090072 Ga0207651_100900722 354
87 3300025986 Ga0207658_10012649 Ga0207658_100126491 354
88 3300026023 Ga0207677_10001235 Ga0207677_100012355 354
89 3300026035 Ga0207703_10003592 Ga0207703_1000359212 354
90 3300026095 Ga0207676_10071455 Ga0207676_100714552 354
91 3300028379 Ga0268266_10368889 Ga0268266_103688891 354
92 3300028381 Ga0268264_10109071 Ga0268264_101090712 354
93 3300048911 Ga0496108_0030449 Ga0496108_0030449_1217_2377 354
94 3300005331 Ga0070670_100103908 Ga0070670_1001039082 355
95 3300005364 Ga0070673_100346518 Ga0070673_1003465181 355
96 3300005367 Ga0070667_100066028 Ga0070667_1000660282 355
97 3300005843 Ga0068860_100095196 Ga0068860_1000951962 355
98 3300006237 Ga0097621_100051214 Ga0097621_1000512142 355
99 3300006358 Ga0068871_100066434 Ga0068871_1000664342 355
100 3300009098 Ga0105245_10168911 Ga0105245_101689112 355
101 3300009101 Ga0105247_10160782 Ga0105247_101607821 355
102 3300009177 Ga0105248_10091586 Ga0105248_100915862 355
103 3300014968 Ga0157379_10241264 Ga0157379_102412642 355
104 3300025931 Ga0207644_10008982 Ga0207644_100089823 355
105 3300025941 Ga0207711_10008941 Ga0207711_100089412 355
106 3300025960 Ga0207651_10210910 Ga0207651_102109102 355
107 3300025986 Ga0207658_10043256 Ga0207658_100432563 355
108 3300026075 Ga0207708_10094440 Ga0207708_100944402 355
109 3300035725 Ga0373947_0181787 Ga0373947_0181787_48_1154 356
110 3300005441 Ga0070700_100215683 Ga0070700_1002156832 357
111 3300009098 Ga0105245_10155639 Ga0105245_101556392 357
112 3300010375 Ga0105239_10155046 Ga0105239_101550462 357
113 3300010375 Ga0105239_10502885 Ga0105239_105028851 357
114 3300013296 Ga0157374_10146598 Ga0157374_101465982 357
115 3300013297 Ga0157378_10216026 Ga0157378_102160262 357
116 3300013308 Ga0157375_10034091 Ga0157375_100340914 357
117 3300025927 Ga0207687_10077378 Ga0207687_100773782 357
118 3300026075 Ga0207708_10173994 Ga0207708_101739942 357
119 3300025961 Ga0207712_10032071 Ga0207712_100320712 358
120 3300003323 rootH1_10029562 rootH1_100295622 359
121 3300003775 Ga0055524_1005390 Ga0055524_10053903 359
122 3300003794 Ga0055531_10004981 Ga0055531_100049817 359
123 3300006944 Ga0099823_1000002 Ga0099823_1000002118 359
124 3300025273 Ga0209673_1022780 Ga0209673_10227802 359
125 3300025298 Ga0209050_1008250 Ga0209050_10082504 359
126 3300025299 Ga0209256_1003387 Ga0209256_10033876 359
127 3300025303 Ga0209051_1003541 Ga0209051_10035413 359
128 3300025304 Ga0209257_1002434 Ga0209257_10024345 359
129 3300027296 Ga0209389_1031075 Ga0209389_10310752 359
130 3300044694 Ga0466963_0023171 Ga0466963_0023171_2446_3600 359
131 3300046681 Ga0495647_0059919 Ga0495647_0059919_324_1484 359
132 3300053156 Ga0500622_0005558 Ga0500622_0005558_2881_4035 359
133 3300005262 Ga0065165_1000079 Ga0065165_100007924 360
134 3300025273 Ga0209673_1022702 Ga0209673_10227022 360
135 3300025295 Ga0209564_1000030 Ga0209564_1000030151 360
136 3300028800 Ga0265338_10059826 Ga0265338_100598264 360
137 3300029957 Ga0265324_10000109 Ga0265324_1000010925 360
138 3300031241 Ga0265325_10025694 Ga0265325_100256942 360
139 3300031711 Ga0265314_10000134 Ga0265314_1000013473 360
140 3300042876 Ga0451577_0000002 Ga0451577_0000002_1504265_1505368 360
141 3300044673 Ga0453683_0000013 Ga0453683_0000013_144822_145925 360
142 3300044712 Ga0453684_0000002 Ga0453684_0000002_226008_227111 360
143 3300045051 Ga0451576_0000037 Ga0451576_0000037_145063_146166 360
144 3300048917 Ga0496114_0169368 Ga0496114_0169368_338_1498 360
145 3300042876 Ga0451577_0011641 Ga0451577_0011641_4064_5221 361
146 3300005339 Ga0070660_100025624 Ga0070660_1000256242 362
147 3300025907 Ga0207645_10153507 Ga0207645_101535072 362
148 3300025909 Ga0207705_10041865 Ga0207705_100418652 362
149 3300028666 Ga0265336_10000030 Ga0265336_10000030135 362
150 3300029957 Ga0265324_10000522 Ga0265324_1000052211 362
151 3300005618 Ga0068864_100132919 Ga0068864_1001329192 363
152 3300042012 Ga0439455_0015604 Ga0439455_0015604_478_1635 363
153 3300044712 Ga0453684_0293421 Ga0453684_0293421_706_1812 363
154 3300009147 Ga0114129_10067923 Ga0114129_100679234 364
155 3300025919 Ga0207657_10036415 Ga0207657_100364154 364
156 3300032004 Ga0307414_10191882 Ga0307414_101918822 364
157 3300044712 Ga0453684_0040217 Ga0453684_0040217_3245_4399 364
158 3300050507 nmdc:mga05p37_147209_c1 nmdc:mga05p37_147209_c1_1015_2172 364
159 3300025253 Ga0209677_105636 Ga0209677_1056362 365
160 3300028794 Ga0307515_10061615 Ga0307515_100616152 365
161 3300035172 Ga0373955_0071005 Ga0373955_0071005_144_1304 365
162 3300035695 Ga0373927_0067846 Ga0373927_0067846_388_1548 365
163 3300053085 Ga0495619_0252430 Ga0495619_0252430_50_1210 365
164 3300025256 Ga0209759_1013534 Ga0209759_10135342 366
165 3300046506 Ga0495583_0000022 Ga0495583_0000022_276536_277690 366
166 3300046507 Ga0495606_0006644 Ga0495606_0006644_4702_5856 366
167 3300046660 Ga0495625_0028632 Ga0495625_0028632_2963_4117 366
168 3300046694 Ga0495649_0000276 Ga0495649_0000276_5401_6555 366
169 3300048918 Ga0496115_0109451 Ga0496115_0109451_1075_2229 366
170 3300005327 Ga0070658_10042789 Ga0070658_100427892 367
171 3300021361 Ga0213872_10000286 Ga0213872_1000028628 367
172 3300025908 Ga0207643_10117579 Ga0207643_101175792 367
173 3300039447 Ga0436361_0147565 Ga0436361_0147565_47046_48200 367
174 3300039447 Ga0436361_1129825 Ga0436361_1129825_1914_3068 367
175 3300005614 Ga0068856_100037290 Ga0068856_1000372902 368
176 3300026078 Ga0207702_10056893 Ga0207702_100568932 368
177 3300031548 Ga0307408_100035791 Ga0307408_1000357912 368
178 3300031901 Ga0307406_10086629 Ga0307406_100866292 368
179 3300032002 Ga0307416_100212879 Ga0307416_1002128791 368
180 3300032005 Ga0307411_10302992 Ga0307411_103029921 368
181 3300037466 Ga0395898_0120447 Ga0395898_0120447_333_1487 368
182 3300038443 Ga0395901_0022909 Ga0395901_0022909_4946_6100 368
183 3300031731 Ga0307405_10006527 Ga0307405_100065275 370
184 3300031824 Ga0307413_10152474 Ga0307413_101524742 370
185 3300031852 Ga0307410_10006677 Ga0307410_100066773 370
186 3300031901 Ga0307406_10004814 Ga0307406_100048144 370
187 3300031911 Ga0307412_10007849 Ga0307412_100078492 370
188 3300032002 Ga0307416_100046031 Ga0307416_1000460311 370
189 3300032004 Ga0307414_10021756 Ga0307414_100217562 370
190 3300032005 Ga0307411_10144737 Ga0307411_101447372 370
191 3300036401 Ga0373937_0158361 Ga0373937_0158361_234_1394 370
192 3300048904 Ga0496101_0134419 Ga0496101_0134419_538_1698 370
193 3300005457 Ga0070662_100002087 Ga0070662_1000020872 371
194 3300025920 Ga0207649_10099654 Ga0207649_100996542 371
195 3300025933 Ga0207706_10002326 Ga0207706_100023262 371
196 3300028794 Ga0307515_10075820 Ga0307515_100758203 371
197 3300031456 Ga0307513_10079132 Ga0307513_100791322 371
198 3300042125 Ga0450923_002188 Ga0450923_002188_1615_2745 371
199 3300035695 Ga0373927_0041637 Ga0373927_0041637_1649_2803 372
200 3300037068 Ga0373925_0020505 Ga0373925_0020505_1790_2944 372
201 3300006353 Ga0075370_10035225 Ga0075370_100352253 373
202 3300025893 Ga0207682_10007238 Ga0207682_100072384 373
203 3300028794 Ga0307515_10034662 Ga0307515_100346628 373
204 3300031507 Ga0307509_10045186 Ga0307509_100451864 373
205 3300031507 Ga0307509_10046455 Ga0307509_100464555 373
206 3300031507 Ga0307509_10075676 Ga0307509_100756762 373
207 3300031507 Ga0307509_10080732 Ga0307509_100807322 373
208 3300031616 Ga0307508_10000048 Ga0307508_1000004837 373
209 3300031616 Ga0307508_10157944 Ga0307508_101579442 373
210 3300044656 Ga0466969_0007097 Ga0466969_0007097_1838_2989 373
211 3300044693 Ga0466961_0008485 Ga0466961_0008485_1616_2767 373
212 3300044706 Ga0466964_0038300 Ga0466964_0038300_568_1719 373
213 3300045049 Ga0466959_0019638 Ga0466959_0019638_2829_3980 373
214 3300046519 Ga0495632_0004037 Ga0495632_0004037_6006_7160 373
215 3300050496 nmdc:mga07m45_13510_c2 nmdc:mga07m45_13510_c2_371_1525 373
216 3300053088 Ga0500644_0016764 Ga0500644_0016764_243_1397 373
217 3300053131 Ga0500652_003226 Ga0500652_003226_1059_2213 373
218 3300061719 Ga0466962_0004424 Ga0466962_0004424_5571_6722 373
219 3300025931 Ga0207644_10151195 Ga0207644_101511952 374
220 3300028794 Ga0307515_10000013 Ga0307515_10000013515 374
221 3300028794 Ga0307515_10000239 Ga0307515_10000239114 374
222 3300003791 Ga0055530_10017992 Ga0055530_100179922 375
223 3300005262 Ga0065165_1001510 Ga0065165_100151018 375
224 iso_pu_bacteria 2585428057 2587727311 375
225 iso_pu_bacteria 2585428058 2587735939 375
226 iso_pu_bacteria 2585428062 2587757847 375
227 iso_pu_bacteria 2588253510 2588292660 375
228 iso_pu_bacteria 2643221592 2643967240 375
229 iso_pu_bacteria 2643221625 2644140071 375
230 iso_pu_bacteria 2643221648 2644271311 375
231 iso_pu_bacteria 2831864461 2831865442 375
232 iso_pu_bacteria 2886848708 2886849919 375
233 3300025298 Ga0209050_1000614 Ga0209050_100061439 376
234 3300031507 Ga0307509_10000135 Ga0307509_1000013522 376
235 3300033180 Ga0307510_10024531 Ga0307510_100245312 376
236 3300033180 Ga0307510_10033752 Ga0307510_100337524 376
237 3300046454 Ga0495592_0000185 Ga0495592_0000185_36926_38080 376
238 3300053086 Ga0500578_0003965 Ga0500578_0003965_8355_9509 376
239 3300053093 Ga0500651_0019099 Ga0500651_0019099_2243_3397 376
240 3300053118 Ga0500594_0001006 Ga0500594_0001006_2540_3694 376
241 3300053130 Ga0500642_0028248 Ga0500642_0028248_128_1282 376
242 3300053136 Ga0500559_0000207 Ga0500559_0000207_41311_42465 376
243 3300053156 Ga0500622_0008903 Ga0500622_0008903_4382_5536 376
244 iso_pu_bacteria 2643221644 2644245983 376
245 iso_pu_bacteria 2643221654 2644305520 376
246 3300001979 JGI24740J21852_10044089 JGI24740J21852_100440891 377
247 3300025981 Ga0207640_10263626 Ga0207640_102636261 377
248 3300005354 Ga0070675_100092899 Ga0070675_1000928992 378
249 3300005543 Ga0070672_100150107 Ga0070672_1001501072 378
250 3300006178 Ga0075367_10094174 Ga0075367_100941742 378
251 3300014969 Ga0157376_10031404 Ga0157376_100314043 378
252 3300021361 Ga0213872_10000510 Ga0213872_100005109 378
253 3300025230 Ga0209563_100014 Ga0209563_100014765 378
254 3300025321 Ga0207656_10020347 Ga0207656_100203472 378
255 3300026095 Ga0207676_10020271 Ga0207676_100202712 378
256 3300028794 Ga0307515_10000179 Ga0307515_10000179124 378
257 3300028794 Ga0307515_10001166 Ga0307515_1000116628 378
258 3300028794 Ga0307515_10019026 Ga0307515_100190269 378
259 3300030522 Ga0307512_10029280 Ga0307512_100292802 378
260 3300031456 Ga0307513_10110681 Ga0307513_101106811 378
261 3300031507 Ga0307509_10082225 Ga0307509_100822252 378
262 3300031616 Ga0307508_10000122 Ga0307508_1000012266 378
263 3300031730 Ga0307516_10005879 Ga0307516_1000587912 378
264 3300033179 Ga0307507_10014209 Ga0307507_100142091 378
265 3300035091 Ga0373951_0012000 Ga0373951_0012000_711_1865 378
266 3300035114 Ga0373939_0000003 Ga0373939_0000003_71825_72979 378
267 3300035121 Ga0373960_0001502 Ga0373960_0001502_3061_4215 378
268 3300035691 Ga0373931_0001000 Ga0373931_0001000_3250_4404 378
269 3300035692 Ga0373935_0161176 Ga0373935_0161176_12_1172 378
270 3300036401 Ga0373937_0177245 Ga0373937_0177245_514_1674 378
271 3300037471 Ga0395905_0004009 Ga0395905_0004009_4427_5578 378
272 3300039447 Ga0436361_0372090 Ga0436361_0372090_19511_20665 378
273 3300044656 Ga0466969_0000009 Ga0466969_0000009_103785_104936 378
274 3300045049 Ga0466959_0014467 Ga0466959_0014467_460_1611 378
275 3300046660 Ga0495625_0006884 Ga0495625_0006884_4715_5869 378
276 3300046683 Ga0495658_0057116 Ga0495658_0057116_55_1215 378
277 3300053077 Ga0495601_0082724 Ga0495601_0082724_316_1476 378
278 3300002738 JGI25154J39366_1000937 JGI25154J39366_100093711 379
279 3300002741 JGI25157J39369_1000361 JGI25157J39369_100036128 379
280 3300002772 JGI25164J39214_1005709 JGI25164J39214_10057091 379
281 3300002773 JGI25152J39213_1001024 JGI25152J39213_10010248 379
282 3300003215 JGI25153J46596_10000904 JGI25153J46596_100009042 379
283 3300003215 JGI25153J46596_10012019 JGI25153J46596_100120192 379
284 3300003322 rootL2_10059169 rootL2_100591693 379
285 3300003756 Ga0055533_1000048 Ga0055533_100004877 379
286 3300003756 Ga0055533_1000068 Ga0055533_10000686 379
287 3300003759 Ga0055525_1001441 Ga0055525_10014413 379
288 3300003761 Ga0055535_1000917 Ga0055535_10009172 379
289 3300003763 Ga0055529_1000291 Ga0055529_100029118 379
290 3300003771 Ga0055526_1001136 Ga0055526_10011369 379
291 3300003775 Ga0055524_1001779 Ga0055524_10017795 379
292 3300003794 Ga0055531_10012094 Ga0055531_100120942 379
293 3300005262 Ga0065165_1002283 Ga0065165_100228311 379
294 3300005295 Ga0065707_10090986 Ga0065707_100909862 379
295 3300005334 Ga0068869_100065020 Ga0068869_1000650202 379
296 3300005336 Ga0070680_100072767 Ga0070680_1000727672 379
297 3300005338 Ga0068868_100022229 Ga0068868_1000222292 379
298 3300005338 Ga0068868_100030420 Ga0068868_1000304205 379
299 3300005339 Ga0070660_100026263 Ga0070660_1000262633 379
300 3300005339 Ga0070660_100090110 Ga0070660_1000901102 379
301 3300005344 Ga0070661_100068331 Ga0070661_1000683312 379
302 3300005354 Ga0070675_100016355 Ga0070675_1000163555 379
303 3300005355 Ga0070671_100075394 Ga0070671_1000753942 379
304 3300005364 Ga0070673_100028817 Ga0070673_1000288173 379
305 3300005367 Ga0070667_100224342 Ga0070667_1002243422 379
306 3300005455 Ga0070663_100046195 Ga0070663_1000461952 379
307 3300005455 Ga0070663_100068556 Ga0070663_1000685561 379
308 3300005456 Ga0070678_100095910 Ga0070678_1000959101 379
309 3300005457 Ga0070662_100001972 Ga0070662_10000197214 379
310 3300005459 Ga0068867_100000074 Ga0068867_10000007417 379
311 3300005459 Ga0068867_100016932 Ga0068867_1000169324 379
312 3300005459 Ga0068867_100019791 Ga0068867_1000197913 379
313 3300005459 Ga0068867_100100750 Ga0068867_1001007502 379
314 3300005467 Ga0070706_100001812 Ga0070706_10000181215 379
315 3300005468 Ga0070707_100065034 Ga0070707_1000650342 379
316 3300005530 Ga0070679_100061522 Ga0070679_1000615221 379
317 3300005539 Ga0068853_100077897 Ga0068853_1000778972 379
318 3300005539 Ga0068853_100222775 Ga0068853_1002227752 379
319 3300005548 Ga0070665_100038822 Ga0070665_1000388224 379
320 3300005563 Ga0068855_100056191 Ga0068855_1000561913 379
321 3300005563 Ga0068855_100076382 Ga0068855_1000763822 379
322 3300005564 Ga0070664_100134325 Ga0070664_1001343251 379
323 3300005577 Ga0068857_100004217 Ga0068857_1000042175 379
324 3300005577 Ga0068857_100013612 Ga0068857_1000136124 379
325 3300005577 Ga0068857_100048921 Ga0068857_1000489213 379
326 3300005578 Ga0068854_100045107 Ga0068854_1000451072 379
327 3300005578 Ga0068854_100047902 Ga0068854_1000479022 379
328 3300005614 Ga0068856_100001787 Ga0068856_10000178717 379
329 3300005614 Ga0068856_100116430 Ga0068856_1001164302 379
330 3300005616 Ga0068852_100092002 Ga0068852_1000920022 379
331 3300005616 Ga0068852_100126431 Ga0068852_1001264312 379
332 3300005616 Ga0068852_100173945 Ga0068852_1001739452 379
333 3300005616 Ga0068852_100233945 Ga0068852_1002339452 379
334 3300005616 Ga0068852_100481171 Ga0068852_1004811711 379
335 3300005618 Ga0068864_100315504 Ga0068864_1003155042 379
336 3300005719 Ga0068861_100012599 Ga0068861_1000125995 379
337 3300005841 Ga0068863_100018149 Ga0068863_1000181495 379
338 3300005842 Ga0068858_100212585 Ga0068858_1002125852 379
339 3300005843 Ga0068860_100036624 Ga0068860_1000366242 379
340 3300005844 Ga0068862_100016050 Ga0068862_1000160503 379
341 3300005844 Ga0068862_100050997 Ga0068862_1000509974 379
342 3300006038 Ga0075365_10044946 Ga0075365_100449463 379
343 3300006042 Ga0075368_10007764 Ga0075368_100077642 379
344 3300006048 Ga0075363_100027136 Ga0075363_1000271362 379
345 3300006177 Ga0075362_10005083 Ga0075362_100050834 379
346 3300006178 Ga0075367_10003757 Ga0075367_100037575 379
347 3300006178 Ga0075367_10008433 Ga0075367_100084332 379
348 3300006178 Ga0075367_10015315 Ga0075367_100153153 379
349 3300006178 Ga0075367_10173251 Ga0075367_101732512 379
350 3300006186 Ga0075369_10001649 Ga0075369_100016492 379
351 3300006195 Ga0075366_10014272 Ga0075366_100142722 379
352 3300006195 Ga0075366_10034757 Ga0075366_100347572 379
353 3300006195 Ga0075366_10137035 Ga0075366_101370352 379
354 3300006237 Ga0097621_100064663 Ga0097621_1000646632 379
355 3300006353 Ga0075370_10002473 Ga0075370_100024738 379
356 3300006353 Ga0075370_10003868 Ga0075370_100038683 379
357 3300006353 Ga0075370_10008355 Ga0075370_100083552 379
358 3300006353 Ga0075370_10010033 Ga0075370_100100332 379
359 3300006846 Ga0075430_100012408 Ga0075430_1000124084 379
360 3300006880 Ga0075429_100000549 Ga0075429_10000054918 379
361 3300009093 Ga0105240_10050356 Ga0105240_100503562 379
362 3300009098 Ga0105245_10098671 Ga0105245_100986712 379
363 3300009148 Ga0105243_10013068 Ga0105243_100130683 379
364 3300009148 Ga0105243_10070295 Ga0105243_100702953 379
365 3300009174 Ga0105241_10034699 Ga0105241_100346992 379
366 3300009545 Ga0105237_10083448 Ga0105237_100834482 379
367 3300009545 Ga0105237_10314085 Ga0105237_103140852 379
368 3300010375 Ga0105239_10037165 Ga0105239_100371654 379
369 3300010375 Ga0105239_10055004 Ga0105239_100550042 379
370 3300010375 Ga0105239_10369365 Ga0105239_103693652 379
371 3300011119 Ga0105246_10052639 Ga0105246_100526392 379
372 3300012497 Ga0157319_1000007 Ga0157319_100000784 379
373 3300013100 Ga0157373_10056067 Ga0157373_100560672 379
374 3300013105 Ga0157369_10113559 Ga0157369_101135592 379
375 3300013296 Ga0157374_10168961 Ga0157374_101689612 379
376 3300013306 Ga0163162_10151886 Ga0163162_101518862 379
377 3300013308 Ga0157375_10387732 Ga0157375_103877322 379
378 3300014745 Ga0157377_10000006 Ga0157377_100000068 379
379 3300014968 Ga0157379_10058377 Ga0157379_100583773 379
380 3300014969 Ga0157376_10161544 Ga0157376_101615442 379
381 3300017792 Ga0163161_10096385 Ga0163161_100963852 379
382 3300021384 Ga0213876_10015405 Ga0213876_100154051 379
383 3300025226 Ga0209674_100024 Ga0209674_100024374 379
384 3300025230 Ga0209563_100101 Ga0209563_1001016 379
385 3300025242 Ga0209258_100180 Ga0209258_10018066 379
386 3300025242 Ga0209258_100777 Ga0209258_1007772 379
387 3300025246 Ga0209646_1000012 Ga0209646_1000012134 379
388 3300025250 Ga0209026_1000004 Ga0209026_1000004483 379
389 3300025253 Ga0209677_100091 Ga0209677_100091106 379
390 3300025253 Ga0209677_101750 Ga0209677_1017505 379
391 3300025254 Ga0209148_1006729 Ga0209148_10067292 379
392 3300025256 Ga0209759_1000003 Ga0209759_1000003242 379
393 3300025256 Ga0209759_1000067 Ga0209759_1000067173 379
394 3300025256 Ga0209759_1001906 Ga0209759_10019062 379
395 3300025256 Ga0209759_1008275 Ga0209759_10082752 379
396 3300025258 Ga0209129_1000035 Ga0209129_1000035217 379
397 3300025272 Ga0209455_1000144 Ga0209455_100014466 379
398 3300025273 Ga0209673_1014757 Ga0209673_10147572 379
399 3300025295 Ga0209564_1000024 Ga0209564_1000024411 379
400 3300025297 Ga0209758_1000066 Ga0209758_1000066101 379
401 3300025297 Ga0209758_1000248 Ga0209758_100024865 379
402 3300025299 Ga0209256_1000197 Ga0209256_10001977 379
403 3300025299 Ga0209256_1027942 Ga0209256_10279421 379
404 3300025303 Ga0209051_1002061 Ga0209051_100206111 379
405 3300025303 Ga0209051_1002964 Ga0209051_10029647 379
406 3300025304 Ga0209257_1004130 Ga0209257_10041307 379
407 3300025910 Ga0207684_10005403 Ga0207684_1000540312 379
408 3300025913 Ga0207695_10026886 Ga0207695_100268865 379
409 3300025913 Ga0207695_10071453 Ga0207695_100714532 379
410 3300025913 Ga0207695_10075293 Ga0207695_100752932 379
411 3300025914 Ga0207671_10034414 Ga0207671_100344143 379
412 3300025914 Ga0207671_10034539 Ga0207671_100345392 379
413 3300025918 Ga0207662_10078340 Ga0207662_100783402 379
414 3300025919 Ga0207657_10149925 Ga0207657_101499252 379
415 3300025919 Ga0207657_10300196 Ga0207657_103001961 379
416 3300025920 Ga0207649_10082794 Ga0207649_100827942 379
417 3300025922 Ga0207646_10025442 Ga0207646_100254422 379
418 3300025923 Ga0207681_10040776 Ga0207681_100407762 379
419 3300025924 Ga0207694_10113511 Ga0207694_101135112 379
420 3300025926 Ga0207659_10053395 Ga0207659_100533952 379
421 3300025927 Ga0207687_10235178 Ga0207687_102351782 379
422 3300025931 Ga0207644_10021081 Ga0207644_100210813 379
423 3300025931 Ga0207644_10044828 Ga0207644_100448283 379
424 3300025932 Ga0207690_10155333 Ga0207690_101553331 379
425 3300025933 Ga0207706_10025882 Ga0207706_100258822 379
426 3300025933 Ga0207706_10066743 Ga0207706_100667432 379
427 3300025935 Ga0207709_10007745 Ga0207709_100077454 379
428 3300025935 Ga0207709_10208528 Ga0207709_102085282 379
429 3300025942 Ga0207689_10018619 Ga0207689_100186192 379
430 3300025944 Ga0207661_10105194 Ga0207661_101051942 379
431 3300025945 Ga0207679_10010126 Ga0207679_100101265 379
432 3300025949 Ga0207667_10021849 Ga0207667_100218492 379
433 3300025960 Ga0207651_10018533 Ga0207651_100185333 379
434 3300025981 Ga0207640_10007735 Ga0207640_100077353 379
435 3300025986 Ga0207658_10244092 Ga0207658_102440922 379
436 3300026023 Ga0207677_10014267 Ga0207677_100142674 379
437 3300026023 Ga0207677_10125475 Ga0207677_101254752 379
438 3300026041 Ga0207639_10299319 Ga0207639_102993192 379
439 3300026067 Ga0207678_10083994 Ga0207678_100839941 379
440 3300026067 Ga0207678_10124281 Ga0207678_101242812 379
441 3300026078 Ga0207702_10000033 Ga0207702_1000003310 379
442 3300026089 Ga0207648_10000039 Ga0207648_1000003960 379
443 3300026089 Ga0207648_10051426 Ga0207648_100514263 379
444 3300026089 Ga0207648_10060172 Ga0207648_100601722 379
445 3300026089 Ga0207648_10068722 Ga0207648_100687222 379
446 3300026095 Ga0207676_10011369 Ga0207676_100113694 379
447 3300026116 Ga0207674_10004849 Ga0207674_1000484916 379
448 3300026116 Ga0207674_10017935 Ga0207674_100179352 379
449 3300026116 Ga0207674_10039358 Ga0207674_100393585 379
450 3300026116 Ga0207674_10084515 Ga0207674_100845152 379
451 3300026116 Ga0207674_10184103 Ga0207674_101841032 379
452 3300026118 Ga0207675_100018234 Ga0207675_1000182342 379
453 3300026118 Ga0207675_100022435 Ga0207675_1000224355 379
454 3300026121 Ga0207683_10124007 Ga0207683_101240071 379
455 3300026142 Ga0207698_10033942 Ga0207698_100339423 379
456 3300026142 Ga0207698_10320971 Ga0207698_103209712 379
457 3300026142 Ga0207698_10365989 Ga0207698_103659891 379
458 3300028379 Ga0268266_10201755 Ga0268266_102017552 379
459 3300028380 Ga0268265_10055489 Ga0268265_100554891 379
460 3300028381 Ga0268264_10053035 Ga0268264_100530352 379
461 3300028786 Ga0307517_10003885 Ga0307517_1000388519 379
462 3300028786 Ga0307517_10103686 Ga0307517_101036862 379
463 3300028786 Ga0307517_10117758 Ga0307517_101177582 379
464 3300028794 Ga0307515_10021584 Ga0307515_100215842 379
465 3300028794 Ga0307515_10074489 Ga0307515_100744892 379
466 3300029957 Ga0265324_10060151 Ga0265324_100601511 379
467 3300031507 Ga0307509_10083895 Ga0307509_100838952 379
468 3300031507 Ga0307509_10143228 Ga0307509_101432282 379
469 3300031548 Ga0307408_100002033 Ga0307408_1000020337 379
470 3300031548 Ga0307408_100271452 Ga0307408_1002714521 379
471 3300031649 Ga0307514_10000595 Ga0307514_1000059518 379
472 3300031649 Ga0307514_10144322 Ga0307514_101443222 379
473 3300031730 Ga0307516_10000243 Ga0307516_1000024314 379
474 3300031730 Ga0307516_10000942 Ga0307516_100009425 379
475 3300031730 Ga0307516_10049504 Ga0307516_100495042 379
476 3300031731 Ga0307405_10052799 Ga0307405_100527992 379
477 3300031911 Ga0307412_10025572 Ga0307412_100255722 379
478 3300031995 Ga0307409_100000263 Ga0307409_1000002632 379
479 3300032002 Ga0307416_100010747 Ga0307416_1000107475 379
480 3300032126 Ga0307415_100002117 Ga0307415_1000021172 379
481 3300033180 Ga0307510_10019100 Ga0307510_100191007 379
482 3300034957 Ga0373938_0004483 Ga0373938_0004483_352_1506 379
483 3300035691 Ga0373931_0001994 Ga0373931_0001994_3755_4918 379
484 3300035691 Ga0373931_0034620 Ga0373931_0034620_73_1227 379
485 3300036401 Ga0373937_0083668 Ga0373937_0083668_82_1236 379
486 3300036401 Ga0373937_0171685 Ga0373937_0171685_347_1501 379
487 3300037068 Ga0373925_0006787 Ga0373925_0006787_7147_8301 379
488 3300037471 Ga0395905_0027724 Ga0395905_0027724_499_1656 379
489 3300039437 Ga0436365_0730430 Ga0436365_0730430_2105_3268 379
490 3300039447 Ga0436361_0602459 Ga0436361_0602459_1907_3061 379
491 3300039450 Ga0436363_1578616 Ga0436363_1578616_695_1858 379
492 3300042438 Ga0439459_0000614 Ga0439459_0000614_270_1424 379
493 3300042876 Ga0451577_0005990 Ga0451577_0005990_4140_5294 379
494 3300042876 Ga0451577_0021420 Ga0451577_0021420_416_1576 379
495 3300042876 Ga0451577_0228983 Ga0451577_0228983_190_1350 379
496 3300044656 Ga0466969_0027851 Ga0466969_0027851_134_1288 379
497 3300044658 Ga0466972_0005323 Ga0466972_0005323_1471_2625 379
498 3300044683 Ga0466965_0097007 Ga0466965_0097007_34_1188 379
499 3300044684 Ga0466966_0000566 Ga0466966_0000566_3877_5031 379
500 3300044694 Ga0466963_0197183 Ga0466963_0197183_51_1205 379
501 3300044706 Ga0466964_0002753 Ga0466964_0002753_4371_5525 379
502 3300044719 Ga0466971_0069364 Ga0466971_0069364_120_1274 379
503 3300044765 Ga0466970_0132918 Ga0466970_0132918_41_1195 379
504 3300044842 Ga0466957_0096502 Ga0466957_0096502_97_1251 379
505 3300045049 Ga0466959_0155875 Ga0466959_0155875_357_1511 379
506 3300045051 Ga0451576_0011961 Ga0451576_0011961_4044_5198 379
507 3300046457 Ga0495590_0003929 Ga0495590_0003929_4650_5804 379
508 3300046507 Ga0495606_0089597 Ga0495606_0089597_648_1802 379
509 3300046512 Ga0495610_0040794 Ga0495610_0040794_599_1753 379
510 3300046519 Ga0495632_0005415 Ga0495632_0005415_3961_5115 379
511 3300046519 Ga0495632_0072991 Ga0495632_0072991_21_1175 379
512 3300046542 Ga0495597_0003643 Ga0495597_0003643_4106_5260 379
513 3300046616 Ga0495668_0056332 Ga0495668_0056332_554_1708 379
514 3300046660 Ga0495625_0036327 Ga0495625_0036327_1832_2986 379
515 3300046683 Ga0495658_0049639 Ga0495658_0049639_802_1956 379
516 3300046690 Ga0495624_0024292 Ga0495624_0024292_727_1881 379
517 3300046692 Ga0495671_0045836 Ga0495671_0045836_777_1931 379
518 3300046694 Ga0495649_0019858 Ga0495649_0019858_1816_2970 379
519 3300047443 Ga0495687_001929 Ga0495687_001929_12345_13499 379
520 3300047443 Ga0495687_004091 Ga0495687_004091_5101_6255 379
521 3300048904 Ga0496101_0068118 Ga0496101_0068118_925_2088 379
522 3300048905 Ga0496102_0004774 Ga0496102_0004774_4497_5651 379
523 3300048905 Ga0496102_0035825 Ga0496102_0035825_1525_2679 379
524 3300048907 Ga0496104_0362367 Ga0496104_0362367_148_1302 379
525 3300048916 Ga0496113_0063585 Ga0496113_0063585_1018_2181 379
526 3300048917 Ga0496114_0038403 Ga0496114_0038403_936_2099 379
527 3300048924 Ga0496121_0048421 Ga0496121_0048421_1461_2615 379
528 3300048927 Ga0496124_0000273 Ga0496124_0000273_40980_42134 379
529 3300048928 Ga0496125_0025441 Ga0496125_0025441_2865_4019 379
530 3300049579 Ga0501043_0000024 Ga0501043_0000024_117942_119096 379
531 3300049580 Ga0501046_0000107 Ga0501046_0000107_52544_53698 379
532 3300049581 Ga0501047_0000051 Ga0501047_0000051_34940_36094 379
533 3300049582 Ga0501048_0001157 Ga0501048_0001157_3919_5073 379
534 3300049649 Ga0501198_000003 Ga0501198_000003_87057_88214 379
535 3300049662 Ga0501222_000001 Ga0501222_000001_302958_304115 379
536 3300050491 nmdc:mga00v17_146225_c1 nmdc:mga00v17_146225_c1_351_1505 379
537 3300050492 nmdc:mga0yw44_12790_c1 nmdc:mga0yw44_12790_c1_950_2104 379
538 3300050493 nmdc:mga0k408_10101_c1 nmdc:mga0k408_10101_c1_3765_4919 379
539 3300050493 nmdc:mga0k408_23966_c1 nmdc:mga0k408_23966_c1_952_2106 379
540 3300050493 nmdc:mga0k408_4060_c1 nmdc:mga0k408_4060_c1_2434_3588 379
541 3300050493 nmdc:mga0k408_5915_c1 nmdc:mga0k408_5915_c1_3734_4888 379
542 3300050493 nmdc:mga0k408_7565_c1 nmdc:mga0k408_7565_c1_1547_2701 379
543 3300050494 nmdc:mga06z11_25204_c1 nmdc:mga06z11_25204_c1_1407_2561 379
544 3300050494 nmdc:mga06z11_31232_c1 nmdc:mga06z11_31232_c1_1153_2307 379
545 3300050495 nmdc:mga04h51_2001_c1 nmdc:mga04h51_2001_c1_964_2118 379
546 3300050495 nmdc:mga04h51_9983_c1 nmdc:mga04h51_9983_c1_893_2047 379
547 3300050496 nmdc:mga07m45_17727_c1 nmdc:mga07m45_17727_c1_846_2000 379
548 3300050496 nmdc:mga07m45_22678_c1 nmdc:mga07m45_22678_c1_154_1308 379
549 3300050496 nmdc:mga07m45_23433_c1 nmdc:mga07m45_23433_c1_1408_2562 379
550 3300050496 nmdc:mga07m45_3941_c1 nmdc:mga07m45_3941_c1_4244_5398 379
551 3300050496 nmdc:mga07m45_5755_c1 nmdc:mga07m45_5755_c1_4364_5518 379
552 3300050496 nmdc:mga07m45_63703_c1 nmdc:mga07m45_63703_c1_748_1902 379
553 3300050496 nmdc:mga07m45_638_c1 nmdc:mga07m45_638_c1_950_2104 379
554 3300050509 nmdc:mga0qj67_12586_c1 nmdc:mga0qj67_12586_c1_3518_4672 379
555 3300053080 Ga0500635_0000318 Ga0500635_0000318_8784_9938 379
556 3300053090 Ga0500646_0014455 Ga0500646_0014455_661_1815 379
557 3300053154 Ga0500619_000179 Ga0500619_000179_4225_5379 379
558 3300061719 Ga0466962_0008417 Ga0466962_0008417_337_1491 379
559 3300003775 Ga0055524_1000137 Ga0055524_100013728 380
560 3300003791 Ga0055530_10001713 Ga0055530_100017138 380
561 3300003792 Ga0055540_1000042 Ga0055540_100004264 380
562 3300003794 Ga0055531_10010420 Ga0055531_100104202 380
563 3300005344 Ga0070661_100000143 Ga0070661_10000014348 380
564 3300005366 Ga0070659_100001187 Ga0070659_1000011879 380
565 3300005564 Ga0070664_100012445 Ga0070664_1000124455 380
566 3300005618 Ga0068864_100184437 Ga0068864_1001844372 380
567 3300005841 Ga0068863_100155000 Ga0068863_1001550001 380
568 3300006946 Ga0079104_1000012 Ga0079104_100001283 380
569 3300009177 Ga0105248_10001875 Ga0105248_100018753 380
570 3300025263 Ga0209565_1002606 Ga0209565_10026061 380
571 3300025298 Ga0209050_1000556 Ga0209050_100055656 380
572 3300025298 Ga0209050_1008170 Ga0209050_10081702 380
573 3300025299 Ga0209256_1000030 Ga0209256_1000030237 380
574 3300025303 Ga0209051_1000004 Ga0209051_1000004656 380
575 3300025304 Ga0209257_1000063 Ga0209257_1000063142 380
576 3300025920 Ga0207649_10007131 Ga0207649_100071313 380
577 3300025932 Ga0207690_10001085 Ga0207690_100010858 380
578 3300025941 Ga0207711_10001495 Ga0207711_100014952 380
579 3300025945 Ga0207679_10000107 Ga0207679_1000010714 380
580 3300027111 Ga0209281_1000039 Ga0209281_1000039243 380
581 3300028794 Ga0307515_10038409 Ga0307515_100384094 380
582 3300042531 Ga0450918_000035 Ga0450918_000035_26085_27242 380
583 3300048908 Ga0496105_0235722 Ga0496105_0235722_215_1375 380
584 3300048913 Ga0496110_0176928 Ga0496110_0176928_161_1321 380
585 3300048915 Ga0496112_0016698 Ga0496112_0016698_1494_2654 380
586 3300048916 Ga0496113_0007231 Ga0496113_0007231_126_1286 380
587 3300005331 Ga0070670_100285891 Ga0070670_1002858911 381
588 3300005356 Ga0070674_100002334 Ga0070674_1000023346 381
589 3300005459 Ga0068867_100050890 Ga0068867_1000508902 381
590 3300006195 Ga0075366_10003901 Ga0075366_100039017 381
591 3300025960 Ga0207651_10126081 Ga0207651_101260811 381
592 3300026121 Ga0207683_10151917 Ga0207683_101519171 381
593 3300006195 Ga0075366_10022587 Ga0075366_100225872 384
594 3300001979 JGI24740J21852_10004614 JGI24740J21852_100046144 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

33

390

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tj3-assembly1.cif.gz_B structural basis of peptidoglycan synthesis by e. coli roda-pbp2 complex 0.8374 20 379
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8323 24 381
8tj3-assembly1.cif.gz_B structural basis of peptidoglycan synthesis by e. coli roda-pbp2 complex 0.8285 20 379
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8244 21 381
6pl5-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.8243 24 381
ID Description Score Start End Superfamily
af_Q57586_10_105_1.20.120.420 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);translation initiation factor eif-2b, domain 1 0.6723 122 186 1.20.120.420
1t5oA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);translation initiation factor eif-2b, domain 1 0.5458 116 182 1.20.120.420
af_Q57586_10_105_1.20.120.420 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);translation initiation factor eif-2b, domain 1 0.4546 122 186 1.20.120.420
af_K7MB47_65_296_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3486 79 186 1.25.40.10
af_G3V955_44_182_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3254 81 204 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A0T2YZ76-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9316 7 385 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555
AF-A0A521Z6H6-F1-model_v4 Rod shape-determining protein RodA 0.9305 9 198 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A2N4XQP0-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9243 17 381 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555
AF-A0A5E4RNR2-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9229 9 385 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555
AF-A0A0T2YZ76-F1-model_v4 Peptidoglycan glycosyltransferase MrdB (PGT) (EC 2.4.99.28) (Cell elongation protein RodA) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9177 7 385 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0051301
GO:0071555

Feature Viewer

pLDDT pTM Quality
73.07 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map