F466987

General Info

Members Datasets Scaffolds Average Seq Length
590 343 1180 295

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0001902|Ga0439465_0001902_21_1010
Length 329
Sequence MRPDRKITLSKLWLSRPAPTGYFDGRTEGRMTEDLIIQTIEPVTHDLGGFKVHRTLPSRPRTMVGPFIFFDQMGPAHLDVGTGIDVRPHPXINLATVTYLYAGAIDHRDSLGTFATIEPGAVNLMTAGNGIVHSERSPSAERARGPELSGIQTWLALPEADEEIDPAFEHVAAADLPVIEAGGATARVIMGSLWDAAAPTTTYAGTIYADIALAPGGSIPVDAEADERAVYVSMGEASLDGLRLEPMTLYVLRPGTAATLRSERGGRVMLCGGEAFKTPRHVWWNFVSSSRDRINQAKQDWQAGNFAKVPGDDKEWIPIPEVPKTVSYP

Samples

Sample ID Description Type Environment
1 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
198 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
203 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
272 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
273 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
277 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
278 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
279 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
280 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
281 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
282 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
283 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
284 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
285 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
288 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
289 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
290 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
291 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
297 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
307 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
308 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
311 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
312 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
313 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
316 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
317 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
318 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
322 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
323 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
324 2643221569 Achromobacter sp. Root565 Isolate Unclassified
325 2643221594 Achromobacter sp. Root170 Isolate Unclassified
326 2643221621 Achromobacter sp. Root83 Isolate Unclassified
327 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
328 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
329 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
330 2818991436 Collimonas arenae 515 Isolate Unclassified
331 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
332 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
333 2855730933 Achromobacter sp. HZ28 Isolate Nodule
334 2855767633 Achromobacter sp. HZ34 Isolate Nodule
335 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
336 2858950400 Achromobacter sp. K91 Isolate Unclassified
337 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
338 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
339 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
340 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
341 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
342 2941479691
343 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 0.68
Isolates 3.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.12
Nodule 0.51
Rhizoplane 2.54
Rhizosphere 70.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439465_0001902 3300041413 Bacteria 6836
2 MRS1b_contig_299100 2162886011 Bacteria 3052
3 JGI24741J21665_1001690 3300001915 Bacteria 6110
4 JGI24740J21852_10004410 3300001979 Bacteria 6048
5 JGI24739J22299_10011758 3300001989 Bacteria 3225
6 JGI24737J22298_10004273 3300001990 Bacteria 4989
7 JGI24737J22298_10028180 3300001990 Bacteria 1767
8 JGI25162J39368_1000036 3300002737 Bacteria 180433
9 JGI25150J39212_1000081 3300002774 Bacteria 58313
10 JGI25165J46597_1000022 3300003214 Bacteria 357959
11 JGI25165J46597_1000138 3300003214 Bacteria 121773
12 JGI25153J46596_10000080 3300003215 Bacteria 113263
13 JGI25153J46596_10000112 3300003215 Bacteria 92578
14 JGI25153J46596_10048176 3300003215 Bacteria 1247
15 Ga0055538_1000011 3300003751 Bacteria 357959
16 Ga0055539_1000016 3300003752 Bacteria 358248
17 Ga0055533_1000019 3300003756 Bacteria 357959
18 Ga0055525_1000042 3300003759 Bacteria 279804
19 Ga0055525_1000070 3300003759 Bacteria 183047
20 Ga0055542_1000402 3300003762 Bacteria 42527
21 Ga0055529_1000439 3300003763 Bacteria 41829
22 Ga0055526_1001589 3300003771 Bacteria 15946
23 Ga0055537_1001707 3300003773 Bacteria 8124
24 Ga0055524_1000226 3300003775 Bacteria 59950
25 Ga0055530_10000049 3300003791 Bacteria 107051
26 Ga0055530_10000073 3300003791 Bacteria 85352
27 Ga0055530_10026435 3300003791 Bacteria 1604
28 Ga0055540_1000940 3300003792 Bacteria 18931
29 Ga0055531_10000017 3300003794 Bacteria 177036
30 Ga0055531_10007290 3300003794 Bacteria 6066
31 Ga0055541_1000017 3300003841 Bacteria 286811
32 Ga0055543_1027234 3300004625 Bacteria 1013
33 Ga0065165_1003945 3300005262 Bacteria 9759
34 Ga0065165_1006038 3300005262 Bacteria 6510
35 Ga0065165_1012591 3300005262 Bacteria 3431
36 Ga0065165_1023529 3300005262 Bacteria 2087
37 Ga0065704_10095203 3300005289 Bacteria 2499
38 Ga0065712_10071677 3300005290 Bacteria 5119
39 Ga0065712_10154066 3300005290 Bacteria 1348
40 Ga0065715_10130889 3300005293 Bacteria 2018
41 Ga0070658_10000209 3300005327 Bacteria 51813
42 Ga0070658_10003103 3300005327 Bacteria 13704
43 Ga0070676_10125271 3300005328 Bacteria 1618
44 Ga0070683_100322930 3300005329 Bacteria 1469
45 Ga0070670_100001575 3300005331 Bacteria 18384
46 Ga0070677_10001952 3300005333 Bacteria 6539
47 Ga0070680_100029357 3300005336 Bacteria 4417
48 Ga0068868_100000020 3300005338 Bacteria 92590
49 Ga0070660_100000381 3300005339 Bacteria 29499
50 Ga0070660_100000567 3300005339 Bacteria 24778
51 Ga0070660_100002485 3300005339 Bacteria 12648
52 Ga0070660_100005129 3300005339 Bacteria 9051
53 Ga0070660_100058373 3300005339 Bacteria 2991
54 Ga0070660_100131205 3300005339 Bacteria 2005
55 Ga0070660_100141087 3300005339 Bacteria 1933
56 Ga0070661_100000764 3300005344 Bacteria 23216
57 Ga0070661_100018324 3300005344 Bacteria 4977
58 Ga0070692_10020062 3300005345 Bacteria 3235
59 Ga0070668_100246265 3300005347 Bacteria 1482
60 Ga0070669_100053605 3300005353 Bacteria 2952
61 Ga0070669_100089304 3300005353 Bacteria 2308
62 Ga0070675_100002279 3300005354 Bacteria 14247
63 Ga0070675_100006097 3300005354 Bacteria 9244
64 Ga0070675_100075309 3300005354 Bacteria 2805
65 Ga0070675_100082466 3300005354 Bacteria 2683
66 Ga0070671_100009594 3300005355 Bacteria 7777
67 Ga0070671_100010401 3300005355 Bacteria 7463
68 Ga0070671_100066255 3300005355 Bacteria 3009
69 Ga0070671_100078861 3300005355 Bacteria 2752
70 Ga0070674_100004595 3300005356 Bacteria 7891
71 Ga0070674_100035505 3300005356 Bacteria 3339
72 Ga0070673_100007210 3300005364 Bacteria 7310
73 Ga0070673_100264447 3300005364 Bacteria 1504
74 Ga0070659_100000017 3300005366 Bacteria 163966
75 Ga0070659_100119248 3300005366 Bacteria 2135
76 Ga0070659_100286137 3300005366 Bacteria 1372
77 Ga0070667_100009793 3300005367 Bacteria 7947
78 Ga0070667_100085908 3300005367 Bacteria 2699
79 Ga0070667_100157929 3300005367 Bacteria 1996
80 Ga0070667_100359883 3300005367 Bacteria 1319
81 Ga0070711_100033863 3300005439 Bacteria 3404
82 Ga0070663_100015279 3300005455 Bacteria 4951
83 Ga0070681_10033653 3300005458 Bacteria 5145
84 Ga0070681_10067145 3300005458 Bacteria 3555
85 Ga0070685_10096336 3300005466 Bacteria 1800
86 Ga0070679_100000001 3300005530 Bacteria 764811
87 Ga0070679_100003301 3300005530 Bacteria 14768
88 Ga0070672_100120811 3300005543 Bacteria 2144
89 Ga0070686_100000056 3300005544 Bacteria 87537
90 Ga0070696_100122140 3300005546 Bacteria 1886
91 Ga0070665_100000021 3300005548 Bacteria 389668
92 Ga0070665_100000497 3300005548 Bacteria 56270
93 Ga0070665_100101657 3300005548 Bacteria 2879
94 Ga0070665_100185476 3300005548 Bacteria 2081
95 Ga0068855_100035561 3300005563 Bacteria 5933
96 Ga0068855_100147957 3300005563 Bacteria 2672
97 Ga0070664_100004202 3300005564 Bacteria 11571
98 Ga0070664_100063823 3300005564 Bacteria 3140
99 Ga0070664_100240533 3300005564 Bacteria 1625
100 Ga0068857_100009009 3300005577 Bacteria 8652
101 Ga0068854_100034554 3300005578 Bacteria 3533
102 Ga0068854_100366004 3300005578 Bacteria 1184
103 Ga0068852_100533106 3300005616 Bacteria 1173
104 Ga0068859_100015698 3300005617 Bacteria 7610
105 Ga0068864_100000870 3300005618 Bacteria 25428
106 Ga0068864_100134875 3300005618 Bacteria 2222
107 Ga0068861_100000271 3300005719 Bacteria 28950
108 Ga0068851_10010027 3300005834 Bacteria 4412
109 Ga0068863_100000186 3300005841 Bacteria 65963
110 Ga0068863_100025592 3300005841 Bacteria 5627
111 Ga0068858_100000022 3300005842 Bacteria 169718
112 Ga0068858_100000318 3300005842 Bacteria 51170
113 Ga0081540_1053900 3300005983 Bacteria 1969
114 Ga0081539_10026431 3300005985 Bacteria 3704
115 Ga0075366_10038523 3300006195 Bacteria 2823
116 Ga0068871_100007771 3300006358 Bacteria 7678
117 Ga0068871_100275909 3300006358 Bacteria 1469
118 Ga0075430_100256079 3300006846 Bacteria 1450
119 Ga0068865_100005493 3300006881 Bacteria 7691
120 Ga0068865_100099200 3300006881 Bacteria 2129
121 Ga0097620_100015698 3300006931 Bacteria 7610
122 Ga0105240_10796791 3300009093 Bacteria 1024
123 Ga0105245_10001471 3300009098 Bacteria 21285
124 Ga0105245_10076742 3300009098 Bacteria 3045
125 Ga0105243_10001935 3300009148 Bacteria 17641
126 Ga0105243_10134584 3300009148 Bacteria 2101
127 Ga0105241_10010947 3300009174 Bacteria 6653
128 Ga0105248_10003753 3300009177 Bacteria 16834
129 Ga0105248_10052245 3300009177 Bacteria 4586
130 Ga0105248_10067604 3300009177 Bacteria 4012
131 Ga0105248_10143362 3300009177 Bacteria 2696
132 Ga0105237_10014154 3300009545 Bacteria 8350
133 Ga0105237_10184536 3300009545 Bacteria 2086
134 Ga0105238_10009972 3300009551 Bacteria 9525
135 Ga0105249_10011955 3300009553 Bacteria 7636
136 Ga0105239_10015330 3300010375 Bacteria 8492
137 Ga0157373_10138777 3300013100 Bacteria 1709
138 Ga0157371_10000066 3300013102 Bacteria 168406
139 Ga0157370_10042974 3300013104 Bacteria 4352
140 Ga0157369_10005411 3300013105 Bacteria 14863
141 Ga0157374_10224964 3300013296 Bacteria 1842
142 Ga0163162_10001728 3300013306 Bacteria 20466
143 Ga0157372_10613801 3300013307 Bacteria 1268
144 Ga0163163_10230617 3300014325 Bacteria 1901
145 Ga0157379_10122315 3300014968 Bacteria 2342
146 Ga0157379_10128443 3300014968 Bacteria 2281
147 Ga0182006_1040282 3300015261 Bacteria 1839
148 Ga0182007_10009847 3300015262 Bacteria 3814
149 Ga0182005_1000741 3300015265 Bacteria 14944
150 Ga0206353_10341789 3300020082 Bacteria 7854
151 Ga0213873_10000023 3300021358 Bacteria 102573
152 Ga0213876_10000091 3300021384 Bacteria 102527
153 Ga0209784_100019 3300025224 Bacteria 453558
154 Ga0209566_100017 3300025225 Bacteria 453558
155 Ga0209674_100031 3300025226 Bacteria 453558
156 Ga0209563_100035 3300025230 Bacteria 453558
157 Ga0209563_100053 3300025230 Bacteria 332370
158 Ga0207427_100315 3300025231 Bacteria 32969
159 Ga0209437_100038 3300025233 Bacteria 453558
160 Ga0207425_1000019 3300025245 Bacteria 399942
161 Ga0207425_1015084 3300025245 Bacteria 1741
162 Ga0209026_1009440 3300025250 Bacteria 1916
163 Ga0209677_100020 3300025253 Bacteria 453558
164 Ga0209148_1000008 3300025254 Bacteria 1504371
165 Ga0209129_1000951 3300025258 Bacteria 17420
166 Ga0209233_1000049 3300025261 Bacteria 453558
167 Ga0209233_1000182 3300025261 Bacteria 137671
168 Ga0209565_1000007 3300025263 Bacteria 784361
169 Ga0209565_1000089 3300025263 Bacteria 150511
170 Ga0209565_1008886 3300025263 Bacteria 2598
171 Ga0209455_1000002 3300025272 Bacteria 1505459
172 Ga0209455_1007590 3300025272 Bacteria 3041
173 Ga0209673_1001068 3300025273 Bacteria 31210
174 Ga0209675_1006849 3300025291 Bacteria 4493
175 Ga0209676_1008871 3300025292 Bacteria 4421
176 Ga0209676_1013921 3300025292 Bacteria 3061
177 Ga0209025_1000268 3300025294 Bacteria 121656
178 Ga0209564_1001376 3300025295 Bacteria 25390
179 Ga0209758_1000019 3300025297 Bacteria 743682
180 Ga0209758_1000023 3300025297 Bacteria 612453
181 Ga0209050_1000001 3300025298 Bacteria 3563507
182 Ga0209050_1000102 3300025298 Bacteria 229971
183 Ga0209050_1001812 3300025298 Bacteria 20909
184 Ga0209256_1000008 3300025299 Bacteria 975723
185 Ga0209051_1000304 3300025303 Bacteria 77336
186 Ga0209257_1000112 3300025304 Bacteria 234058
187 Ga0209257_1002047 3300025304 Bacteria 21436
188 Ga0209257_1020279 3300025304 Bacteria 2464
189 Ga0207697_10070312 3300025315 Bacteria 1466
190 Ga0207656_10002461 3300025321 Bacteria 6248
191 Ga0207682_10000829 3300025893 Bacteria 14296
192 Ga0207682_10003840 3300025893 Bacteria 6450
193 Ga0207688_10026501 3300025901 Bacteria 3187
194 Ga0207688_10175415 3300025901 Bacteria 1276
195 Ga0207680_10122525 3300025903 Bacteria 1702
196 Ga0207647_10019765 3300025904 Bacteria 4525
197 Ga0207647_10199358 3300025904 Bacteria 1158
198 Ga0207645_10099315 3300025907 Bacteria 1877
199 Ga0207705_10000005 3300025909 Bacteria 673478
200 Ga0207705_10000618 3300025909 Bacteria 29682
201 Ga0207705_10025963 3300025909 Bacteria 4180
202 Ga0207705_10038288 3300025909 Bacteria 3433
203 Ga0207654_10008597 3300025911 Bacteria 5171
204 Ga0207707_10051512 3300025912 Bacteria 3585
205 Ga0207695_10013348 3300025913 Bacteria 9804
206 Ga0207671_10006249 3300025914 Bacteria 10674
207 Ga0207663_10021822 3300025916 Bacteria 3651
208 Ga0207660_10004252 3300025917 Bacteria 9334
209 Ga0207660_10042947 3300025917 Bacteria 3175
210 Ga0207657_10000800 3300025919 Bacteria 33315
211 Ga0207657_10001546 3300025919 Bacteria 24651
212 Ga0207657_10002530 3300025919 Bacteria 19780
213 Ga0207657_10010024 3300025919 Bacteria 9479
214 Ga0207657_10011474 3300025919 Bacteria 8796
215 Ga0207657_10062430 3300025919 Bacteria 3190
216 Ga0207649_10000027 3300025920 Bacteria 161926
217 Ga0207649_10000471 3300025920 Bacteria 28765
218 Ga0207652_10000003 3300025921 Bacteria 502441
219 Ga0207652_10424916 3300025921 Bacteria 1198
220 Ga0207681_10006740 3300025923 Bacteria 7048
221 Ga0207681_10043833 3300025923 Bacteria 2996
222 Ga0207694_10011586 3300025924 Bacteria 6653
223 Ga0207694_10355888 3300025924 Bacteria 1212
224 Ga0207650_10037118 3300025925 Bacteria 3549
225 Ga0207659_10002718 3300025926 Bacteria 10545
226 Ga0207659_10086574 3300025926 Bacteria 2330
227 Ga0207687_10034874 3300025927 Bacteria 3420
228 Ga0207644_10000032 3300025931 Bacteria 133759
229 Ga0207644_10014887 3300025931 Bacteria 5214
230 Ga0207644_10023982 3300025931 Bacteria 4184
231 Ga0207644_10146352 3300025931 Bacteria 1824
232 Ga0207690_10000035 3300025932 Bacteria 149201
233 Ga0207690_10000868 3300025932 Bacteria 19312
234 Ga0207690_10035119 3300025932 Bacteria 3235
235 Ga0207690_10110891 3300025932 Bacteria 1976
236 Ga0207706_10007371 3300025933 Bacteria 10166
237 Ga0207706_10033408 3300025933 Bacteria 4580
238 Ga0207706_10072327 3300025933 Bacteria 3033
239 Ga0207709_10000047 3300025935 Bacteria 238649
240 Ga0207709_10140645 3300025935 Bacteria 1658
241 Ga0207669_10000038 3300025937 Bacteria 74003
242 Ga0207669_10062519 3300025937 Bacteria 2293
243 Ga0207704_10070010 3300025938 Bacteria 2219
244 Ga0207691_10006900 3300025940 Bacteria 10952
245 Ga0207691_10182738 3300025940 Bacteria 1832
246 Ga0207711_10007985 3300025941 Bacteria 8853
247 Ga0207711_10029889 3300025941 Bacteria 4596
248 Ga0207679_10023810 3300025945 Bacteria 4192
249 Ga0207679_10203901 3300025945 Bacteria 1654
250 Ga0207667_10000001 3300025949 Bacteria 1178522
251 Ga0207651_10021974 3300025960 Bacteria 3890
252 Ga0207651_10461627 3300025960 Bacteria 1091
253 Ga0207712_10024593 3300025961 Bacteria 3991
254 Ga0207668_10000034 3300025972 Bacteria 119274
255 Ga0207668_10152673 3300025972 Bacteria 1790
256 Ga0207640_10015362 3300025981 Bacteria 4430
257 Ga0207640_10025108 3300025981 Bacteria 3603
258 Ga0207640_10484559 3300025981 Bacteria 1027
259 Ga0207677_10000071 3300026023 Bacteria 84386
260 Ga0207677_10510683 3300026023 Bacteria 1041
261 Ga0207703_10000048 3300026035 Bacteria 151143
262 Ga0207639_10025577 3300026041 Bacteria 4280
263 Ga0207639_10101014 3300026041 Bacteria 2331
264 Ga0207678_10009241 3300026067 Bacteria 8675
265 Ga0207678_10103986 3300026067 Bacteria 2423
266 Ga0207702_10004316 3300026078 Bacteria 12679
267 Ga0207641_10000031 3300026088 Bacteria 224320
268 Ga0207641_10004526 3300026088 Bacteria 12021
269 Ga0207648_10067850 3300026089 Bacteria 3109
270 Ga0207676_10000270 3300026095 Bacteria 44974
271 Ga0207676_10081571 3300026095 Bacteria 2628
272 Ga0207676_10149427 3300026095 Bacteria 2010
273 Ga0207676_10305615 3300026095 Bacteria 1454
274 Ga0207674_10053276 3300026116 Bacteria 4124
275 Ga0207674_10054927 3300026116 Bacteria 4052
276 Ga0207674_10109871 3300026116 Bacteria 2733
277 Ga0207675_100000038 3300026118 Bacteria 93037
278 Ga0207683_10000100 3300026121 Bacteria 71364
279 Ga0207698_10097414 3300026142 Bacteria 2427
280 Ga0207698_10616177 3300026142 Bacteria 1072
281 Ga0209281_1011408 3300027111 Bacteria 1992
282 Ga0209974_10010519 3300027876 Bacteria 3122
283 Ga0268266_10000015 3300028379 Bacteria 630629
284 Ga0268266_10000294 3300028379 Bacteria 81573
285 Ga0268266_10007596 3300028379 Bacteria 9763
286 Ga0268266_10013743 3300028379 Bacteria 6972
287 Ga0268264_10020145 3300028381 Bacteria 5450
288 Ga0307517_10009422 3300028786 Bacteria 13832
289 Ga0307517_10138967 3300028786 Bacteria 1714
290 Ga0307513_10057007 3300031456 Bacteria 4166
291 Ga0307513_10106571 3300031456 Bacteria 2808
292 Ga0307509_10379440 3300031507 Bacteria 1127
293 Ga0307408_100114422 3300031548 Bacteria 2078
294 Ga0307408_100192243 3300031548 Bacteria 1645
295 Ga0307408_100200798 3300031548 Bacteria 1614
296 Ga0307408_100214980 3300031548 Bacteria 1565
297 Ga0307508_10000550 3300031616 Bacteria 44447
298 Ga0307405_10016845 3300031731 Bacteria 3995
299 Ga0307405_10183562 3300031731 Bacteria 1504
300 Ga0307405_10233130 3300031731 Bacteria 1358
301 Ga0307413_10028544 3300031824 Bacteria 3109
302 Ga0307413_10119061 3300031824 Bacteria 1784
303 Ga0307413_10238472 3300031824 Bacteria 1341
304 Ga0307413_10244290 3300031824 Bacteria 1327
305 Ga0307413_10245410 3300031824 Bacteria 1325
306 Ga0307410_10000178 3300031852 Bacteria 23344
307 Ga0307410_10013007 3300031852 Bacteria 4837
308 Ga0307410_10013226 3300031852 Bacteria 4805
309 Ga0307410_10117314 3300031852 Bacteria 1935
310 Ga0307410_10155448 3300031852 Bacteria 1708
311 Ga0307410_10228140 3300031852 Bacteria 1436
312 Ga0307410_10230356 3300031852 Bacteria 1430
313 Ga0307410_10315201 3300031852 Bacteria 1239
314 Ga0307406_10091615 3300031901 Bacteria 2048
315 Ga0307406_10395872 3300031901 Bacteria 1093
316 Ga0307407_10007202 3300031903 Bacteria 5021
317 Ga0307407_10010715 3300031903 Bacteria 4333
318 Ga0307407_10018363 3300031903 Bacteria 3536
319 Ga0307407_10041543 3300031903 Bacteria 2572
320 Ga0307412_10000748 3300031911 Bacteria 18824
321 Ga0307412_10001148 3300031911 Bacteria 15196
322 Ga0307412_10008404 3300031911 Bacteria 5890
323 Ga0307412_10061202 3300031911 Bacteria 2530
324 Ga0307412_10072047 3300031911 Bacteria 2360
325 Ga0307409_100000947 3300031995 Bacteria 13532
326 Ga0307409_100002166 3300031995 Bacteria 10126
327 Ga0307409_100022765 3300031995 Bacteria 4325
328 Ga0307409_100027349 3300031995 Bacteria 4040
329 Ga0307409_100106575 3300031995 Bacteria 2339
330 Ga0307409_100185748 3300031995 Bacteria 1845
331 Ga0307409_100428986 3300031995 Bacteria 1270
332 Ga0307409_100437037 3300031995 Bacteria 1259
333 Ga0307409_100563254 3300031995 Bacteria 1120
334 Ga0307416_100008752 3300032002 Bacteria 6559
335 Ga0307416_100017891 3300032002 Bacteria 4976
336 Ga0307416_100024444 3300032002 Bacteria 4410
337 Ga0307416_100039405 3300032002 Bacteria 3658
338 Ga0307416_100053637 3300032002 Bacteria 3236
339 Ga0307416_100130377 3300032002 Bacteria 2262
340 Ga0307416_100242577 3300032002 Bacteria 1747
341 Ga0307416_100276642 3300032002 Bacteria 1652
342 Ga0307416_100765232 3300032002 Bacteria 1059
343 Ga0307414_10032682 3300032004 Bacteria 3429
344 Ga0307414_10152630 3300032004 Bacteria 1824
345 Ga0307414_10254903 3300032004 Bacteria 1460
346 Ga0307414_10284496 3300032004 Bacteria 1391
347 Ga0307414_10468601 3300032004 Bacteria 1108
348 Ga0307411_10001198 3300032005 Bacteria 10265
349 Ga0307411_10019714 3300032005 Bacteria 3903
350 Ga0307411_10032907 3300032005 Bacteria 3209
351 Ga0307411_10044462 3300032005 Bacteria 2849
352 Ga0307411_10051868 3300032005 Bacteria 2679
353 Ga0307411_10125970 3300032005 Bacteria 1863
354 Ga0307411_10127002 3300032005 Bacteria 1856
355 Ga0307411_10251359 3300032005 Bacteria 1390
356 Ga0307415_100010658 3300032126 Bacteria 5216
357 Ga0307415_100127655 3300032126 Bacteria 1919
358 Ga0307415_100248318 3300032126 Bacteria 1444
359 Ga0307510_10002463 3300033180 Bacteria 21035
360 Ga0395900_0074842 3300037418 Bacteria 3481
361 Ga0395898_0227941 3300037466 Bacteria 1777
362 Ga0395901_0078048 3300038443 Bacteria 3457
363 Ga0395901_0140808 3300038443 Bacteria 2535
364 Ga0395901_0223175 3300038443 Bacteria 1969
365 Ga0237819_01122 3300038705 Bacteria 7796
366 Ga0436365_0598248 3300039437 Bacteria 40283
367 Ga0436365_1020809 3300039437 Bacteria 10139
368 Ga0436365_1404021 3300039437 Bacteria 6837
369 Ga0436362_0265247 3300039453 Bacteria 102026
370 Ga0439461_0000038 3300041410 Bacteria 16271
371 Ga0439466_0047431 3300041411 Bacteria 1416
372 Ga0439465_0020138 3300041413 Bacteria 2087
373 Ga0451807_0677377 3300041486 Bacteria 2187
374 Ga0451853_0802417 3300041512 Bacteria 1910
375 Ga0439431_0000211 3300041997 Bacteria 11608
376 Ga0439431_0048756 3300041997 Bacteria 1094
377 Ga0439442_000860 3300042002 Bacteria 6251
378 Ga0439445_0000068 3300042004 Bacteria 15640
379 Ga0439445_0002914 3300042004 Bacteria 3821
380 Ga0439432_000877 3300042006 Bacteria 11269
381 Ga0439432_051651 3300042006 Bacteria 1281
382 Ga0450920_013992 3300042122 Bacteria 1514
383 Ga0439434_0002135 3300042435 Bacteria 5723
384 Ga0466957_0416805 3300044842 Bacteria 921
385 Ga0495617_049090 3300046452 Bacteria 1405
386 Ga0495627_012247 3300046453 Bacteria 3051
387 Ga0495592_0001831 3300046454 Bacteria 14948
388 Ga0495638_0000012 3300046460 Bacteria 435577
389 Ga0495638_0002975 3300046460 Bacteria 13525
390 Ga0495651_0004314 3300046462 Bacteria 10896
391 Ga0495651_0049989 3300046462 Bacteria 3226
392 Ga0495653_0002503 3300046463 Bacteria 14634
393 Ga0495650_0000290 3300046471 Bacteria 93004
394 Ga0495585_0002773 3300046492 Bacteria 12212
395 Ga0495585_0020405 3300046492 Bacteria 3812
396 Ga0495585_0126023 3300046492 Bacteria 1351
397 Ga0495607_0016870 3300046501 Bacteria 4702
398 Ga0495583_0000411 3300046506 Bacteria 65040
399 Ga0495583_0001065 3300046506 Bacteria 30658
400 Ga0495583_0003000 3300046506 Bacteria 13518
401 Ga0495583_0013953 3300046506 Bacteria 4452
402 Ga0495606_0000383 3300046507 Bacteria 75070
403 Ga0495608_0001267 3300046511 Bacteria 17938
404 Ga0495618_0052065 3300046514 Bacteria 2587
405 Ga0495628_0001337 3300046516 Bacteria 22626
406 Ga0495631_0029181 3300046518 Bacteria 2512
407 Ga0495631_0031426 3300046518 Bacteria 2402
408 Ga0495632_0000832 3300046519 Bacteria 27194
409 Ga0495643_0000556 3300046522 Bacteria 46207
410 Ga0495643_0006292 3300046522 Bacteria 7853
411 Ga0495643_0031650 3300046522 Bacteria 2943
412 Ga0495643_0050076 3300046522 Bacteria 2250
413 Ga0495644_0044850 3300046523 Bacteria 1663
414 Ga0495648_0000038 3300046524 Bacteria 191612
415 Ga0495648_0000901 3300046524 Bacteria 31037
416 Ga0495648_0013015 3300046524 Bacteria 6174
417 Ga0495652_0031929 3300046529 Bacteria 4609
418 Ga0495652_0112562 3300046529 Bacteria 2186
419 Ga0495652_0147328 3300046529 Bacteria 1843
420 Ga0495654_0078414 3300046530 Bacteria 1553
421 Ga0495598_0001525 3300046537 Bacteria 4625
422 Ga0495621_0002891 3300046539 Bacteria 4678
423 Ga0495597_0026834 3300046542 Bacteria 2645
424 Ga0495645_0288700 3300046543 Bacteria 1076
425 Ga0495622_0005748 3300046557 Bacteria 5751
426 Ga0495622_0129464 3300046557 Bacteria 1150
427 Ga0495633_0002232 3300046558 Bacteria 13853
428 Ga0495633_0013935 3300046558 Bacteria 4215
429 Ga0495633_0015028 3300046558 Bacteria 4024
430 Ga0495633_0016871 3300046558 Bacteria 3749
431 Ga0495668_0000218 3300046616 Bacteria 83540
432 Ga0495611_0005427 3300046648 Bacteria 5451
433 Ga0495611_0035355 3300046648 Bacteria 2213
434 Ga0495625_0000496 3300046660 Bacteria 58853
435 Ga0495625_0001098 3300046660 Bacteria 35115
436 Ga0495625_0028736 3300046660 Bacteria 4166
437 Ga0495625_0040485 3300046660 Bacteria 3398
438 Ga0495625_0061599 3300046660 Bacteria 2655
439 Ga0495661_0116386 3300046665 Bacteria 1483
440 Ga0495599_0002386 3300046678 Bacteria 10924
441 Ga0495646_0004343 3300046680 Bacteria 8932
442 Ga0495646_0010710 3300046680 Bacteria 5826
443 Ga0495669_0000241 3300046684 Bacteria 32038
444 Ga0495669_0002156 3300046684 Bacteria 8083
445 Ga0495669_0011004 3300046684 Bacteria 3831
446 Ga0495669_0015695 3300046684 Bacteria 3243
447 Ga0495670_0000104 3300046691 Bacteria 37290
448 Ga0495670_0027119 3300046691 Bacteria 2836
449 Ga0495670_0054457 3300046691 Bacteria 2004
450 Ga0495670_0056147 3300046691 Bacteria 1975
451 Ga0495671_0000034 3300046692 Bacteria 195385
452 Ga0495649_0035817 3300046694 Bacteria 2729
453 Ga0495600_0015093 3300046809 Bacteria 4879
454 Ga0495683_0002703 3300047323 Bacteria 10584
455 Ga0495687_000082 3300047443 Bacteria 147137
456 Ga0495687_000472 3300047443 Bacteria 48797
457 Ga0495673_0000013 3300047469 Bacteria 612902
458 Ga0495673_0050588 3300047469 Bacteria 1823
459 Ga0495681_0002528 3300047470 Bacteria 13027
460 Ga0495681_0039186 3300047470 Bacteria 2316
461 Ga0495686_0000602 3300047472 Bacteria 50008
462 Ga0495686_0099947 3300047472 Bacteria 1750
463 Ga0495602_0063131 3300048088 Bacteria 3210
464 Ga0496102_0000930 3300048905 Bacteria 27582
465 Ga0496103_0001181 3300048906 Bacteria 17921
466 Ga0496104_0003538 3300048907 Bacteria 13471
467 Ga0496105_0001238 3300048908 Bacteria 17814
468 Ga0496110_0005603 3300048913 Bacteria 9856
469 Ga0496110_0016383 3300048913 Bacteria 6189
470 Ga0496111_0001589 3300048914 Bacteria 13126
471 Ga0496111_0025686 3300048914 Bacteria 4156
472 Ga0496113_0552921 3300048916 Bacteria 923
473 Ga0496115_0000339 3300048918 Bacteria 39809
474 Ga0496115_0009842 3300048918 Bacteria 7117
475 Ga0496116_0006574 3300048919 Bacteria 10525
476 Ga0496116_0015362 3300048919 Bacteria 6054
477 Ga0496116_0158836 3300048919 Bacteria 1243
478 Ga0496117_0003623 3300048920 Bacteria 17798
479 Ga0496118_0002640 3300048921 Bacteria 23762
480 Ga0496118_0049413 3300048921 Bacteria 3239
481 Ga0496118_0071311 3300048921 Bacteria 2502
482 Ga0496119_0116690 3300048922 Bacteria 1473
483 Ga0496120_0014422 3300048923 Bacteria 5267
484 Ga0496120_0018434 3300048923 Bacteria 4500
485 Ga0496121_0000128 3300048924 Bacteria 168457
486 Ga0496121_0000200 3300048924 Bacteria 131314
487 Ga0496121_0004809 3300048924 Bacteria 17800
488 Ga0496122_0000021 3300048925 Bacteria 391363
489 Ga0496122_0182792 3300048925 Bacteria 1248
490 Ga0496123_0000382 3300048926 Bacteria 83286
491 Ga0496123_0008086 3300048926 Bacteria 9727
492 Ga0496123_0008374 3300048926 Bacteria 9506
493 Ga0496123_0057905 3300048926 Bacteria 2518
494 Ga0496123_0086142 3300048926 Bacteria 1886
495 Ga0496124_0000761 3300048927 Bacteria 52586
496 Ga0496124_0001474 3300048927 Bacteria 34588
497 Ga0496124_0003074 3300048927 Bacteria 20784
498 Ga0496124_0040880 3300048927 Bacteria 4006
499 Ga0496124_0082792 3300048927 Bacteria 2633
500 Ga0496125_0000005 3300048928 Bacteria 827598
501 Ga0496125_0004606 3300048928 Bacteria 15755
502 Ga0496125_0015489 3300048928 Bacteria 7369
503 Ga0496126_0000467 3300048929 Bacteria 80295
504 Ga0501290_000033 3300049513 Bacteria 18347
505 Ga0501292_000026 3300049515 Bacteria 42153
506 Ga0501294_001219 3300049517 Bacteria 2658
507 Ga0501034_0143067 3300049571 Bacteria 2370
508 Ga0501038_0050628 3300049574 Bacteria 3588
509 Ga0501206_002038 3300049653 Bacteria 2549
510 Ga0501222_000164 3300049662 Bacteria 13081
511 Ga0501223_000934 3300049663 Bacteria 6908
512 Ga0501227_021106 3300049665 Bacteria 1499
513 Ga0501227_059446 3300049665 Bacteria 977
514 Ga0501233_024172 3300049668 Bacteria 1327
515 Ga0501257_000093 3300049686 Bacteria 21754
516 Ga0501257_022339 3300049686 Bacteria 1497
517 Ga0501261_000055 3300049690 Bacteria 21300
518 Ga0501221_004751 3300049704 Bacteria 2255
519 Ga0501225_0001875 3300049705 Bacteria 6601
520 Ga0501245_000201 3300049708 Bacteria 6667
521 Ga0501080_0108079 3300049742 Bacteria 2578
522 Ga0501279_000066 3300049775 Bacteria 18226
523 Ga0501280_000428 3300049776 Bacteria 10089
524 Ga0501281_00046 3300049777 Bacteria 14598
525 Ga0501282_001783 3300049778 Bacteria 2367
526 Ga0501283_004254 3300049779 Bacteria 1928
527 Ga0501044_0540519 3300049823 Bacteria 1063
528 nmdc:mga0k408_46010_c1 3300050493 Bacteria 2519
529 nmdc:mga07m45_247207_c1 3300050496 Bacteria 1038
530 nmdc:mga0qj67_77037_c1 3300050509 Bacteria 2668
531 Ga0500610_0001098 3300053079 Bacteria 8897
532 Ga0500643_000292 3300053087 Bacteria 43095
533 Ga0500643_001429 3300053087 Bacteria 13765
534 Ga0500643_009896 3300053087 Bacteria 3600
535 Ga0500643_014938 3300053087 Bacteria 2678
536 Ga0500646_0041121 3300053090 Bacteria 1302
537 Ga0500566_0003208 3300053094 Bacteria 9779
538 Ga0500556_0033203 3300053104 Bacteria 1769
539 Ga0500595_001136 3300053119 Bacteria 14745
540 Ga0500595_002209 3300053119 Bacteria 9883
541 Ga0500607_000007 3300053121 Bacteria 134097
542 Ga0500658_0002518 3300053134 Bacteria 7098
543 Ga0500658_0006669 3300053134 Bacteria 4278
544 Ga0500658_0010916 3300053134 Bacteria 3351
545 Ga0500559_0000693 3300053136 Bacteria 22159
546 Ga0500559_0001181 3300053136 Bacteria 15619
547 Ga0500559_0004787 3300053136 Bacteria 6339
548 Ga0500559_0134924 3300053136 Bacteria 1154
549 Ga0500568_0002185 3300053139 Bacteria 11770
550 Ga0500573_0000030 3300053140 Bacteria 135037
551 Ga0500590_130387 3300053148 Bacteria 1164
552 Ga0500604_0000001 3300053151 Bacteria 174619
553 Ga0500604_0031722 3300053151 Bacteria 1553
554 Ga0500616_0000070 3300053153 Bacteria 232610
555 Ga0500616_0008535 3300053153 Bacteria 6352
556 Ga0500619_022571 3300053154 Bacteria 1828
557 Ga0500622_0000145 3300053156 Bacteria 75417
558 Ga0500636_0002811 3300053177 Bacteria 9719
559 Ga0500637_0005234 3300053178 Bacteria 6263
560 Ga0500645_000237 3300053730 Bacteria 41544
561 Ga0500645_002010 3300053730 Bacteria 9526
562 Ga0500596_000903 3300053735 Bacteria 5929
563 Ga0500587_001316 3300053739 Bacteria 3486
564 Ga0500661_008186 3300055283 Bacteria 1923
565 Ga0587090_004550 3300059510 Bacteria 1688
566 Ga0587094_004794 3300059513 Bacteria 1554
567 Ga0587071_012130 3300060344 Bacteria 1466
568 2599902264 2599185292 Bacteria 6290804
569 2600202790 2599185354 Bacteria 4398675
570 2600228266 2599185359 Bacteria 4772316
571 2643859654 2643221569 Bacteria 6064337
572 2643978953 2643221594 Bacteria 5811388
573 2644120398 2643221621 Bacteria 6212786
574 2644125699 2643221622 Bacteria 4212502
575 2753767137 2751185897 Bacteria 5322941
576 2809036290 2808606395 Bacteria 6020352
577 2819542504 2818991436 Bacteria 5376622
578 2819716312 2818991466 Bacteria 4748179
579 2830079118 2830075706 Bacteria 3855215
580 2855731537 2855730933 Bacteria 7047938
581 2855768243 2855767633 Bacteria 7049357
582 2857541367 2857537821 Bacteria 5248181
583 2858951683 2858950400 Bacteria 6783797
584 2879165358 2879163058 Bacteria 4223965
585 2881413587 2881412998 Bacteria 6492157
586 2885430999 2885429604 Bacteria 3642894
587 2928528885 2928526807 Bacteria 4760224
588 2928970436 2928968154 Bacteria 4633371
589 2941483168
590 2946789968 2946787523 Bacteria 4366789
591 Ga0439465_0001902
592 MRS1b_contig_299100
593 JGI24741J21665_1001690
594 JGI24740J21852_10004410
595 JGI24739J22299_10011758
596 JGI24737J22298_10004273
597 JGI24737J22298_10028180
598 JGI25162J39368_1000036
599 JGI25150J39212_1000081
600 JGI25165J46597_1000022
601 JGI25165J46597_1000138
602 JGI25153J46596_10000080
603 JGI25153J46596_10000112
604 JGI25153J46596_10048176
605 Ga0055538_1000011
606 Ga0055539_1000016
607 Ga0055533_1000019
608 Ga0055525_1000042
609 Ga0055525_1000070
610 Ga0055542_1000402
611 Ga0055529_1000439
612 Ga0055526_1001589
613 Ga0055537_1001707
614 Ga0055524_1000226
615 Ga0055530_10000049
616 Ga0055530_10000073
617 Ga0055530_10026435
618 Ga0055540_1000940
619 Ga0055531_10000017
620 Ga0055531_10007290
621 Ga0055541_1000017
622 Ga0055543_1027234
623 Ga0065165_1003945
624 Ga0065165_1006038
625 Ga0065165_1012591
626 Ga0065165_1023529
627 Ga0065704_10095203
628 Ga0065712_10071677
629 Ga0065712_10154066
630 Ga0065715_10130889
631 Ga0070658_10000209
632 Ga0070658_10003103
633 Ga0070676_10125271
634 Ga0070683_100322930
635 Ga0070670_100001575
636 Ga0070677_10001952
637 Ga0070680_100029357
638 Ga0068868_100000020
639 Ga0070660_100000381
640 Ga0070660_100000567
641 Ga0070660_100002485
642 Ga0070660_100005129
643 Ga0070660_100058373
644 Ga0070660_100131205
645 Ga0070660_100141087
646 Ga0070661_100000764
647 Ga0070661_100018324
648 Ga0070692_10020062
649 Ga0070668_100246265
650 Ga0070669_100053605
651 Ga0070669_100089304
652 Ga0070675_100002279
653 Ga0070675_100006097
654 Ga0070675_100075309
655 Ga0070675_100082466
656 Ga0070671_100009594
657 Ga0070671_100010401
658 Ga0070671_100066255
659 Ga0070671_100078861
660 Ga0070674_100004595
661 Ga0070674_100035505
662 Ga0070673_100007210
663 Ga0070673_100264447
664 Ga0070659_100000017
665 Ga0070659_100119248
666 Ga0070659_100286137
667 Ga0070667_100009793
668 Ga0070667_100085908
669 Ga0070667_100157929
670 Ga0070667_100359883
671 Ga0070711_100033863
672 Ga0070663_100015279
673 Ga0070681_10033653
674 Ga0070681_10067145
675 Ga0070685_10096336
676 Ga0070679_100000001
677 Ga0070679_100003301
678 Ga0070672_100120811
679 Ga0070686_100000056
680 Ga0070696_100122140
681 Ga0070665_100000021
682 Ga0070665_100000497
683 Ga0070665_100101657
684 Ga0070665_100185476
685 Ga0068855_100035561
686 Ga0068855_100147957
687 Ga0070664_100004202
688 Ga0070664_100063823
689 Ga0070664_100240533
690 Ga0068857_100009009
691 Ga0068854_100034554
692 Ga0068854_100366004
693 Ga0068852_100533106
694 Ga0068859_100015698
695 Ga0068864_100000870
696 Ga0068864_100134875
697 Ga0068861_100000271
698 Ga0068851_10010027
699 Ga0068863_100000186
700 Ga0068863_100025592
701 Ga0068858_100000022
702 Ga0068858_100000318
703 Ga0081540_1053900
704 Ga0081539_10026431
705 Ga0075366_10038523
706 Ga0068871_100007771
707 Ga0068871_100275909
708 Ga0075430_100256079
709 Ga0068865_100005493
710 Ga0068865_100099200
711 Ga0097620_100015698
712 Ga0105240_10796791
713 Ga0105245_10001471
714 Ga0105245_10076742
715 Ga0105243_10001935
716 Ga0105243_10134584
717 Ga0105241_10010947
718 Ga0105248_10003753
719 Ga0105248_10052245
720 Ga0105248_10067604
721 Ga0105248_10143362
722 Ga0105237_10014154
723 Ga0105237_10184536
724 Ga0105238_10009972
725 Ga0105249_10011955
726 Ga0105239_10015330
727 Ga0157373_10138777
728 Ga0157371_10000066
729 Ga0157370_10042974
730 Ga0157369_10005411
731 Ga0157374_10224964
732 Ga0163162_10001728
733 Ga0157372_10613801
734 Ga0163163_10230617
735 Ga0157379_10122315
736 Ga0157379_10128443
737 Ga0182006_1040282
738 Ga0182007_10009847
739 Ga0182005_1000741
740 Ga0206353_10341789
741 Ga0213873_10000023
742 Ga0213876_10000091
743 Ga0209784_100019
744 Ga0209566_100017
745 Ga0209674_100031
746 Ga0209563_100035
747 Ga0209563_100053
748 Ga0207427_100315
749 Ga0209437_100038
750 Ga0207425_1000019
751 Ga0207425_1015084
752 Ga0209026_1009440
753 Ga0209677_100020
754 Ga0209148_1000008
755 Ga0209129_1000951
756 Ga0209233_1000049
757 Ga0209233_1000182
758 Ga0209565_1000007
759 Ga0209565_1000089
760 Ga0209565_1008886
761 Ga0209455_1000002
762 Ga0209455_1007590
763 Ga0209673_1001068
764 Ga0209675_1006849
765 Ga0209676_1008871
766 Ga0209676_1013921
767 Ga0209025_1000268
768 Ga0209564_1001376
769 Ga0209758_1000019
770 Ga0209758_1000023
771 Ga0209050_1000001
772 Ga0209050_1000102
773 Ga0209050_1001812
774 Ga0209256_1000008
775 Ga0209051_1000304
776 Ga0209257_1000112
777 Ga0209257_1002047
778 Ga0209257_1020279
779 Ga0207697_10070312
780 Ga0207656_10002461
781 Ga0207682_10000829
782 Ga0207682_10003840
783 Ga0207688_10026501
784 Ga0207688_10175415
785 Ga0207680_10122525
786 Ga0207647_10019765
787 Ga0207647_10199358
788 Ga0207645_10099315
789 Ga0207705_10000005
790 Ga0207705_10000618
791 Ga0207705_10025963
792 Ga0207705_10038288
793 Ga0207654_10008597
794 Ga0207707_10051512
795 Ga0207695_10013348
796 Ga0207671_10006249
797 Ga0207663_10021822
798 Ga0207660_10004252
799 Ga0207660_10042947
800 Ga0207657_10000800
801 Ga0207657_10001546
802 Ga0207657_10002530
803 Ga0207657_10010024
804 Ga0207657_10011474
805 Ga0207657_10062430
806 Ga0207649_10000027
807 Ga0207649_10000471
808 Ga0207652_10000003
809 Ga0207652_10424916
810 Ga0207681_10006740
811 Ga0207681_10043833
812 Ga0207694_10011586
813 Ga0207694_10355888
814 Ga0207650_10037118
815 Ga0207659_10002718
816 Ga0207659_10086574
817 Ga0207687_10034874
818 Ga0207644_10000032
819 Ga0207644_10014887
820 Ga0207644_10023982
821 Ga0207644_10146352
822 Ga0207690_10000035
823 Ga0207690_10000868
824 Ga0207690_10035119
825 Ga0207690_10110891
826 Ga0207706_10007371
827 Ga0207706_10033408
828 Ga0207706_10072327
829 Ga0207709_10000047
830 Ga0207709_10140645
831 Ga0207669_10000038
832 Ga0207669_10062519
833 Ga0207704_10070010
834 Ga0207691_10006900
835 Ga0207691_10182738
836 Ga0207711_10007985
837 Ga0207711_10029889
838 Ga0207679_10023810
839 Ga0207679_10203901
840 Ga0207667_10000001
841 Ga0207651_10021974
842 Ga0207651_10461627
843 Ga0207712_10024593
844 Ga0207668_10000034
845 Ga0207668_10152673
846 Ga0207640_10015362
847 Ga0207640_10025108
848 Ga0207640_10484559
849 Ga0207677_10000071
850 Ga0207677_10510683
851 Ga0207703_10000048
852 Ga0207639_10025577
853 Ga0207639_10101014
854 Ga0207678_10009241
855 Ga0207678_10103986
856 Ga0207702_10004316
857 Ga0207641_10000031
858 Ga0207641_10004526
859 Ga0207648_10067850
860 Ga0207676_10000270
861 Ga0207676_10081571
862 Ga0207676_10149427
863 Ga0207676_10305615
864 Ga0207674_10053276
865 Ga0207674_10054927
866 Ga0207674_10109871
867 Ga0207675_100000038
868 Ga0207683_10000100
869 Ga0207698_10097414
870 Ga0207698_10616177
871 Ga0209281_1011408
872 Ga0209974_10010519
873 Ga0268266_10000015
874 Ga0268266_10000294
875 Ga0268266_10007596
876 Ga0268266_10013743
877 Ga0268264_10020145
878 Ga0307517_10009422
879 Ga0307517_10138967
880 Ga0307513_10057007
881 Ga0307513_10106571
882 Ga0307509_10379440
883 Ga0307408_100114422
884 Ga0307408_100192243
885 Ga0307408_100200798
886 Ga0307408_100214980
887 Ga0307508_10000550
888 Ga0307405_10016845
889 Ga0307405_10183562
890 Ga0307405_10233130
891 Ga0307413_10028544
892 Ga0307413_10119061
893 Ga0307413_10238472
894 Ga0307413_10244290
895 Ga0307413_10245410
896 Ga0307410_10000178
897 Ga0307410_10013007
898 Ga0307410_10013226
899 Ga0307410_10117314
900 Ga0307410_10155448
901 Ga0307410_10228140
902 Ga0307410_10230356
903 Ga0307410_10315201
904 Ga0307406_10091615
905 Ga0307406_10395872
906 Ga0307407_10007202
907 Ga0307407_10010715
908 Ga0307407_10018363
909 Ga0307407_10041543
910 Ga0307412_10000748
911 Ga0307412_10001148
912 Ga0307412_10008404
913 Ga0307412_10061202
914 Ga0307412_10072047
915 Ga0307409_100000947
916 Ga0307409_100002166
917 Ga0307409_100022765
918 Ga0307409_100027349
919 Ga0307409_100106575
920 Ga0307409_100185748
921 Ga0307409_100428986
922 Ga0307409_100437037
923 Ga0307409_100563254
924 Ga0307416_100008752
925 Ga0307416_100017891
926 Ga0307416_100024444
927 Ga0307416_100039405
928 Ga0307416_100053637
929 Ga0307416_100130377
930 Ga0307416_100242577
931 Ga0307416_100276642
932 Ga0307416_100765232
933 Ga0307414_10032682
934 Ga0307414_10152630
935 Ga0307414_10254903
936 Ga0307414_10284496
937 Ga0307414_10468601
938 Ga0307411_10001198
939 Ga0307411_10019714
940 Ga0307411_10032907
941 Ga0307411_10044462
942 Ga0307411_10051868
943 Ga0307411_10125970
944 Ga0307411_10127002
945 Ga0307411_10251359
946 Ga0307415_100010658
947 Ga0307415_100127655
948 Ga0307415_100248318
949 Ga0307510_10002463
950 Ga0395900_0074842
951 Ga0395898_0227941
952 Ga0395901_0078048
953 Ga0395901_0140808
954 Ga0395901_0223175
955 Ga0237819_01122
956 Ga0436365_0598248
957 Ga0436365_1020809
958 Ga0436365_1404021
959 Ga0436362_0265247
960 Ga0439461_0000038
961 Ga0439466_0047431
962 Ga0439465_0020138
963 Ga0451807_0677377
964 Ga0451853_0802417
965 Ga0439431_0000211
966 Ga0439431_0048756
967 Ga0439442_000860
968 Ga0439445_0000068
969 Ga0439445_0002914
970 Ga0439432_000877
971 Ga0439432_051651
972 Ga0450920_013992
973 Ga0439434_0002135
974 Ga0466957_0416805
975 Ga0495617_049090
976 Ga0495627_012247
977 Ga0495592_0001831
978 Ga0495638_0000012
979 Ga0495638_0002975
980 Ga0495651_0004314
981 Ga0495651_0049989
982 Ga0495653_0002503
983 Ga0495650_0000290
984 Ga0495585_0002773
985 Ga0495585_0020405
986 Ga0495585_0126023
987 Ga0495607_0016870
988 Ga0495583_0000411
989 Ga0495583_0001065
990 Ga0495583_0003000
991 Ga0495583_0013953
992 Ga0495606_0000383
993 Ga0495608_0001267
994 Ga0495618_0052065
995 Ga0495628_0001337
996 Ga0495631_0029181
997 Ga0495631_0031426
998 Ga0495632_0000832
999 Ga0495643_0000556
1000 Ga0495643_0006292
1001 Ga0495643_0031650
1002 Ga0495643_0050076
1003 Ga0495644_0044850
1004 Ga0495648_0000038
1005 Ga0495648_0000901
1006 Ga0495648_0013015
1007 Ga0495652_0031929
1008 Ga0495652_0112562
1009 Ga0495652_0147328
1010 Ga0495654_0078414
1011 Ga0495598_0001525
1012 Ga0495621_0002891
1013 Ga0495597_0026834
1014 Ga0495645_0288700
1015 Ga0495622_0005748
1016 Ga0495622_0129464
1017 Ga0495633_0002232
1018 Ga0495633_0013935
1019 Ga0495633_0015028
1020 Ga0495633_0016871
1021 Ga0495668_0000218
1022 Ga0495611_0005427
1023 Ga0495611_0035355
1024 Ga0495625_0000496
1025 Ga0495625_0001098
1026 Ga0495625_0028736
1027 Ga0495625_0040485
1028 Ga0495625_0061599
1029 Ga0495661_0116386
1030 Ga0495599_0002386
1031 Ga0495646_0004343
1032 Ga0495646_0010710
1033 Ga0495669_0000241
1034 Ga0495669_0002156
1035 Ga0495669_0011004
1036 Ga0495669_0015695
1037 Ga0495670_0000104
1038 Ga0495670_0027119
1039 Ga0495670_0054457
1040 Ga0495670_0056147
1041 Ga0495671_0000034
1042 Ga0495649_0035817
1043 Ga0495600_0015093
1044 Ga0495683_0002703
1045 Ga0495687_000082
1046 Ga0495687_000472
1047 Ga0495673_0000013
1048 Ga0495673_0050588
1049 Ga0495681_0002528
1050 Ga0495681_0039186
1051 Ga0495686_0000602
1052 Ga0495686_0099947
1053 Ga0495602_0063131
1054 Ga0496102_0000930
1055 Ga0496103_0001181
1056 Ga0496104_0003538
1057 Ga0496105_0001238
1058 Ga0496110_0005603
1059 Ga0496110_0016383
1060 Ga0496111_0001589
1061 Ga0496111_0025686
1062 Ga0496113_0552921
1063 Ga0496115_0000339
1064 Ga0496115_0009842
1065 Ga0496116_0006574
1066 Ga0496116_0015362
1067 Ga0496116_0158836
1068 Ga0496117_0003623
1069 Ga0496118_0002640
1070 Ga0496118_0049413
1071 Ga0496118_0071311
1072 Ga0496119_0116690
1073 Ga0496120_0014422
1074 Ga0496120_0018434
1075 Ga0496121_0000128
1076 Ga0496121_0000200
1077 Ga0496121_0004809
1078 Ga0496122_0000021
1079 Ga0496122_0182792
1080 Ga0496123_0000382
1081 Ga0496123_0008086
1082 Ga0496123_0008374
1083 Ga0496123_0057905
1084 Ga0496123_0086142
1085 Ga0496124_0000761
1086 Ga0496124_0001474
1087 Ga0496124_0003074
1088 Ga0496124_0040880
1089 Ga0496124_0082792
1090 Ga0496125_0000005
1091 Ga0496125_0004606
1092 Ga0496125_0015489
1093 Ga0496126_0000467
1094 Ga0501290_000033
1095 Ga0501292_000026
1096 Ga0501294_001219
1097 Ga0501034_0143067
1098 Ga0501038_0050628
1099 Ga0501206_002038
1100 Ga0501222_000164
1101 Ga0501223_000934
1102 Ga0501227_021106
1103 Ga0501227_059446
1104 Ga0501233_024172
1105 Ga0501257_000093
1106 Ga0501257_022339
1107 Ga0501261_000055
1108 Ga0501221_004751
1109 Ga0501225_0001875
1110 Ga0501245_000201
1111 Ga0501080_0108079
1112 Ga0501279_000066
1113 Ga0501280_000428
1114 Ga0501281_00046
1115 Ga0501282_001783
1116 Ga0501283_004254
1117 Ga0501044_0540519
1118 nmdc:mga0k408_46010_c1
1119 nmdc:mga07m45_247207_c1
1120 nmdc:mga0qj67_77037_c1
1121 Ga0500610_0001098
1122 Ga0500643_000292
1123 Ga0500643_001429
1124 Ga0500643_009896
1125 Ga0500643_014938
1126 Ga0500646_0041121
1127 Ga0500566_0003208
1128 Ga0500556_0033203
1129 Ga0500595_001136
1130 Ga0500595_002209
1131 Ga0500607_000007
1132 Ga0500658_0002518
1133 Ga0500658_0006669
1134 Ga0500658_0010916
1135 Ga0500559_0000693
1136 Ga0500559_0001181
1137 Ga0500559_0004787
1138 Ga0500559_0134924
1139 Ga0500568_0002185
1140 Ga0500573_0000030
1141 Ga0500590_130387
1142 Ga0500604_0000001
1143 Ga0500604_0031722
1144 Ga0500616_0000070
1145 Ga0500616_0008535
1146 Ga0500619_022571
1147 Ga0500622_0000145
1148 Ga0500636_0002811
1149 Ga0500637_0005234
1150 Ga0500645_000237
1151 Ga0500645_002010
1152 Ga0500596_000903
1153 Ga0500587_001316
1154 Ga0500661_008186
1155 Ga0587090_004550
1156 Ga0587094_004794
1157 Ga0587071_012130
1158 2599902264
1159 2600202790
1160 2600228266
1161 2643859654
1162 2643978953
1163 2644120398
1164 2644125699
1165 2753767137
1166 2809036290
1167 2819542504
1168 2819716312
1169 2830079118
1170 2855731537
1171 2855768243
1172 2857541367
1173 2858951683
1174 2879165358
1175 2881413587
1176 2885430999
1177 2928528885
1178 2928970436
1179 2941483168
1180 2946789968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05726

Pirin_C

Pirin C-terminal cupin domain

208

307

0.98

PF02678

Pirin

Pirin

49

155

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9372 1 274
6d0p-assembly4.cif.gz_D 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.9348 1 276
6d0g-assembly1.cif.gz_A 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.926 2 294
6d0g-assembly1.cif.gz_A 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.908 2 294
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9024 1 274
ID Description Score Start End Superfamily
af_Q9SR06_19_98_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.9173 176 240 2.60.120.1030
af_C0P2Q1_61_325_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9092 11 272 2.60.120.10
af_Q5M827_137_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9032 143 270 2.60.120.10
af_Q9D711_137_245_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8951 143 243 2.60.120.10
4oi2A01 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.8946 176 238 2.60.120.1030
ID Description Score Start End GO Terms
AF-A0A5E6QY55-F1-model_v4 Pirin N-terminal domain-containing protein 0.9964 44 145
AF-A0A6L3ZQX3-F1-model_v4 deleted 0.9915 8 136
AF-A0A4Q2YVQ3-F1-model_v4 Pirin family protein 0.9902 6 223 GO:0046872
AF-A0A536TC78-F1-model_v4 Pirin family protein 0.99 31 290 GO:0046872
AF-A0A2N7XTZ3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9895 54 147

Map