F466980
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 293 | 578 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300035207|Ga0373942_0002748|Ga0373942_0002748_1865_3004 |
| Length | 379 |
| Sequence | MIMGRVLRFIMCSFAVSTCASIVPTRFGEYLRQIRLRRRRKFRQLAQKFNAIPAFVTFAPFCGSICRMRRVRVIDSHTGGEPTRVVISGGPDLGSDSLANRLERFRNDHDDFRCAVVNEPRGSDGVVGALLCAPVDESCVTGLIFFDRSGYLGMCGHGTIGVVTTLAHLNRIGPGNHRIETPVGIVVAHLNENGKVEVTNVPSYRLATNVTIDVPGIGPVTGDVAWGGNWFFLVNDHGQQLEFENIDRLLEFTLRVREALARAGITGADGHEIDHVELFGPSQLPGVNSKNFVLCPSKTYDRSPCGTGTSAKLACLFADGKLQEGQVWKQESIVGTVFEGTIKLVDNMVHPRIKGSAFITAEADLILDARDPFAMGIGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 3 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 4 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 5 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 6 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 7 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 8 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 9 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 10 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 11 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 12 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 13 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 14 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 15 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 267 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 268 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 272 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 273 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 275 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 276 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 279 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 289 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 293 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 0 |
| Isolates | 2.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.34 |
| Bulb | 0 |
| Endosphere | 3.05 |
| Nodule | 0 |
| Rhizoplane | 1.86 |
| Rhizosphere | 90.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_4046139 | 2162886011 | Bacteria | 2216 |
| 2 | CNAas_1000687 | 3300000532 | Unclassified | 3256 |
| 3 | LJNas_1000973 | 3300000546 | Bacteria | 4564 |
| 4 | JGI25156J39149_1000222 | 3300002705 | Bacteria | 39568 |
| 5 | JGI25156J39149_1000835 | 3300002705 | Bacteria | 15565 |
| 6 | JGI25154J39366_1002986 | 3300002738 | Bacteria | 3860 |
| 7 | JGI25157J39369_1000056 | 3300002741 | Bacteria | 107681 |
| 8 | JGI25157J39369_1000100 | 3300002741 | Bacteria | 73363 |
| 9 | rootH1_10002255 | 3300003316 | Bacteria | 2358 |
| 10 | Ga0055539_1000400 | 3300003752 | Bacteria | 16967 |
| 11 | Ga0055533_1000080 | 3300003756 | Bacteria | 131291 |
| 12 | Ga0055525_1001850 | 3300003759 | Bacteria | 2847 |
| 13 | Ga0055535_1000357 | 3300003761 | Bacteria | 44443 |
| 14 | Ga0055529_1000433 | 3300003763 | Bacteria | 42325 |
| 15 | Ga0055529_1000772 | 3300003763 | Bacteria | 20105 |
| 16 | Ga0065714_10064425 | 3300005288 | Bacteria | 189652 |
| 17 | Ga0065704_10084316 | 3300005289 | Bacteria | 3349 |
| 18 | Ga0065712_10067727 | 3300005290 | Bacteria | 189643 |
| 19 | Ga0065715_10000520 | 3300005293 | Bacteria | 22337 |
| 20 | Ga0065715_10009366 | 3300005293 | Bacteria | 2974 |
| 21 | Ga0065715_10122956 | 3300005293 | Bacteria | 2184 |
| 22 | Ga0065707_10014475 | 3300005295 | Bacteria | 2744 |
| 23 | Ga0070658_10008509 | 3300005327 | Bacteria | 8249 |
| 24 | Ga0070658_10023738 | 3300005327 | Bacteria | 4918 |
| 25 | Ga0070658_10055663 | 3300005327 | Bacteria | 3214 |
| 26 | Ga0070658_10391693 | 3300005327 | Bacteria | 1193 |
| 27 | Ga0070676_10306289 | 3300005328 | Bacteria | 1079 |
| 28 | Ga0070683_100136737 | 3300005329 | Unclassified | 2321 |
| 29 | Ga0070690_100013982 | 3300005330 | Bacteria | 4759 |
| 30 | Ga0070670_100000190 | 3300005331 | Bacteria | 56382 |
| 31 | Ga0070670_100107096 | 3300005331 | Bacteria | 2409 |
| 32 | Ga0068869_100071495 | 3300005334 | Unclassified | 2569 |
| 33 | Ga0068869_100143540 | 3300005334 | Bacteria | 1846 |
| 34 | Ga0068869_100159889 | 3300005334 | Bacteria | 1753 |
| 35 | Ga0068869_100184643 | 3300005334 | Bacteria | 1636 |
| 36 | Ga0070666_10038327 | 3300005335 | Bacteria | 3188 |
| 37 | Ga0070680_100097092 | 3300005336 | Unclassified | 2443 |
| 38 | Ga0070680_100226177 | 3300005336 | Unclassified | 1580 |
| 39 | Ga0070682_100028147 | 3300005337 | Bacteria | 3378 |
| 40 | Ga0068868_100030083 | 3300005338 | Bacteria | 4163 |
| 41 | Ga0068868_100405157 | 3300005338 | Bacteria | 1178 |
| 42 | Ga0070660_100194307 | 3300005339 | Bacteria | 1644 |
| 43 | Ga0070689_100011690 | 3300005340 | Bacteria | 6299 |
| 44 | Ga0070687_100057980 | 3300005343 | Bacteria | 2033 |
| 45 | Ga0070661_100011670 | 3300005344 | Bacteria | 6125 |
| 46 | Ga0070661_100248856 | 3300005344 | Unclassified | 1371 |
| 47 | Ga0070692_10038186 | 3300005345 | Bacteria | 2446 |
| 48 | Ga0070692_10084609 | 3300005345 | Bacteria | 1714 |
| 49 | Ga0070669_100025253 | 3300005353 | Bacteria | 4267 |
| 50 | Ga0070669_100230629 | 3300005353 | Bacteria | 1467 |
| 51 | Ga0070675_100098253 | 3300005354 | Bacteria | 2462 |
| 52 | Ga0070675_100314201 | 3300005354 | Unclassified | 1383 |
| 53 | Ga0070671_100058154 | 3300005355 | Bacteria | 3219 |
| 54 | Ga0070673_100003539 | 3300005364 | Bacteria | 9740 |
| 55 | Ga0070673_100168728 | 3300005364 | Bacteria | 1867 |
| 56 | Ga0070659_100002688 | 3300005366 | Bacteria | 12637 |
| 57 | Ga0070659_100040156 | 3300005366 | Bacteria | 3655 |
| 58 | Ga0070667_100038272 | 3300005367 | Bacteria | 4021 |
| 59 | Ga0070703_10055496 | 3300005406 | Bacteria | 1280 |
| 60 | Ga0070709_10254185 | 3300005434 | Bacteria | 1267 |
| 61 | Ga0070714_100178260 | 3300005435 | Bacteria | 1932 |
| 62 | Ga0070713_100003514 | 3300005436 | Bacteria | 10353 |
| 63 | Ga0070713_100065812 | 3300005436 | Unclassified | 3046 |
| 64 | Ga0070701_10245812 | 3300005438 | Bacteria | 1078 |
| 65 | Ga0070705_100160613 | 3300005440 | Bacteria | 1502 |
| 66 | Ga0070700_100000047 | 3300005441 | Bacteria | 90040 |
| 67 | Ga0070700_100009101 | 3300005441 | Bacteria | 5442 |
| 68 | Ga0070700_100017991 | 3300005441 | Bacteria | 4055 |
| 69 | Ga0070694_100031779 | 3300005444 | Bacteria | 3463 |
| 70 | Ga0070694_100053848 | 3300005444 | Bacteria | 2724 |
| 71 | Ga0070662_100305608 | 3300005457 | Bacteria | 1293 |
| 72 | Ga0070681_10000991 | 3300005458 | Bacteria | 24026 |
| 73 | Ga0070681_10011837 | 3300005458 | Bacteria | 8647 |
| 74 | Ga0070681_10019055 | 3300005458 | Bacteria | 6868 |
| 75 | Ga0070681_10062988 | 3300005458 | Unclassified | 3681 |
| 76 | Ga0068867_100066515 | 3300005459 | Bacteria | 2685 |
| 77 | Ga0070706_100000305 | 3300005467 | Bacteria | 59523 |
| 78 | Ga0070707_100003309 | 3300005468 | Bacteria | 15219 |
| 79 | Ga0070707_100030775 | 3300005468 | Bacteria | 5112 |
| 80 | Ga0070698_100030109 | 3300005471 | Bacteria | 5631 |
| 81 | Ga0070698_100055758 | 3300005471 | Bacteria | 4005 |
| 82 | Ga0070698_100366511 | 3300005471 | Bacteria | 1373 |
| 83 | Ga0070699_100000978 | 3300005518 | Bacteria | 26634 |
| 84 | Ga0070699_100052966 | 3300005518 | Bacteria | 3512 |
| 85 | Ga0070679_100015571 | 3300005530 | Bacteria | 7307 |
| 86 | Ga0070679_100131172 | 3300005530 | Unclassified | 2487 |
| 87 | Ga0070679_100159787 | 3300005530 | Bacteria | 2228 |
| 88 | Ga0070684_100000038 | 3300005535 | Bacteria | 94959 |
| 89 | Ga0070697_100171668 | 3300005536 | Bacteria | 1835 |
| 90 | Ga0068853_100024960 | 3300005539 | Bacteria | 5016 |
| 91 | Ga0070686_100159888 | 3300005544 | Bacteria | 1586 |
| 92 | Ga0070695_100055708 | 3300005545 | Bacteria | 2549 |
| 93 | Ga0070696_100115532 | 3300005546 | Bacteria | 1937 |
| 94 | Ga0070696_100309414 | 3300005546 | Bacteria | 1213 |
| 95 | Ga0070704_100063873 | 3300005549 | Bacteria | 2644 |
| 96 | Ga0070704_100101781 | 3300005549 | Bacteria | 2166 |
| 97 | Ga0070704_100339459 | 3300005549 | Bacteria | 1264 |
| 98 | Ga0068855_100004750 | 3300005563 | Bacteria | 16587 |
| 99 | Ga0068855_100043417 | 3300005563 | Bacteria | 5325 |
| 100 | Ga0068855_100238384 | 3300005563 | Bacteria | 2033 |
| 101 | Ga0070664_100002701 | 3300005564 | Bacteria | 14318 |
| 102 | Ga0070664_100052266 | 3300005564 | Bacteria | 3460 |
| 103 | Ga0070664_100056741 | 3300005564 | Bacteria | 3327 |
| 104 | Ga0070664_100076952 | 3300005564 | Bacteria | 2868 |
| 105 | Ga0070664_100531173 | 3300005564 | Bacteria | 1087 |
| 106 | Ga0068857_100001183 | 3300005577 | Bacteria | 20375 |
| 107 | Ga0068857_100003033 | 3300005577 | Bacteria | 13888 |
| 108 | Ga0068857_100018023 | 3300005577 | Bacteria | 6194 |
| 109 | Ga0068857_100028380 | 3300005577 | Bacteria | 4938 |
| 110 | Ga0068857_100055661 | 3300005577 | Bacteria | 3510 |
| 111 | Ga0068857_100234109 | 3300005577 | Bacteria | 1680 |
| 112 | Ga0068857_100240734 | 3300005577 | Bacteria | 1656 |
| 113 | Ga0068857_100394094 | 3300005577 | Bacteria | 1288 |
| 114 | Ga0068854_100045828 | 3300005578 | Bacteria | 3111 |
| 115 | Ga0068854_100260509 | 3300005578 | Unclassified | 1388 |
| 116 | Ga0068856_100000247 | 3300005614 | Bacteria | 58943 |
| 117 | Ga0068856_100000722 | 3300005614 | Bacteria | 35876 |
| 118 | Ga0070702_100003608 | 3300005615 | Bacteria | 6953 |
| 119 | Ga0070702_100224629 | 3300005615 | Bacteria | 1258 |
| 120 | Ga0070702_100250324 | 3300005615 | Bacteria | 1201 |
| 121 | Ga0068852_100031067 | 3300005616 | Bacteria | 4402 |
| 122 | Ga0068852_100040345 | 3300005616 | Bacteria | 3937 |
| 123 | Ga0068852_100072927 | 3300005616 | Bacteria | 3019 |
| 124 | Ga0068852_100143422 | 3300005616 | Bacteria | 2213 |
| 125 | Ga0068859_100006226 | 3300005617 | Bacteria | 12112 |
| 126 | Ga0068859_100009958 | 3300005617 | Bacteria | 9589 |
| 127 | Ga0068859_100019709 | 3300005617 | Bacteria | 6774 |
| 128 | Ga0068859_100023383 | 3300005617 | Bacteria | 6202 |
| 129 | Ga0068859_100028873 | 3300005617 | Bacteria | 5563 |
| 130 | Ga0068859_100034560 | 3300005617 | Bacteria | 5073 |
| 131 | Ga0068859_100060421 | 3300005617 | Unclassified | 3819 |
| 132 | Ga0068859_100080936 | 3300005617 | Bacteria | 3289 |
| 133 | Ga0068859_100090560 | 3300005617 | Bacteria | 3110 |
| 134 | Ga0068859_100376924 | 3300005617 | Unclassified | 1514 |
| 135 | Ga0068859_100528631 | 3300005617 | Bacteria | 1274 |
| 136 | Ga0068864_100005438 | 3300005618 | Bacteria | 10444 |
| 137 | Ga0068864_100060141 | 3300005618 | Bacteria | 3289 |
| 138 | Ga0068864_100060926 | 3300005618 | Unclassified | 3268 |
| 139 | Ga0068864_100216790 | 3300005618 | Bacteria | 1764 |
| 140 | Ga0068864_100264708 | 3300005618 | Bacteria | 1600 |
| 141 | Ga0068866_10130515 | 3300005718 | Bacteria | 1428 |
| 142 | Ga0068861_100067771 | 3300005719 | Bacteria | 2756 |
| 143 | Ga0068861_100139309 | 3300005719 | Bacteria | 1978 |
| 144 | Ga0068861_100147422 | 3300005719 | Bacteria | 1927 |
| 145 | Ga0068861_100372781 | 3300005719 | Bacteria | 1258 |
| 146 | Ga0068851_10006676 | 3300005834 | Bacteria | 5279 |
| 147 | Ga0068863_100041372 | 3300005841 | Bacteria | 4382 |
| 148 | Ga0068863_100068757 | 3300005841 | Bacteria | 3350 |
| 149 | Ga0068863_100092211 | 3300005841 | Bacteria | 2874 |
| 150 | Ga0068863_100161928 | 3300005841 | Bacteria | 2144 |
| 151 | Ga0068858_100048925 | 3300005842 | Bacteria | 3916 |
| 152 | Ga0068858_100051777 | 3300005842 | Bacteria | 3799 |
| 153 | Ga0068858_100103386 | 3300005842 | Bacteria | 2657 |
| 154 | Ga0068858_100194295 | 3300005842 | Bacteria | 1918 |
| 155 | Ga0068858_100285068 | 3300005842 | Bacteria | 1573 |
| 156 | Ga0068860_100020977 | 3300005843 | Bacteria | 6331 |
| 157 | Ga0068860_100046626 | 3300005843 | Bacteria | 4132 |
| 158 | Ga0068860_100083605 | 3300005843 | Bacteria | 3036 |
| 159 | Ga0068860_100087101 | 3300005843 | Bacteria | 2973 |
| 160 | Ga0068860_100179005 | 3300005843 | Bacteria | 2049 |
| 161 | Ga0068860_100335564 | 3300005843 | Bacteria | 1486 |
| 162 | Ga0068862_100075016 | 3300005844 | Bacteria | 2924 |
| 163 | Ga0068862_100131999 | 3300005844 | Bacteria | 2210 |
| 164 | Ga0068862_100158387 | 3300005844 | Bacteria | 2020 |
| 165 | Ga0081455_10083166 | 3300005937 | Bacteria | 2616 |
| 166 | Ga0081539_10001529 | 3300005985 | Bacteria | 38746 |
| 167 | Ga0081539_10005669 | 3300005985 | Bacteria | 12532 |
| 168 | Ga0081539_10018864 | 3300005985 | Bacteria | 4754 |
| 169 | Ga0081539_10083112 | 3300005985 | Unclassified | 1677 |
| 170 | Ga0070717_10073137 | 3300006028 | Bacteria | 2864 |
| 171 | Ga0070717_10097272 | 3300006028 | Bacteria | 2494 |
| 172 | Ga0097621_100005230 | 3300006237 | Bacteria | 9125 |
| 173 | Ga0097621_100010737 | 3300006237 | Bacteria | 6716 |
| 174 | Ga0097621_100037611 | 3300006237 | Bacteria | 3880 |
| 175 | Ga0097621_100047701 | 3300006237 | Bacteria | 3472 |
| 176 | Ga0097621_100192884 | 3300006237 | Bacteria | 1765 |
| 177 | Ga0068871_100019181 | 3300006358 | Bacteria | 5219 |
| 178 | Ga0068871_100044637 | 3300006358 | Bacteria | 3566 |
| 179 | Ga0068871_100070632 | 3300006358 | Bacteria | 2870 |
| 180 | Ga0075428_100071806 | 3300006844 | Bacteria | 3783 |
| 181 | Ga0075428_100497209 | 3300006844 | Bacteria | 1305 |
| 182 | Ga0075431_100460325 | 3300006847 | Bacteria | 1267 |
| 183 | Ga0075433_10088101 | 3300006852 | Bacteria | 2742 |
| 184 | Ga0075433_10120465 | 3300006852 | Bacteria | 2330 |
| 185 | Ga0075433_10178161 | 3300006852 | Bacteria | 1891 |
| 186 | Ga0075434_100063142 | 3300006871 | Bacteria | 3686 |
| 187 | Ga0075434_100196361 | 3300006871 | Bacteria | 2038 |
| 188 | Ga0075434_100500056 | 3300006871 | Bacteria | 1237 |
| 189 | Ga0075429_100058672 | 3300006880 | Bacteria | 3352 |
| 190 | Ga0075429_100178375 | 3300006880 | Bacteria | 1861 |
| 191 | Ga0068865_100023803 | 3300006881 | Bacteria | 4014 |
| 192 | Ga0075436_100006391 | 3300006914 | Bacteria | 8076 |
| 193 | Ga0075436_100050778 | 3300006914 | Bacteria | 2862 |
| 194 | Ga0075436_100220045 | 3300006914 | Bacteria | 1347 |
| 195 | Ga0097620_100006226 | 3300006931 | Bacteria | 12112 |
| 196 | Ga0097620_100009957 | 3300006931 | Bacteria | 9589 |
| 197 | Ga0097620_100019709 | 3300006931 | Bacteria | 6774 |
| 198 | Ga0097620_100023383 | 3300006931 | Bacteria | 6202 |
| 199 | Ga0097620_100028871 | 3300006931 | Bacteria | 5563 |
| 200 | Ga0097620_100034558 | 3300006931 | Bacteria | 5073 |
| 201 | Ga0097620_100060422 | 3300006931 | Unclassified | 3819 |
| 202 | Ga0097620_100080935 | 3300006931 | Bacteria | 3289 |
| 203 | Ga0097620_100090559 | 3300006931 | Bacteria | 3110 |
| 204 | Ga0097620_100315517 | 3300006931 | Bacteria | 1657 |
| 205 | Ga0097620_100376934 | 3300006931 | Unclassified | 1514 |
| 206 | Ga0097620_100528607 | 3300006931 | Bacteria | 1274 |
| 207 | Ga0075435_100305126 | 3300007076 | Bacteria | 1362 |
| 208 | Ga0105251_10004327 | 3300009011 | Bacteria | 9721 |
| 209 | Ga0105251_10042756 | 3300009011 | Bacteria | 2196 |
| 210 | Ga0105251_10115148 | 3300009011 | Bacteria | 1223 |
| 211 | Ga0105251_10117009 | 3300009011 | Bacteria | 1212 |
| 212 | Ga0105244_10020684 | 3300009036 | Bacteria | 3652 |
| 213 | Ga0105240_10037272 | 3300009093 | Bacteria | 6250 |
| 214 | Ga0105240_10049969 | 3300009093 | Bacteria | 5275 |
| 215 | Ga0105240_10122290 | 3300009093 | Bacteria | 3132 |
| 216 | Ga0105240_10211213 | 3300009093 | Bacteria | 2268 |
| 217 | Ga0111539_10024249 | 3300009094 | Bacteria | 7449 |
| 218 | Ga0111539_10106009 | 3300009094 | Bacteria | 3297 |
| 219 | Ga0111539_10139405 | 3300009094 | Bacteria | 2840 |
| 220 | Ga0111539_10409110 | 3300009094 | Bacteria | 1580 |
| 221 | Ga0105245_10136474 | 3300009098 | Bacteria | 2306 |
| 222 | Ga0105247_10001923 | 3300009101 | Bacteria | 14491 |
| 223 | Ga0114129_10013535 | 3300009147 | Bacteria | 11626 |
| 224 | Ga0105243_10000144 | 3300009148 | Bacteria | 81484 |
| 225 | Ga0105243_10002285 | 3300009148 | Bacteria | 16071 |
| 226 | Ga0105243_10099965 | 3300009148 | Bacteria | 2406 |
| 227 | Ga0105241_10021785 | 3300009174 | Bacteria | 4742 |
| 228 | Ga0105241_10119423 | 3300009174 | Bacteria | 2121 |
| 229 | Ga0105241_10138667 | 3300009174 | Bacteria | 1978 |
| 230 | Ga0105241_10179691 | 3300009174 | Bacteria | 1754 |
| 231 | Ga0105241_10246745 | 3300009174 | Unclassified | 1512 |
| 232 | Ga0105242_10051934 | 3300009176 | Bacteria | 3343 |
| 233 | Ga0105242_10122544 | 3300009176 | Bacteria | 2234 |
| 234 | Ga0105242_10268931 | 3300009176 | Bacteria | 1543 |
| 235 | Ga0105242_10326998 | 3300009176 | Bacteria | 1408 |
| 236 | Ga0105248_10008342 | 3300009177 | Bacteria | 11380 |
| 237 | Ga0105248_10026990 | 3300009177 | Bacteria | 6387 |
| 238 | Ga0105248_10034742 | 3300009177 | Bacteria | 5641 |
| 239 | Ga0105248_10038862 | 3300009177 | Bacteria | 5328 |
| 240 | Ga0105248_10170110 | 3300009177 | Bacteria | 2456 |
| 241 | Ga0105248_10207095 | 3300009177 | Bacteria | 2210 |
| 242 | Ga0105248_10654933 | 3300009177 | Bacteria | 1185 |
| 243 | Ga0105237_10000843 | 3300009545 | Bacteria | 41798 |
| 244 | Ga0105237_10028407 | 3300009545 | Bacteria | 5698 |
| 245 | Ga0105237_10231625 | 3300009545 | Bacteria | 1848 |
| 246 | Ga0105238_10000370 | 3300009551 | Bacteria | 48257 |
| 247 | Ga0105238_10006520 | 3300009551 | Bacteria | 11616 |
| 248 | Ga0105238_10013280 | 3300009551 | Bacteria | 8312 |
| 249 | Ga0105249_10000844 | 3300009553 | Bacteria | 27423 |
| 250 | Ga0105249_10261993 | 3300009553 | Bacteria | 1718 |
| 251 | Ga0105028_107051 | 3300009993 | Bacteria | 1173 |
| 252 | Ga0105239_10040324 | 3300010375 | Bacteria | 5116 |
| 253 | Ga0105239_10053571 | 3300010375 | Bacteria | 4425 |
| 254 | Ga0105239_10124425 | 3300010375 | Bacteria | 2865 |
| 255 | Ga0105239_10196306 | 3300010375 | Bacteria | 2260 |
| 256 | Ga0105239_10401014 | 3300010375 | Bacteria | 1552 |
| 257 | Ga0105246_10151469 | 3300011119 | Bacteria | 1756 |
| 258 | Ga0105246_10167253 | 3300011119 | Bacteria | 1681 |
| 259 | Ga0157373_10026181 | 3300013100 | Bacteria | 4215 |
| 260 | Ga0157373_10071289 | 3300013100 | Unclassified | 2454 |
| 261 | Ga0157373_10129172 | 3300013100 | Unclassified | 1777 |
| 262 | Ga0157371_10015105 | 3300013102 | Bacteria | 5804 |
| 263 | Ga0157370_10007038 | 3300013104 | Bacteria | 12279 |
| 264 | Ga0157370_10055878 | 3300013104 | Bacteria | 3759 |
| 265 | Ga0157370_10178711 | 3300013104 | Bacteria | 1972 |
| 266 | Ga0157369_10000401 | 3300013105 | Bacteria | 57752 |
| 267 | Ga0157369_10001968 | 3300013105 | Bacteria | 24775 |
| 268 | Ga0157369_10016299 | 3300013105 | Bacteria | 8365 |
| 269 | Ga0157369_10050147 | 3300013105 | Bacteria | 4522 |
| 270 | Ga0157369_10113789 | 3300013105 | Bacteria | 2874 |
| 271 | Ga0157369_10276000 | 3300013105 | Bacteria | 1751 |
| 272 | Ga0157374_10008732 | 3300013296 | Bacteria | 8669 |
| 273 | Ga0157374_10052985 | 3300013296 | Unclassified | 3781 |
| 274 | Ga0157374_10105404 | 3300013296 | Bacteria | 2708 |
| 275 | Ga0157378_10003679 | 3300013297 | Bacteria | 13600 |
| 276 | Ga0157378_10020058 | 3300013297 | Bacteria | 5879 |
| 277 | Ga0157378_10174563 | 3300013297 | Bacteria | 2018 |
| 278 | Ga0157378_10194758 | 3300013297 | Bacteria | 1914 |
| 279 | Ga0157378_10286708 | 3300013297 | Unclassified | 1589 |
| 280 | Ga0163162_10004613 | 3300013306 | Bacteria | 13279 |
| 281 | Ga0163162_10027304 | 3300013306 | Bacteria | 5644 |
| 282 | Ga0163162_10043171 | 3300013306 | Bacteria | 4514 |
| 283 | Ga0157372_10004845 | 3300013307 | Bacteria | 14308 |
| 284 | Ga0157372_10010935 | 3300013307 | Bacteria | 9659 |
| 285 | Ga0157372_10072929 | 3300013307 | Bacteria | 3869 |
| 286 | Ga0157372_10090997 | 3300013307 | Bacteria | 3470 |
| 287 | Ga0157372_10170897 | 3300013307 | Bacteria | 2515 |
| 288 | Ga0157372_10215609 | 3300013307 | Bacteria | 2225 |
| 289 | Ga0157372_10571390 | 3300013307 | Bacteria | 1318 |
| 290 | Ga0157372_10880814 | 3300013307 | Bacteria | 1039 |
| 291 | Ga0157375_10096948 | 3300013308 | Bacteria | 3022 |
| 292 | Ga0157375_10113584 | 3300013308 | Bacteria | 2809 |
| 293 | Ga0157375_10674334 | 3300013308 | Bacteria | 1189 |
| 294 | Ga0163163_10000209 | 3300014325 | Bacteria | 60592 |
| 295 | Ga0163163_10002342 | 3300014325 | Bacteria | 16028 |
| 296 | Ga0163163_10004974 | 3300014325 | Bacteria | 11444 |
| 297 | Ga0163163_10018160 | 3300014325 | Bacteria | 6576 |
| 298 | Ga0163163_10048137 | 3300014325 | Bacteria | 4191 |
| 299 | Ga0163163_10074278 | 3300014325 | Bacteria | 3392 |
| 300 | Ga0163163_10094424 | 3300014325 | Bacteria | 3009 |
| 301 | Ga0163163_10237341 | 3300014325 | Bacteria | 1873 |
| 302 | Ga0157380_10023612 | 3300014326 | Bacteria | 4641 |
| 303 | Ga0157380_10382101 | 3300014326 | Bacteria | 1329 |
| 304 | Ga0157377_10000074 | 3300014745 | Bacteria | 77443 |
| 305 | Ga0157377_10106824 | 3300014745 | Bacteria | 1677 |
| 306 | Ga0157379_10046382 | 3300014968 | Bacteria | 3876 |
| 307 | Ga0157376_10061364 | 3300014969 | Bacteria | 3160 |
| 308 | Ga0157376_10069379 | 3300014969 | Bacteria | 2988 |
| 309 | Ga0182005_1000004 | 3300015265 | Bacteria | 609645 |
| 310 | Ga0163161_10012424 | 3300017792 | Bacteria | 5913 |
| 311 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 312 | Ga0209563_100049 | 3300025230 | Bacteria | 358472 |
| 313 | Ga0207427_101398 | 3300025231 | Bacteria | 8819 |
| 314 | Ga0209258_100189 | 3300025242 | Bacteria | 128268 |
| 315 | Ga0209646_1000124 | 3300025246 | Bacteria | 138207 |
| 316 | Ga0209026_1000085 | 3300025250 | Bacteria | 185778 |
| 317 | Ga0209677_100135 | 3300025253 | Bacteria | 69251 |
| 318 | Ga0209677_100203 | 3300025253 | Bacteria | 47561 |
| 319 | Ga0209677_103161 | 3300025253 | Bacteria | 5556 |
| 320 | Ga0209759_1000068 | 3300025256 | Bacteria | 183479 |
| 321 | Ga0209759_1000729 | 3300025256 | Bacteria | 28835 |
| 322 | Ga0209759_1002917 | 3300025256 | Bacteria | 7174 |
| 323 | Ga0209759_1010734 | 3300025256 | Bacteria | 2662 |
| 324 | Ga0209455_1000092 | 3300025272 | Bacteria | 220516 |
| 325 | Ga0209051_1004213 | 3300025303 | Bacteria | 8973 |
| 326 | Ga0207697_10088546 | 3300025315 | Bacteria | 1310 |
| 327 | Ga0207656_10003975 | 3300025321 | Bacteria | 5122 |
| 328 | Ga0207713_1029389 | 3300025735 | Bacteria | 2463 |
| 329 | Ga0207653_10000894 | 3300025885 | Bacteria | 9903 |
| 330 | Ga0207642_10048586 | 3300025899 | Bacteria | 1903 |
| 331 | Ga0207710_10001516 | 3300025900 | Bacteria | 11506 |
| 332 | Ga0207680_10018308 | 3300025903 | Bacteria | 3721 |
| 333 | Ga0207680_10085754 | 3300025903 | Bacteria | 1990 |
| 334 | Ga0207647_10003108 | 3300025904 | Bacteria | 12466 |
| 335 | Ga0207647_10098742 | 3300025904 | Bacteria | 1735 |
| 336 | Ga0207645_10041276 | 3300025907 | Bacteria | 2954 |
| 337 | Ga0207643_10010983 | 3300025908 | Bacteria | 4886 |
| 338 | Ga0207643_10040090 | 3300025908 | Bacteria | 2636 |
| 339 | Ga0207643_10135635 | 3300025908 | Bacteria | 1467 |
| 340 | Ga0207705_10010139 | 3300025909 | Bacteria | 6857 |
| 341 | Ga0207705_10043903 | 3300025909 | Bacteria | 3211 |
| 342 | Ga0207684_10000053 | 3300025910 | Bacteria | 225260 |
| 343 | Ga0207684_10031170 | 3300025910 | Bacteria | 4538 |
| 344 | Ga0207654_10014038 | 3300025911 | Bacteria | 4132 |
| 345 | Ga0207707_10000004 | 3300025912 | Bacteria | 391281 |
| 346 | Ga0207707_10009356 | 3300025912 | Bacteria | 8498 |
| 347 | Ga0207707_10114856 | 3300025912 | Bacteria | 2353 |
| 348 | Ga0207695_10024272 | 3300025913 | Bacteria | 6827 |
| 349 | Ga0207695_10111010 | 3300025913 | Bacteria | 2721 |
| 350 | Ga0207695_10151287 | 3300025913 | Bacteria | 2260 |
| 351 | Ga0207695_10194026 | 3300025913 | Bacteria | 1947 |
| 352 | Ga0207671_10043459 | 3300025914 | Bacteria | 3323 |
| 353 | Ga0207660_10002498 | 3300025917 | Bacteria | 12095 |
| 354 | Ga0207660_10126680 | 3300025917 | Unclassified | 1940 |
| 355 | Ga0207660_10126851 | 3300025917 | Unclassified | 1938 |
| 356 | Ga0207662_10024050 | 3300025918 | Bacteria | 3505 |
| 357 | Ga0207662_10151478 | 3300025918 | Bacteria | 1475 |
| 358 | Ga0207657_10084610 | 3300025919 | Bacteria | 2658 |
| 359 | Ga0207652_10000087 | 3300025921 | Bacteria | 99945 |
| 360 | Ga0207652_10008111 | 3300025921 | Bacteria | 8432 |
| 361 | Ga0207652_10127830 | 3300025921 | Bacteria | 2264 |
| 362 | Ga0207652_10135206 | 3300025921 | Unclassified | 2201 |
| 363 | Ga0207646_10069952 | 3300025922 | Bacteria | 3134 |
| 364 | Ga0207646_10226594 | 3300025922 | Bacteria | 1688 |
| 365 | Ga0207646_10352112 | 3300025922 | Bacteria | 1331 |
| 366 | Ga0207694_10003790 | 3300025924 | Bacteria | 11963 |
| 367 | Ga0207694_10025335 | 3300025924 | Bacteria | 4508 |
| 368 | Ga0207694_10028730 | 3300025924 | Bacteria | 4241 |
| 369 | Ga0207650_10000007 | 3300025925 | Bacteria | 530810 |
| 370 | Ga0207650_10150340 | 3300025925 | Bacteria | 1837 |
| 371 | Ga0207650_10271164 | 3300025925 | Bacteria | 1379 |
| 372 | Ga0207659_10067416 | 3300025926 | Bacteria | 2599 |
| 373 | Ga0207659_10137334 | 3300025926 | Bacteria | 1894 |
| 374 | Ga0207659_10265038 | 3300025926 | Bacteria | 1399 |
| 375 | Ga0207687_10075007 | 3300025927 | Bacteria | 2426 |
| 376 | Ga0207700_10102017 | 3300025928 | Bacteria | 2290 |
| 377 | Ga0207700_10108400 | 3300025928 | Bacteria | 2230 |
| 378 | Ga0207700_10235088 | 3300025928 | Bacteria | 1560 |
| 379 | Ga0207700_10434474 | 3300025928 | Unclassified | 1155 |
| 380 | Ga0207664_10017642 | 3300025929 | Bacteria | 5238 |
| 381 | Ga0207664_10189094 | 3300025929 | Bacteria | 1771 |
| 382 | Ga0207644_10353218 | 3300025931 | Bacteria | 1194 |
| 383 | Ga0207690_10045759 | 3300025932 | Bacteria | 2893 |
| 384 | Ga0207690_10062705 | 3300025932 | Unclassified | 2532 |
| 385 | Ga0207690_10090434 | 3300025932 | Bacteria | 2161 |
| 386 | Ga0207690_10185748 | 3300025932 | Bacteria | 1568 |
| 387 | Ga0207706_10010126 | 3300025933 | Bacteria | 8632 |
| 388 | Ga0207706_10216847 | 3300025933 | Bacteria | 1676 |
| 389 | Ga0207686_10234572 | 3300025934 | Bacteria | 1332 |
| 390 | Ga0207686_10257850 | 3300025934 | Bacteria | 1277 |
| 391 | Ga0207670_10001523 | 3300025936 | Bacteria | 12188 |
| 392 | Ga0207670_10244760 | 3300025936 | Bacteria | 1383 |
| 393 | Ga0207704_10296128 | 3300025938 | Bacteria | 1237 |
| 394 | Ga0207691_10014923 | 3300025940 | Bacteria | 7402 |
| 395 | Ga0207711_10028499 | 3300025941 | Unclassified | 4699 |
| 396 | Ga0207711_10114592 | 3300025941 | Bacteria | 2401 |
| 397 | Ga0207689_10014720 | 3300025942 | Bacteria | 6643 |
| 398 | Ga0207689_10047043 | 3300025942 | Bacteria | 3564 |
| 399 | Ga0207689_10048650 | 3300025942 | Bacteria | 3498 |
| 400 | Ga0207689_10064957 | 3300025942 | Bacteria | 3002 |
| 401 | Ga0207689_10132329 | 3300025942 | Bacteria | 2053 |
| 402 | Ga0207689_10135406 | 3300025942 | Bacteria | 2028 |
| 403 | Ga0207689_10179110 | 3300025942 | Bacteria | 1748 |
| 404 | Ga0207689_10265932 | 3300025942 | Bacteria | 1419 |
| 405 | Ga0207661_10093237 | 3300025944 | Unclassified | 2513 |
| 406 | Ga0207667_10002685 | 3300025949 | Bacteria | 22003 |
| 407 | Ga0207667_10074935 | 3300025949 | Bacteria | 3514 |
| 408 | Ga0207667_10127757 | 3300025949 | Bacteria | 2618 |
| 409 | Ga0207667_10146617 | 3300025949 | Bacteria | 2430 |
| 410 | Ga0207651_10082845 | 3300025960 | Bacteria | 2317 |
| 411 | Ga0207651_10102670 | 3300025960 | Bacteria | 2126 |
| 412 | Ga0207651_10109126 | 3300025960 | Bacteria | 2073 |
| 413 | Ga0207651_10349593 | 3300025960 | Bacteria | 1244 |
| 414 | Ga0207712_10001401 | 3300025961 | Bacteria | 16456 |
| 415 | Ga0207712_10096231 | 3300025961 | Bacteria | 2191 |
| 416 | Ga0207640_10035617 | 3300025981 | Bacteria | 3116 |
| 417 | Ga0207640_10068539 | 3300025981 | Bacteria | 2378 |
| 418 | Ga0207677_10333314 | 3300026023 | Bacteria | 1265 |
| 419 | Ga0207703_10036835 | 3300026035 | Bacteria | 3895 |
| 420 | Ga0207703_10169093 | 3300026035 | Bacteria | 1921 |
| 421 | Ga0207703_10249169 | 3300026035 | Bacteria | 1600 |
| 422 | Ga0207639_10008033 | 3300026041 | Bacteria | 7212 |
| 423 | Ga0207639_10144576 | 3300026041 | Bacteria | 1985 |
| 424 | Ga0207639_10386214 | 3300026041 | Bacteria | 1258 |
| 425 | Ga0207678_10402809 | 3300026067 | Unclassified | 1185 |
| 426 | Ga0207708_10000113 | 3300026075 | Bacteria | 62692 |
| 427 | Ga0207708_10014216 | 3300026075 | Bacteria | 5952 |
| 428 | Ga0207708_10024164 | 3300026075 | Bacteria | 4596 |
| 429 | Ga0207708_10084634 | 3300026075 | Bacteria | 2438 |
| 430 | Ga0207708_10299722 | 3300026075 | Bacteria | 1307 |
| 431 | Ga0207702_10000235 | 3300026078 | Bacteria | 64091 |
| 432 | Ga0207702_10001127 | 3300026078 | Bacteria | 27289 |
| 433 | Ga0207702_10024438 | 3300026078 | Bacteria | 5014 |
| 434 | Ga0207702_10055061 | 3300026078 | Bacteria | 3373 |
| 435 | Ga0207641_10051511 | 3300026088 | Unclassified | 3487 |
| 436 | Ga0207641_10086461 | 3300026088 | Bacteria | 2734 |
| 437 | Ga0207641_10270818 | 3300026088 | Bacteria | 1593 |
| 438 | Ga0207641_10409312 | 3300026088 | Bacteria | 1304 |
| 439 | Ga0207648_10012132 | 3300026089 | Bacteria | 8080 |
| 440 | Ga0207648_10032894 | 3300026089 | Bacteria | 4576 |
| 441 | Ga0207648_10095808 | 3300026089 | Unclassified | 2596 |
| 442 | Ga0207676_10003576 | 3300026095 | Bacteria | 10980 |
| 443 | Ga0207676_10014396 | 3300026095 | Bacteria | 5690 |
| 444 | Ga0207676_10054349 | 3300026095 | Bacteria | 3138 |
| 445 | Ga0207674_10003076 | 3300026116 | Bacteria | 20639 |
| 446 | Ga0207674_10009239 | 3300026116 | Bacteria | 11299 |
| 447 | Ga0207674_10045026 | 3300026116 | Bacteria | 4541 |
| 448 | Ga0207674_10047263 | 3300026116 | Bacteria | 4413 |
| 449 | Ga0207674_10050907 | 3300026116 | Bacteria | 4228 |
| 450 | Ga0207674_10092481 | 3300026116 | Bacteria | 3014 |
| 451 | Ga0207674_10205464 | 3300026116 | Bacteria | 1919 |
| 452 | Ga0207674_10221059 | 3300026116 | Bacteria | 1842 |
| 453 | Ga0207674_10258053 | 3300026116 | Bacteria | 1690 |
| 454 | Ga0207674_10365984 | 3300026116 | Bacteria | 1394 |
| 455 | Ga0207675_100006726 | 3300026118 | Bacteria | 10871 |
| 456 | Ga0207675_100096602 | 3300026118 | Bacteria | 2782 |
| 457 | Ga0207683_10247172 | 3300026121 | Bacteria | 1627 |
| 458 | Ga0207698_10048609 | 3300026142 | Bacteria | 3222 |
| 459 | Ga0207698_10116362 | 3300026142 | Bacteria | 2253 |
| 460 | Ga0207698_10125428 | 3300026142 | Bacteria | 2182 |
| 461 | Ga0207698_10294575 | 3300026142 | Bacteria | 1508 |
| 462 | Ga0207428_10009063 | 3300027907 | Bacteria | 8949 |
| 463 | Ga0268266_10000140 | 3300028379 | Bacteria | 140387 |
| 464 | Ga0268265_10106379 | 3300028380 | Bacteria | 2279 |
| 465 | Ga0268265_10402435 | 3300028380 | Bacteria | 1266 |
| 466 | Ga0268265_10490876 | 3300028380 | Bacteria | 1155 |
| 467 | Ga0268264_10012975 | 3300028381 | Bacteria | 6851 |
| 468 | Ga0268264_10043066 | 3300028381 | Bacteria | 3739 |
| 469 | Ga0268264_10086297 | 3300028381 | Bacteria | 2696 |
| 470 | Ga0268264_10097643 | 3300028381 | Bacteria | 2547 |
| 471 | Ga0268264_10105531 | 3300028381 | Bacteria | 2458 |
| 472 | Ga0265336_10000006 | 3300028666 | Bacteria | 348453 |
| 473 | Ga0307515_10097879 | 3300028794 | Bacteria | 3580 |
| 474 | Ga0265324_10001517 | 3300029957 | Bacteria | 13111 |
| 475 | Ga0265339_10163154 | 3300031249 | Eukaryota | 1120 |
| 476 | Ga0307513_10115348 | 3300031456 | Bacteria | 2668 |
| 477 | Ga0307516_10001445 | 3300031730 | Bacteria | 32809 |
| 478 | Ga0307405_10033920 | 3300031731 | Bacteria | 3033 |
| 479 | Ga0307410_10013753 | 3300031852 | Bacteria | 4736 |
| 480 | Ga0307410_10329450 | 3300031852 | Bacteria | 1214 |
| 481 | Ga0307406_10000949 | 3300031901 | Bacteria | 16238 |
| 482 | Ga0307414_10149131 | 3300032004 | Bacteria | 1842 |
| 483 | Ga0307507_10033999 | 3300033179 | Bacteria | 5279 |
| 484 | Ga0373939_0044473 | 3300035114 | Bacteria | 1352 |
| 485 | Ga0373942_0002748 | 3300035207 | Bacteria | 4202 |
| 486 | Ga0373931_0228514 | 3300035691 | Bacteria | 1123 |
| 487 | Ga0373935_0213960 | 3300035692 | Bacteria | 1336 |
| 488 | Ga0373933_0143295 | 3300035724 | Bacteria | 1510 |
| 489 | Ga0373937_0107331 | 3300036401 | Bacteria | 2596 |
| 490 | Ga0373937_0568774 | 3300036401 | Bacteria | 1077 |
| 491 | Ga0373925_0284996 | 3300037068 | Bacteria | 1331 |
| 492 | Ga0395898_0123374 | 3300037466 | Bacteria | 2482 |
| 493 | Ga0395905_0221084 | 3300037471 | Bacteria | 1772 |
| 494 | Ga0436364_0681300 | 3300037853 | Bacteria | 3923 |
| 495 | Ga0436364_1343081 | 3300037853 | Bacteria | 2671 |
| 496 | Ga0395901_0033779 | 3300038443 | Bacteria | 5282 |
| 497 | Ga0395901_0566583 | 3300038443 | Bacteria | 1149 |
| 498 | Ga0242420_000456 | 3300038996 | Bacteria | 4628 |
| 499 | Ga0436360_0258342 | 3300039438 | Bacteria | 1360 |
| 500 | Ga0451577_0087014 | 3300042876 | Bacteria | 2788 |
| 501 | Ga0451577_0270866 | 3300042876 | Bacteria | 1538 |
| 502 | Ga0466969_0002921 | 3300044656 | Bacteria | 9118 |
| 503 | Ga0466965_0003825 | 3300044683 | Bacteria | 6644 |
| 504 | Ga0466966_0008102 | 3300044684 | Bacteria | 6966 |
| 505 | Ga0466961_0037377 | 3300044693 | Bacteria | 3114 |
| 506 | Ga0466964_0004764 | 3300044706 | Bacteria | 5016 |
| 507 | Ga0466957_0020261 | 3300044842 | Bacteria | 3914 |
| 508 | Ga0466959_0002303 | 3300045049 | Bacteria | 12179 |
| 509 | Ga0451576_0016127 | 3300045051 | Bacteria | 8255 |
| 510 | Ga0451576_0150474 | 3300045051 | Bacteria | 2427 |
| 511 | Ga0451576_0458258 | 3300045051 | Bacteria | 1339 |
| 512 | Ga0495582_0217886 | 3300046473 | Bacteria | 1092 |
| 513 | Ga0495582_0341192 | 3300046473 | Bacteria | 862 |
| 514 | Ga0495639_0011388 | 3300046475 | Bacteria | 3835 |
| 515 | Ga0495639_0050284 | 3300046475 | Bacteria | 1893 |
| 516 | Ga0495664_0083564 | 3300046477 | Bacteria | 1916 |
| 517 | Ga0495583_0000224 | 3300046506 | Bacteria | 95810 |
| 518 | Ga0495606_0001614 | 3300046507 | Bacteria | 29404 |
| 519 | Ga0495608_0017001 | 3300046511 | Bacteria | 5032 |
| 520 | Ga0495616_0007064 | 3300046513 | Bacteria | 6745 |
| 521 | Ga0495630_0000667 | 3300046517 | Bacteria | 24749 |
| 522 | Ga0495625_0031520 | 3300046660 | Bacteria | 3942 |
| 523 | Ga0495635_0040140 | 3300046663 | Bacteria | 3235 |
| 524 | Ga0495646_0188281 | 3300046680 | Bacteria | 1129 |
| 525 | Ga0495658_0094808 | 3300046683 | Bacteria | 1773 |
| 526 | Ga0495669_0007294 | 3300046684 | Bacteria | 4632 |
| 527 | Ga0495624_0004031 | 3300046690 | Bacteria | 10804 |
| 528 | Ga0495649_0002245 | 3300046694 | Bacteria | 13726 |
| 529 | Ga0495589_0027344 | 3300046794 | Bacteria | 2884 |
| 530 | Ga0495581_0033187 | 3300047315 | Bacteria | 2989 |
| 531 | Ga0495676_0188098 | 3300047321 | Bacteria | 1442 |
| 532 | Ga0495675_0302149 | 3300047444 | Bacteria | 950 |
| 533 | Ga0495684_0006627 | 3300047471 | Bacteria | 8982 |
| 534 | Ga0495686_0024061 | 3300047472 | Bacteria | 4005 |
| 535 | Ga0496103_0134844 | 3300048906 | Bacteria | 1578 |
| 536 | Ga0496104_0102634 | 3300048907 | Bacteria | 2739 |
| 537 | Ga0496104_0200665 | 3300048907 | Bacteria | 1907 |
| 538 | Ga0496105_0145498 | 3300048908 | Bacteria | 1949 |
| 539 | Ga0496108_0161645 | 3300048911 | Bacteria | 1936 |
| 540 | Ga0496109_0541876 | 3300048912 | Bacteria | 1098 |
| 541 | Ga0496110_0246020 | 3300048913 | Bacteria | 1628 |
| 542 | Ga0496112_0056264 | 3300048915 | Bacteria | 3871 |
| 543 | Ga0496112_0060783 | 3300048915 | Bacteria | 3724 |
| 544 | Ga0496112_0366656 | 3300048915 | Bacteria | 1382 |
| 545 | Ga0496113_0195818 | 3300048916 | Bacteria | 1605 |
| 546 | Ga0501292_008074 | 3300049515 | Bacteria | 1531 |
| 547 | Ga0501298_008826 | 3300049521 | Bacteria | 1702 |
| 548 | Ga0501299_009095 | 3300049522 | Bacteria | 1630 |
| 549 | Ga0501070_0253588 | 3300049586 | Bacteria | 1439 |
| 550 | Ga0501072_0411049 | 3300049588 | Bacteria | 1073 |
| 551 | Ga0501227_014912 | 3300049665 | Bacteria | 1731 |
| 552 | Ga0501230_007695 | 3300049667 | Bacteria | 1606 |
| 553 | Ga0501233_014619 | 3300049668 | Bacteria | 1606 |
| 554 | Ga0501257_007104 | 3300049686 | Bacteria | 2497 |
| 555 | Ga0501221_018094 | 3300049704 | Bacteria | 1353 |
| 556 | Ga0501225_0000594 | 3300049705 | Bacteria | 11294 |
| 557 | Ga0501080_0031731 | 3300049742 | Bacteria | 4923 |
| 558 | Ga0501271_005834 | 3300049768 | Bacteria | 1210 |
| 559 | Ga0501273_000997 | 3300049770 | Bacteria | 2539 |
| 560 | Ga0501044_0001575 | 3300049823 | Bacteria | 26679 |
| 561 | nmdc:mga05p37_113313_c1 | 3300050507 | Bacteria | 3334 |
| 562 | nmdc:mga05p37_86867_c1 | 3300050507 | Bacteria | 3855 |
| 563 | nmdc:mga09592_118706_c1 | 3300050508 | Bacteria | 2270 |
| 564 | nmdc:mga09592_45617_c1 | 3300050508 | Bacteria | 3692 |
| 565 | nmdc:mga08y16_186121_c1 | 3300050511 | Bacteria | 2155 |
| 566 | nmdc:mga08y16_232319_c1 | 3300050511 | Bacteria | 1907 |
| 567 | nmdc:mga08y16_2741_c1 | 3300050511 | Bacteria | 18062 |
| 568 | nmdc:mga08y16_79491_c1 | 3300050511 | Bacteria | 3418 |
| 569 | nmdc:mga0rr50_32695_c1 | 3300050513 | Bacteria | 3709 |
| 570 | nmdc:mga0a205_5488_c1 | 3300050515 | Bacteria | 11420 |
| 571 | nmdc:mga0a205_82339_c1 | 3300050515 | Bacteria | 3108 |
| 572 | nmdc:mga0sz30_130319_c1 | 3300050516 | Bacteria | 1108 |
| 573 | Ga0495601_0000786 | 3300053077 | Bacteria | 17145 |
| 574 | Ga0500635_0000057 | 3300053080 | Bacteria | 73077 |
| 575 | Ga0495595_0035117 | 3300053084 | Bacteria | 2271 |
| 576 | Ga0495619_0002942 | 3300053085 | Bacteria | 11061 |
| 577 | Ga0501084_0207999 | 3300054114 | Viruses | 1651 |
| 578 | Ga0500661_011670 | 3300055283 | Bacteria | 1588 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035114 | Ga0373939_0044473 | Ga0373939_0044473_583_1338 | 248 |
| 2 | 3300047444 | Ga0495675_0302149 | Ga0495675_0302149_29_784 | 248 |
| 3 | 3300046473 | Ga0495582_0341192 | Ga0495582_0341192_76_834 | 252 |
| 4 | 3300046680 | Ga0495646_0188281 | Ga0495646_0188281_23_781 | 252 |
| 5 | 3300047472 | Ga0495686_0024061 | Ga0495686_0024061_556_1509 | 262 |
| 6 | 3300005563 | Ga0068855_100238384 | Ga0068855_1002383842 | 273 |
| 7 | 3300009093 | Ga0105240_10049969 | Ga0105240_100499693 | 273 |
| 8 | 3300025913 | Ga0207695_10024272 | Ga0207695_100242723 | 273 |
| 9 | 3300013105 | Ga0157369_10113789 | Ga0157369_101137894 | 275 |
| 10 | 3300013296 | Ga0157374_10008732 | Ga0157374_100087328 | 275 |
| 11 | 3300048915 | Ga0496112_0060783 | Ga0496112_0060783_2211_3047 | 275 |
| 12 | 3300046660 | Ga0495625_0031520 | Ga0495625_0031520_1673_2677 | 276 |
| 13 | 3300003761 | Ga0055535_1000357 | Ga0055535_100035724 | 278 |
| 14 | 3300003763 | Ga0055529_1000433 | Ga0055529_100043315 | 278 |
| 15 | 3300003763 | Ga0055529_1000772 | Ga0055529_10007724 | 278 |
| 16 | 3300025242 | Ga0209258_100189 | Ga0209258_10018940 | 278 |
| 17 | 3300025256 | Ga0209759_1000729 | Ga0209759_10007294 | 278 |
| 18 | 3300025272 | Ga0209455_1000092 | Ga0209455_100009240 | 278 |
| 19 | 3300046475 | Ga0495639_0050284 | Ga0495639_0050284_870_1823 | 278 |
| 20 | 3300013105 | Ga0157369_10000401 | Ga0157369_1000040146 | 281 |
| 21 | 3300025253 | Ga0209677_103161 | Ga0209677_1031614 | 283 |
| 22 | 3300053080 | Ga0500635_0000057 | Ga0500635_0000057_13873_14826 | 283 |
| 23 | 3300025256 | Ga0209759_1010734 | Ga0209759_10107342 | 284 |
| 24 | 3300046506 | Ga0495583_0000224 | Ga0495583_0000224_6430_7383 | 284 |
| 25 | 3300046507 | Ga0495606_0001614 | Ga0495606_0001614_10848_11801 | 284 |
| 26 | 3300046684 | Ga0495669_0007294 | Ga0495669_0007294_574_1527 | 284 |
| 27 | 3300046694 | Ga0495649_0002245 | Ga0495649_0002245_11355_12308 | 284 |
| 28 | 3300046794 | Ga0495589_0027344 | Ga0495589_0027344_1555_2508 | 284 |
| 29 | 3300055283 | Ga0500661_011670 | Ga0500661_011670_49_1002 | 284 |
| 30 | 3300002705 | JGI25156J39149_1000222 | JGI25156J39149_100022228 | 285 |
| 31 | 3300002705 | JGI25156J39149_1000835 | JGI25156J39149_10008354 | 285 |
| 32 | 3300002738 | JGI25154J39366_1002986 | JGI25154J39366_10029864 | 285 |
| 33 | 3300002741 | JGI25157J39369_1000056 | JGI25157J39369_100005646 | 285 |
| 34 | 3300002741 | JGI25157J39369_1000100 | JGI25157J39369_10001008 | 285 |
| 35 | 3300005577 | Ga0068857_100001183 | Ga0068857_1000011835 | 285 |
| 36 | 3300005578 | Ga0068854_100045828 | Ga0068854_1000458282 | 285 |
| 37 | 3300005614 | Ga0068856_100000722 | Ga0068856_10000072229 | 285 |
| 38 | 3300005616 | Ga0068852_100031067 | Ga0068852_1000310673 | 285 |
| 39 | 3300013105 | Ga0157369_10276000 | Ga0157369_102760002 | 285 |
| 40 | 3300025246 | Ga0209646_1000124 | Ga0209646_100012463 | 285 |
| 41 | 3300025250 | Ga0209026_1000085 | Ga0209026_100008563 | 285 |
| 42 | 3300025253 | Ga0209677_100203 | Ga0209677_10020337 | 285 |
| 43 | 3300025256 | Ga0209759_1000068 | Ga0209759_100006861 | 285 |
| 44 | 3300025949 | Ga0207667_10074935 | Ga0207667_100749353 | 285 |
| 45 | 3300025981 | Ga0207640_10035617 | Ga0207640_100356173 | 285 |
| 46 | 3300026078 | Ga0207702_10000235 | Ga0207702_100002357 | 285 |
| 47 | 3300026116 | Ga0207674_10003076 | Ga0207674_1000307615 | 285 |
| 48 | 3300026142 | Ga0207698_10116362 | Ga0207698_101163622 | 285 |
| 49 | 3300031730 | Ga0307516_10001445 | Ga0307516_100014453 | 286 |
| 50 | 3300025256 | Ga0209759_1002917 | Ga0209759_10029173 | 291 |
| 51 | 3300005563 | Ga0068855_100004750 | Ga0068855_10000475013 | 293 |
| 52 | 3300025949 | Ga0207667_10002685 | Ga0207667_1000268519 | 293 |
| 53 | 3300005577 | Ga0068857_100394094 | Ga0068857_1003940941 | 294 |
| 54 | 3300026116 | Ga0207674_10365984 | Ga0207674_103659842 | 294 |
| 55 | 3300042876 | Ga0451577_0087014 | Ga0451577_0087014_687_1640 | 294 |
| 56 | 3300045051 | Ga0451576_0150474 | Ga0451576_0150474_1227_2180 | 294 |
| 57 | 3300005330 | Ga0070690_100013982 | Ga0070690_1000139823 | 295 |
| 58 | 3300005334 | Ga0068869_100184643 | Ga0068869_1001846432 | 295 |
| 59 | 3300005338 | Ga0068868_100405157 | Ga0068868_1004051571 | 295 |
| 60 | 3300009176 | Ga0105242_10326998 | Ga0105242_103269981 | 295 |
| 61 | 3300013297 | Ga0157378_10194758 | Ga0157378_101947582 | 295 |
| 62 | 3300025934 | Ga0207686_10257850 | Ga0207686_102578501 | 295 |
| 63 | 3300025942 | Ga0207689_10048650 | Ga0207689_100486502 | 295 |
| 64 | 3300003752 | Ga0055539_1000400 | Ga0055539_10004006 | 296 |
| 65 | 3300003756 | Ga0055533_1000080 | Ga0055533_1000080122 | 296 |
| 66 | 3300003759 | Ga0055525_1001850 | Ga0055525_10018504 | 296 |
| 67 | 3300005328 | Ga0070676_10306289 | Ga0070676_103062891 | 296 |
| 68 | 3300005438 | Ga0070701_10245812 | Ga0070701_102458121 | 296 |
| 69 | 3300005441 | Ga0070700_100009101 | Ga0070700_1000091013 | 296 |
| 70 | 3300013308 | Ga0157375_10113584 | Ga0157375_101135842 | 296 |
| 71 | 3300014326 | Ga0157380_10023612 | Ga0157380_100236125 | 296 |
| 72 | 3300025226 | Ga0209674_100003 | Ga0209674_1000031855 | 296 |
| 73 | 3300025230 | Ga0209563_100049 | Ga0209563_100049317 | 296 |
| 74 | 3300025231 | Ga0207427_101398 | Ga0207427_1013988 | 296 |
| 75 | 3300025253 | Ga0209677_100135 | Ga0209677_10013524 | 296 |
| 76 | 3300025907 | Ga0207645_10041276 | Ga0207645_100412763 | 296 |
| 77 | 3300028666 | Ga0265336_10000006 | Ga0265336_10000006314 | 296 |
| 78 | 3300029957 | Ga0265324_10001517 | Ga0265324_100015177 | 296 |
| 79 | 3300003316 | rootH1_10002255 | rootH1_100022551 | 297 |
| 80 | 3300025932 | Ga0207690_10045759 | Ga0207690_100457594 | 297 |
| 81 | 3300031456 | Ga0307513_10115348 | Ga0307513_101153483 | 299 |
| 82 | 3300044842 | Ga0466957_0020261 | Ga0466957_0020261_1536_2540 | 299 |
| 83 | 3300005344 | Ga0070661_100011670 | Ga0070661_1000116702 | 300 |
| 84 | 3300005458 | Ga0070681_10011837 | Ga0070681_100118372 | 300 |
| 85 | 3300005530 | Ga0070679_100015571 | Ga0070679_1000155713 | 300 |
| 86 | 3300005564 | Ga0070664_100052266 | Ga0070664_1000522663 | 300 |
| 87 | 3300005577 | Ga0068857_100018023 | Ga0068857_1000180236 | 300 |
| 88 | 3300005614 | Ga0068856_100000247 | Ga0068856_10000024743 | 300 |
| 89 | 3300013100 | Ga0157373_10026181 | Ga0157373_100261815 | 300 |
| 90 | 3300013104 | Ga0157370_10007038 | Ga0157370_1000703813 | 300 |
| 91 | 3300025921 | Ga0207652_10008111 | Ga0207652_100081118 | 300 |
| 92 | 3300025932 | Ga0207690_10090434 | Ga0207690_100904342 | 300 |
| 93 | 3300026078 | Ga0207702_10001127 | Ga0207702_1000112720 | 300 |
| 94 | 3300026116 | Ga0207674_10050907 | Ga0207674_100509074 | 300 |
| 95 | 3300035692 | Ga0373935_0213960 | Ga0373935_0213960_283_1221 | 300 |
| 96 | 3300046513 | Ga0495616_0007064 | Ga0495616_0007064_3616_4542 | 300 |
| 97 | 3300049586 | Ga0501070_0253588 | Ga0501070_0253588_218_1144 | 300 |
| 98 | 3300049742 | Ga0501080_0031731 | Ga0501080_0031731_1575_2501 | 300 |
| 99 | 3300010375 | Ga0105239_10401014 | Ga0105239_104010141 | 301 |
| 100 | 3300013307 | Ga0157372_10170897 | Ga0157372_101708972 | 301 |
| 101 | 3300045051 | Ga0451576_0458258 | Ga0451576_0458258_209_1138 | 301 |
| 102 | 3300037853 | Ga0436364_1343081 | Ga0436364_1343081_158_1081 | 302 |
| 103 | 3300005457 | Ga0070662_100305608 | Ga0070662_1003056082 | 303 |
| 104 | 3300025926 | Ga0207659_10137334 | Ga0207659_101373341 | 303 |
| 105 | 3300026121 | Ga0207683_10247172 | Ga0207683_102471722 | 303 |
| 106 | 3300005327 | Ga0070658_10023738 | Ga0070658_100237382 | 304 |
| 107 | 3300005327 | Ga0070658_10055663 | Ga0070658_100556633 | 304 |
| 108 | 3300005327 | Ga0070658_10391693 | Ga0070658_103916931 | 304 |
| 109 | 3300005339 | Ga0070660_100194307 | Ga0070660_1001943072 | 304 |
| 110 | 3300005364 | Ga0070673_100003539 | Ga0070673_1000035393 | 304 |
| 111 | 3300009148 | Ga0105243_10000144 | Ga0105243_1000014438 | 304 |
| 112 | 3300025909 | Ga0207705_10043903 | Ga0207705_100439034 | 304 |
| 113 | 3300025919 | Ga0207657_10084610 | Ga0207657_100846102 | 304 |
| 114 | 3300025960 | Ga0207651_10082845 | Ga0207651_100828452 | 304 |
| 115 | 3300037466 | Ga0395898_0123374 | Ga0395898_0123374_1373_2383 | 304 |
| 116 | 3300037471 | Ga0395905_0221084 | Ga0395905_0221084_141_1073 | 304 |
| 117 | 3300038443 | Ga0395901_0566583 | Ga0395901_0566583_126_1136 | 304 |
| 118 | 3300044656 | Ga0466969_0002921 | Ga0466969_0002921_6944_7975 | 304 |
| 119 | 3300044683 | Ga0466965_0003825 | Ga0466965_0003825_4404_5435 | 304 |
| 120 | 3300044684 | Ga0466966_0008102 | Ga0466966_0008102_1117_2142 | 304 |
| 121 | 3300044693 | Ga0466961_0037377 | Ga0466961_0037377_385_1338 | 304 |
| 122 | 3300044706 | Ga0466964_0004764 | Ga0466964_0004764_2936_3967 | 304 |
| 123 | 3300045049 | Ga0466959_0002303 | Ga0466959_0002303_5902_6933 | 304 |
| 124 | 3300045051 | Ga0451576_0016127 | Ga0451576_0016127_5357_6286 | 304 |
| 125 | 3300005327 | Ga0070658_10008509 | Ga0070658_100085096 | 305 |
| 126 | 3300005436 | Ga0070713_100003514 | Ga0070713_1000035146 | 305 |
| 127 | 3300005937 | Ga0081455_10083166 | Ga0081455_100831662 | 305 |
| 128 | 3300013307 | Ga0157372_10072929 | Ga0157372_100729293 | 305 |
| 129 | 3300025909 | Ga0207705_10010139 | Ga0207705_100101391 | 305 |
| 130 | 3300025928 | Ga0207700_10108400 | Ga0207700_101084001 | 305 |
| 131 | 3300028794 | Ga0307515_10097879 | Ga0307515_100978792 | 305 |
| 132 | 3300046475 | Ga0495639_0011388 | Ga0495639_0011388_1595_2542 | 305 |
| 133 | 3300046517 | Ga0495630_0000667 | Ga0495630_0000667_7230_8177 | 305 |
| 134 | 3300046663 | Ga0495635_0040140 | Ga0495635_0040140_759_1706 | 305 |
| 135 | 3300046690 | Ga0495624_0004031 | Ga0495624_0004031_7741_8688 | 305 |
| 136 | 3300047315 | Ga0495581_0033187 | Ga0495581_0033187_917_1864 | 305 |
| 137 | 3300047321 | Ga0495676_0188098 | Ga0495676_0188098_419_1366 | 305 |
| 138 | 3300047471 | Ga0495684_0006627 | Ga0495684_0006627_6567_7514 | 305 |
| 139 | 3300005340 | Ga0070689_100011690 | Ga0070689_1000116905 | 306 |
| 140 | 3300005345 | Ga0070692_10038186 | Ga0070692_100381862 | 306 |
| 141 | 3300005345 | Ga0070692_10084609 | Ga0070692_100846092 | 306 |
| 142 | 3300005366 | Ga0070659_100040156 | Ga0070659_1000401561 | 306 |
| 143 | 3300005406 | Ga0070703_10055496 | Ga0070703_100554962 | 306 |
| 144 | 3300005444 | Ga0070694_100031779 | Ga0070694_1000317794 | 306 |
| 145 | 3300005444 | Ga0070694_100053848 | Ga0070694_1000538481 | 306 |
| 146 | 3300005471 | Ga0070698_100366511 | Ga0070698_1003665111 | 306 |
| 147 | 3300005546 | Ga0070696_100309414 | Ga0070696_1003094141 | 306 |
| 148 | 3300005549 | Ga0070704_100101781 | Ga0070704_1001017812 | 306 |
| 149 | 3300005549 | Ga0070704_100339459 | Ga0070704_1003394591 | 306 |
| 150 | 3300005577 | Ga0068857_100055661 | Ga0068857_1000556612 | 306 |
| 151 | 3300005615 | Ga0070702_100250324 | Ga0070702_1002503241 | 306 |
| 152 | 3300005617 | Ga0068859_100034560 | Ga0068859_1000345602 | 306 |
| 153 | 3300005617 | Ga0068859_100090560 | Ga0068859_1000905603 | 306 |
| 154 | 3300005618 | Ga0068864_100005438 | Ga0068864_1000054387 | 306 |
| 155 | 3300005719 | Ga0068861_100372781 | Ga0068861_1003727811 | 306 |
| 156 | 3300005834 | Ga0068851_10006676 | Ga0068851_100066764 | 306 |
| 157 | 3300005841 | Ga0068863_100041372 | Ga0068863_1000413722 | 306 |
| 158 | 3300005842 | Ga0068858_100285068 | Ga0068858_1002850682 | 306 |
| 159 | 3300005843 | Ga0068860_100087101 | Ga0068860_1000871014 | 306 |
| 160 | 3300005844 | Ga0068862_100075016 | Ga0068862_1000750162 | 306 |
| 161 | 3300005844 | Ga0068862_100158387 | Ga0068862_1001583872 | 306 |
| 162 | 3300006931 | Ga0097620_100034558 | Ga0097620_1000345582 | 306 |
| 163 | 3300006931 | Ga0097620_100090559 | Ga0097620_1000905593 | 306 |
| 164 | 3300009011 | Ga0105251_10004327 | Ga0105251_100043276 | 306 |
| 165 | 3300009036 | Ga0105244_10020684 | Ga0105244_100206843 | 306 |
| 166 | 3300009093 | Ga0105240_10037272 | Ga0105240_100372724 | 306 |
| 167 | 3300009094 | Ga0111539_10106009 | Ga0111539_101060092 | 306 |
| 168 | 3300009545 | Ga0105237_10000843 | Ga0105237_1000084333 | 306 |
| 169 | 3300013102 | Ga0157371_10015105 | Ga0157371_100151055 | 306 |
| 170 | 3300013105 | Ga0157369_10001968 | Ga0157369_1000196812 | 306 |
| 171 | 3300013307 | Ga0157372_10004845 | Ga0157372_1000484510 | 306 |
| 172 | 3300013307 | Ga0157372_10090997 | Ga0157372_100909973 | 306 |
| 173 | 3300014745 | Ga0157377_10000074 | Ga0157377_1000007470 | 306 |
| 174 | 3300014968 | Ga0157379_10046382 | Ga0157379_100463822 | 306 |
| 175 | 3300025303 | Ga0209051_1004213 | Ga0209051_10042132 | 306 |
| 176 | 3300025321 | Ga0207656_10003975 | Ga0207656_100039754 | 306 |
| 177 | 3300025735 | Ga0207713_1029389 | Ga0207713_10293892 | 306 |
| 178 | 3300025885 | Ga0207653_10000894 | Ga0207653_1000089410 | 306 |
| 179 | 3300025908 | Ga0207643_10010983 | Ga0207643_100109834 | 306 |
| 180 | 3300025918 | Ga0207662_10151478 | Ga0207662_101514782 | 306 |
| 181 | 3300025932 | Ga0207690_10185748 | Ga0207690_101857482 | 306 |
| 182 | 3300025936 | Ga0207670_10001523 | Ga0207670_100015237 | 306 |
| 183 | 3300026035 | Ga0207703_10249169 | Ga0207703_102491692 | 306 |
| 184 | 3300026075 | Ga0207708_10084634 | Ga0207708_100846342 | 306 |
| 185 | 3300026088 | Ga0207641_10409312 | Ga0207641_104093122 | 306 |
| 186 | 3300026095 | Ga0207676_10014396 | Ga0207676_100143964 | 306 |
| 187 | 3300026116 | Ga0207674_10045026 | Ga0207674_100450262 | 306 |
| 188 | 3300026116 | Ga0207674_10047263 | Ga0207674_100472632 | 306 |
| 189 | 3300028380 | Ga0268265_10490876 | Ga0268265_104908762 | 306 |
| 190 | 3300028381 | Ga0268264_10105531 | Ga0268264_101055313 | 306 |
| 191 | 3300042876 | Ga0451577_0270866 | Ga0451577_0270866_340_1269 | 306 |
| 192 | 3300048916 | Ga0496113_0195818 | Ga0496113_0195818_607_1548 | 306 |
| 193 | 3300050507 | nmdc:mga05p37_113313_c1 | nmdc:mga05p37_113313_c1_1066_1998 | 306 |
| 194 | 3300050507 | nmdc:mga05p37_86867_c1 | nmdc:mga05p37_86867_c1_2390_3331 | 306 |
| 195 | 3300050511 | nmdc:mga08y16_186121_c1 | nmdc:mga08y16_186121_c1_535_1476 | 306 |
| 196 | 3300050511 | nmdc:mga08y16_79491_c1 | nmdc:mga08y16_79491_c1_2291_3226 | 306 |
| 197 | 3300050515 | nmdc:mga0a205_82339_c1 | nmdc:mga0a205_82339_c1_690_1637 | 306 |
| 198 | iso_pu_bacteria | 2510065053 | 2510282664 | 306 |
| 199 | iso_pu_bacteria | 2510065055 | 2510295318 | 306 |
| 200 | iso_pu_bacteria | 2510065058 | 2510311056 | 306 |
| 201 | iso_pu_bacteria | 2773857672 | 2774129151 | 306 |
| 202 | iso_pu_bacteria | 2917832318 | 2917833278 | 306 |
| 203 | iso_pu_bacteria | 2919125081 | 2919126182 | 306 |
| 204 | iso_pu_bacteria | 2974298342 | 2974302405 | 306 |
| 205 | iso_pu_bacteria | 2984499530 | 2984500042 | 306 |
| 206 | iso_pu_bacteria | 2984504281 | 2984506580 | 306 |
| 207 | iso_pu_bacteria | 8016728285 | 8016731400 | 306 |
| 208 | 2162886011 | MRS1b_contig_4046139 | MRS1b_0433.00002280 | 307 |
| 209 | 3300000532 | CNAas_1000687 | CNAas_10006872 | 307 |
| 210 | 3300000546 | LJNas_1000973 | LJNas_10009733 | 307 |
| 211 | 3300005288 | Ga0065714_10064425 | Ga0065714_10064425139 | 307 |
| 212 | 3300005289 | Ga0065704_10084316 | Ga0065704_100843162 | 307 |
| 213 | 3300005290 | Ga0065712_10067727 | Ga0065712_10067727141 | 307 |
| 214 | 3300005293 | Ga0065715_10000520 | Ga0065715_100005205 | 307 |
| 215 | 3300005293 | Ga0065715_10009366 | Ga0065715_100093662 | 307 |
| 216 | 3300005293 | Ga0065715_10122956 | Ga0065715_101229562 | 307 |
| 217 | 3300005295 | Ga0065707_10014475 | Ga0065707_100144751 | 307 |
| 218 | 3300005329 | Ga0070683_100136737 | Ga0070683_1001367372 | 307 |
| 219 | 3300005331 | Ga0070670_100000190 | Ga0070670_10000019017 | 307 |
| 220 | 3300005331 | Ga0070670_100107096 | Ga0070670_1001070962 | 307 |
| 221 | 3300005334 | Ga0068869_100071495 | Ga0068869_1000714951 | 307 |
| 222 | 3300005334 | Ga0068869_100143540 | Ga0068869_1001435402 | 307 |
| 223 | 3300005334 | Ga0068869_100159889 | Ga0068869_1001598892 | 307 |
| 224 | 3300005335 | Ga0070666_10038327 | Ga0070666_100383272 | 307 |
| 225 | 3300005336 | Ga0070680_100097092 | Ga0070680_1000970921 | 307 |
| 226 | 3300005336 | Ga0070680_100226177 | Ga0070680_1002261771 | 307 |
| 227 | 3300005337 | Ga0070682_100028147 | Ga0070682_1000281473 | 307 |
| 228 | 3300005338 | Ga0068868_100030083 | Ga0068868_1000300832 | 307 |
| 229 | 3300005343 | Ga0070687_100057980 | Ga0070687_1000579802 | 307 |
| 230 | 3300005344 | Ga0070661_100248856 | Ga0070661_1002488562 | 307 |
| 231 | 3300005353 | Ga0070669_100025253 | Ga0070669_1000252534 | 307 |
| 232 | 3300005353 | Ga0070669_100230629 | Ga0070669_1002306292 | 307 |
| 233 | 3300005354 | Ga0070675_100098253 | Ga0070675_1000982532 | 307 |
| 234 | 3300005354 | Ga0070675_100314201 | Ga0070675_1003142012 | 307 |
| 235 | 3300005355 | Ga0070671_100058154 | Ga0070671_1000581542 | 307 |
| 236 | 3300005364 | Ga0070673_100168728 | Ga0070673_1001687282 | 307 |
| 237 | 3300005366 | Ga0070659_100002688 | Ga0070659_1000026884 | 307 |
| 238 | 3300005367 | Ga0070667_100038272 | Ga0070667_1000382723 | 307 |
| 239 | 3300005434 | Ga0070709_10254185 | Ga0070709_102541851 | 307 |
| 240 | 3300005435 | Ga0070714_100178260 | Ga0070714_1001782602 | 307 |
| 241 | 3300005436 | Ga0070713_100065812 | Ga0070713_1000658122 | 307 |
| 242 | 3300005440 | Ga0070705_100160613 | Ga0070705_1001606132 | 307 |
| 243 | 3300005441 | Ga0070700_100000047 | Ga0070700_10000004717 | 307 |
| 244 | 3300005441 | Ga0070700_100017991 | Ga0070700_1000179912 | 307 |
| 245 | 3300005458 | Ga0070681_10000991 | Ga0070681_1000099112 | 307 |
| 246 | 3300005458 | Ga0070681_10019055 | Ga0070681_100190554 | 307 |
| 247 | 3300005458 | Ga0070681_10062988 | Ga0070681_100629883 | 307 |
| 248 | 3300005459 | Ga0068867_100066515 | Ga0068867_1000665151 | 307 |
| 249 | 3300005467 | Ga0070706_100000305 | Ga0070706_10000030519 | 307 |
| 250 | 3300005468 | Ga0070707_100003309 | Ga0070707_1000033092 | 307 |
| 251 | 3300005468 | Ga0070707_100030775 | Ga0070707_1000307754 | 307 |
| 252 | 3300005471 | Ga0070698_100030109 | Ga0070698_1000301093 | 307 |
| 253 | 3300005471 | Ga0070698_100055758 | Ga0070698_1000557584 | 307 |
| 254 | 3300005518 | Ga0070699_100000978 | Ga0070699_1000009782 | 307 |
| 255 | 3300005518 | Ga0070699_100052966 | Ga0070699_1000529663 | 307 |
| 256 | 3300005530 | Ga0070679_100131172 | Ga0070679_1001311722 | 307 |
| 257 | 3300005530 | Ga0070679_100159787 | Ga0070679_1001597872 | 307 |
| 258 | 3300005535 | Ga0070684_100000038 | Ga0070684_10000003824 | 307 |
| 259 | 3300005536 | Ga0070697_100171668 | Ga0070697_1001716681 | 307 |
| 260 | 3300005539 | Ga0068853_100024960 | Ga0068853_1000249603 | 307 |
| 261 | 3300005544 | Ga0070686_100159888 | Ga0070686_1001598882 | 307 |
| 262 | 3300005545 | Ga0070695_100055708 | Ga0070695_1000557082 | 307 |
| 263 | 3300005546 | Ga0070696_100115532 | Ga0070696_1001155322 | 307 |
| 264 | 3300005549 | Ga0070704_100063873 | Ga0070704_1000638734 | 307 |
| 265 | 3300005563 | Ga0068855_100043417 | Ga0068855_1000434171 | 307 |
| 266 | 3300005564 | Ga0070664_100002701 | Ga0070664_10000270110 | 307 |
| 267 | 3300005564 | Ga0070664_100056741 | Ga0070664_1000567412 | 307 |
| 268 | 3300005564 | Ga0070664_100076952 | Ga0070664_1000769523 | 307 |
| 269 | 3300005564 | Ga0070664_100531173 | Ga0070664_1005311731 | 307 |
| 270 | 3300005577 | Ga0068857_100003033 | Ga0068857_1000030336 | 307 |
| 271 | 3300005577 | Ga0068857_100028380 | Ga0068857_1000283802 | 307 |
| 272 | 3300005577 | Ga0068857_100234109 | Ga0068857_1002341092 | 307 |
| 273 | 3300005577 | Ga0068857_100240734 | Ga0068857_1002407341 | 307 |
| 274 | 3300005578 | Ga0068854_100260509 | Ga0068854_1002605092 | 307 |
| 275 | 3300005615 | Ga0070702_100003608 | Ga0070702_1000036086 | 307 |
| 276 | 3300005615 | Ga0070702_100224629 | Ga0070702_1002246292 | 307 |
| 277 | 3300005616 | Ga0068852_100040345 | Ga0068852_1000403452 | 307 |
| 278 | 3300005616 | Ga0068852_100072927 | Ga0068852_1000729272 | 307 |
| 279 | 3300005616 | Ga0068852_100143422 | Ga0068852_1001434222 | 307 |
| 280 | 3300005617 | Ga0068859_100006226 | Ga0068859_1000062262 | 307 |
| 281 | 3300005617 | Ga0068859_100009958 | Ga0068859_1000099587 | 307 |
| 282 | 3300005617 | Ga0068859_100019709 | Ga0068859_1000197098 | 307 |
| 283 | 3300005617 | Ga0068859_100023383 | Ga0068859_1000233836 | 307 |
| 284 | 3300005617 | Ga0068859_100028873 | Ga0068859_1000288734 | 307 |
| 285 | 3300005617 | Ga0068859_100060421 | Ga0068859_1000604215 | 307 |
| 286 | 3300005617 | Ga0068859_100080936 | Ga0068859_1000809364 | 307 |
| 287 | 3300005617 | Ga0068859_100376924 | Ga0068859_1003769242 | 307 |
| 288 | 3300005617 | Ga0068859_100528631 | Ga0068859_1005286312 | 307 |
| 289 | 3300005618 | Ga0068864_100060141 | Ga0068864_1000601411 | 307 |
| 290 | 3300005618 | Ga0068864_100060926 | Ga0068864_1000609262 | 307 |
| 291 | 3300005618 | Ga0068864_100216790 | Ga0068864_1002167901 | 307 |
| 292 | 3300005618 | Ga0068864_100264708 | Ga0068864_1002647082 | 307 |
| 293 | 3300005718 | Ga0068866_10130515 | Ga0068866_101305152 | 307 |
| 294 | 3300005719 | Ga0068861_100067771 | Ga0068861_1000677712 | 307 |
| 295 | 3300005719 | Ga0068861_100139309 | Ga0068861_1001393092 | 307 |
| 296 | 3300005719 | Ga0068861_100147422 | Ga0068861_1001474222 | 307 |
| 297 | 3300005841 | Ga0068863_100068757 | Ga0068863_1000687573 | 307 |
| 298 | 3300005841 | Ga0068863_100092211 | Ga0068863_1000922112 | 307 |
| 299 | 3300005841 | Ga0068863_100161928 | Ga0068863_1001619282 | 307 |
| 300 | 3300005842 | Ga0068858_100048925 | Ga0068858_1000489252 | 307 |
| 301 | 3300005842 | Ga0068858_100051777 | Ga0068858_1000517772 | 307 |
| 302 | 3300005842 | Ga0068858_100103386 | Ga0068858_1001033863 | 307 |
| 303 | 3300005842 | Ga0068858_100194295 | Ga0068858_1001942952 | 307 |
| 304 | 3300005843 | Ga0068860_100020977 | Ga0068860_1000209774 | 307 |
| 305 | 3300005843 | Ga0068860_100046626 | Ga0068860_1000466263 | 307 |
| 306 | 3300005843 | Ga0068860_100083605 | Ga0068860_1000836053 | 307 |
| 307 | 3300005843 | Ga0068860_100179005 | Ga0068860_1001790052 | 307 |
| 308 | 3300005843 | Ga0068860_100335564 | Ga0068860_1003355641 | 307 |
| 309 | 3300005844 | Ga0068862_100131999 | Ga0068862_1001319993 | 307 |
| 310 | 3300005985 | Ga0081539_10001529 | Ga0081539_1000152919 | 307 |
| 311 | 3300005985 | Ga0081539_10005669 | Ga0081539_100056694 | 307 |
| 312 | 3300005985 | Ga0081539_10018864 | Ga0081539_100188643 | 307 |
| 313 | 3300005985 | Ga0081539_10083112 | Ga0081539_100831122 | 307 |
| 314 | 3300006028 | Ga0070717_10073137 | Ga0070717_100731373 | 307 |
| 315 | 3300006028 | Ga0070717_10097272 | Ga0070717_100972722 | 307 |
| 316 | 3300006237 | Ga0097621_100005230 | Ga0097621_1000052304 | 307 |
| 317 | 3300006237 | Ga0097621_100010737 | Ga0097621_1000107376 | 307 |
| 318 | 3300006237 | Ga0097621_100037611 | Ga0097621_1000376114 | 307 |
| 319 | 3300006237 | Ga0097621_100047701 | Ga0097621_1000477013 | 307 |
| 320 | 3300006237 | Ga0097621_100192884 | Ga0097621_1001928842 | 307 |
| 321 | 3300006358 | Ga0068871_100019181 | Ga0068871_1000191813 | 307 |
| 322 | 3300006358 | Ga0068871_100044637 | Ga0068871_1000446372 | 307 |
| 323 | 3300006358 | Ga0068871_100070632 | Ga0068871_1000706322 | 307 |
| 324 | 3300006844 | Ga0075428_100071806 | Ga0075428_1000718061 | 307 |
| 325 | 3300006844 | Ga0075428_100497209 | Ga0075428_1004972092 | 307 |
| 326 | 3300006847 | Ga0075431_100460325 | Ga0075431_1004603251 | 307 |
| 327 | 3300006852 | Ga0075433_10088101 | Ga0075433_100881013 | 307 |
| 328 | 3300006852 | Ga0075433_10120465 | Ga0075433_101204652 | 307 |
| 329 | 3300006852 | Ga0075433_10178161 | Ga0075433_101781612 | 307 |
| 330 | 3300006871 | Ga0075434_100063142 | Ga0075434_1000631421 | 307 |
| 331 | 3300006871 | Ga0075434_100196361 | Ga0075434_1001963611 | 307 |
| 332 | 3300006871 | Ga0075434_100500056 | Ga0075434_1005000562 | 307 |
| 333 | 3300006880 | Ga0075429_100058672 | Ga0075429_1000586724 | 307 |
| 334 | 3300006880 | Ga0075429_100178375 | Ga0075429_1001783752 | 307 |
| 335 | 3300006881 | Ga0068865_100023803 | Ga0068865_1000238034 | 307 |
| 336 | 3300006914 | Ga0075436_100006391 | Ga0075436_1000063916 | 307 |
| 337 | 3300006914 | Ga0075436_100050778 | Ga0075436_1000507783 | 307 |
| 338 | 3300006914 | Ga0075436_100220045 | Ga0075436_1002200451 | 307 |
| 339 | 3300006931 | Ga0097620_100006226 | Ga0097620_1000062262 | 307 |
| 340 | 3300006931 | Ga0097620_100009957 | Ga0097620_1000099577 | 307 |
| 341 | 3300006931 | Ga0097620_100019709 | Ga0097620_1000197098 | 307 |
| 342 | 3300006931 | Ga0097620_100023383 | Ga0097620_1000233832 | 307 |
| 343 | 3300006931 | Ga0097620_100028871 | Ga0097620_1000288714 | 307 |
| 344 | 3300006931 | Ga0097620_100060422 | Ga0097620_1000604222 | 307 |
| 345 | 3300006931 | Ga0097620_100080935 | Ga0097620_1000809352 | 307 |
| 346 | 3300006931 | Ga0097620_100315517 | Ga0097620_1003155172 | 307 |
| 347 | 3300006931 | Ga0097620_100376934 | Ga0097620_1003769342 | 307 |
| 348 | 3300006931 | Ga0097620_100528607 | Ga0097620_1005286072 | 307 |
| 349 | 3300007076 | Ga0075435_100305126 | Ga0075435_1003051261 | 307 |
| 350 | 3300009011 | Ga0105251_10042756 | Ga0105251_100427562 | 307 |
| 351 | 3300009011 | Ga0105251_10115148 | Ga0105251_101151482 | 307 |
| 352 | 3300009011 | Ga0105251_10117009 | Ga0105251_101170092 | 307 |
| 353 | 3300009093 | Ga0105240_10122290 | Ga0105240_101222902 | 307 |
| 354 | 3300009093 | Ga0105240_10211213 | Ga0105240_102112132 | 307 |
| 355 | 3300009094 | Ga0111539_10024249 | Ga0111539_100242493 | 307 |
| 356 | 3300009094 | Ga0111539_10139405 | Ga0111539_101394053 | 307 |
| 357 | 3300009094 | Ga0111539_10409110 | Ga0111539_104091102 | 307 |
| 358 | 3300009098 | Ga0105245_10136474 | Ga0105245_101364741 | 307 |
| 359 | 3300009101 | Ga0105247_10001923 | Ga0105247_100019235 | 307 |
| 360 | 3300009147 | Ga0114129_10013535 | Ga0114129_100135357 | 307 |
| 361 | 3300009148 | Ga0105243_10002285 | Ga0105243_100022857 | 307 |
| 362 | 3300009148 | Ga0105243_10099965 | Ga0105243_100999652 | 307 |
| 363 | 3300009174 | Ga0105241_10021785 | Ga0105241_100217852 | 307 |
| 364 | 3300009174 | Ga0105241_10119423 | Ga0105241_101194232 | 307 |
| 365 | 3300009174 | Ga0105241_10138667 | Ga0105241_101386672 | 307 |
| 366 | 3300009174 | Ga0105241_10179691 | Ga0105241_101796912 | 307 |
| 367 | 3300009174 | Ga0105241_10246745 | Ga0105241_102467452 | 307 |
| 368 | 3300009176 | Ga0105242_10051934 | Ga0105242_100519344 | 307 |
| 369 | 3300009176 | Ga0105242_10122544 | Ga0105242_101225442 | 307 |
| 370 | 3300009176 | Ga0105242_10268931 | Ga0105242_102689313 | 307 |
| 371 | 3300009177 | Ga0105248_10008342 | Ga0105248_1000834212 | 307 |
| 372 | 3300009177 | Ga0105248_10026990 | Ga0105248_100269903 | 307 |
| 373 | 3300009177 | Ga0105248_10034742 | Ga0105248_100347422 | 307 |
| 374 | 3300009177 | Ga0105248_10038862 | Ga0105248_100388623 | 307 |
| 375 | 3300009177 | Ga0105248_10170110 | Ga0105248_101701102 | 307 |
| 376 | 3300009177 | Ga0105248_10207095 | Ga0105248_102070952 | 307 |
| 377 | 3300009177 | Ga0105248_10654933 | Ga0105248_106549331 | 307 |
| 378 | 3300009545 | Ga0105237_10028407 | Ga0105237_100284072 | 307 |
| 379 | 3300009545 | Ga0105237_10231625 | Ga0105237_102316252 | 307 |
| 380 | 3300009551 | Ga0105238_10000370 | Ga0105238_100003701 | 307 |
| 381 | 3300009551 | Ga0105238_10006520 | Ga0105238_100065202 | 307 |
| 382 | 3300009551 | Ga0105238_10013280 | Ga0105238_100132802 | 307 |
| 383 | 3300009553 | Ga0105249_10000844 | Ga0105249_1000084411 | 307 |
| 384 | 3300009553 | Ga0105249_10261993 | Ga0105249_102619932 | 307 |
| 385 | 3300009993 | Ga0105028_107051 | Ga0105028_1070512 | 307 |
| 386 | 3300010375 | Ga0105239_10040324 | Ga0105239_100403244 | 307 |
| 387 | 3300010375 | Ga0105239_10053571 | Ga0105239_100535714 | 307 |
| 388 | 3300010375 | Ga0105239_10124425 | Ga0105239_101244252 | 307 |
| 389 | 3300010375 | Ga0105239_10196306 | Ga0105239_101963062 | 307 |
| 390 | 3300011119 | Ga0105246_10151469 | Ga0105246_101514692 | 307 |
| 391 | 3300011119 | Ga0105246_10167253 | Ga0105246_101672532 | 307 |
| 392 | 3300013100 | Ga0157373_10071289 | Ga0157373_100712893 | 307 |
| 393 | 3300013100 | Ga0157373_10129172 | Ga0157373_101291723 | 307 |
| 394 | 3300013104 | Ga0157370_10055878 | Ga0157370_100558784 | 307 |
| 395 | 3300013104 | Ga0157370_10178711 | Ga0157370_101787112 | 307 |
| 396 | 3300013105 | Ga0157369_10016299 | Ga0157369_100162994 | 307 |
| 397 | 3300013105 | Ga0157369_10050147 | Ga0157369_100501474 | 307 |
| 398 | 3300013296 | Ga0157374_10052985 | Ga0157374_100529852 | 307 |
| 399 | 3300013296 | Ga0157374_10105404 | Ga0157374_101054042 | 307 |
| 400 | 3300013297 | Ga0157378_10003679 | Ga0157378_100036793 | 307 |
| 401 | 3300013297 | Ga0157378_10020058 | Ga0157378_100200584 | 307 |
| 402 | 3300013297 | Ga0157378_10174563 | Ga0157378_101745632 | 307 |
| 403 | 3300013297 | Ga0157378_10286708 | Ga0157378_102867082 | 307 |
| 404 | 3300013306 | Ga0163162_10004613 | Ga0163162_100046139 | 307 |
| 405 | 3300013306 | Ga0163162_10027304 | Ga0163162_100273044 | 307 |
| 406 | 3300013306 | Ga0163162_10043171 | Ga0163162_100431715 | 307 |
| 407 | 3300013307 | Ga0157372_10010935 | Ga0157372_100109357 | 307 |
| 408 | 3300013307 | Ga0157372_10215609 | Ga0157372_102156092 | 307 |
| 409 | 3300013307 | Ga0157372_10571390 | Ga0157372_105713902 | 307 |
| 410 | 3300013307 | Ga0157372_10880814 | Ga0157372_108808141 | 307 |
| 411 | 3300013308 | Ga0157375_10096948 | Ga0157375_100969482 | 307 |
| 412 | 3300013308 | Ga0157375_10674334 | Ga0157375_106743342 | 307 |
| 413 | 3300014325 | Ga0163163_10000209 | Ga0163163_1000020934 | 307 |
| 414 | 3300014325 | Ga0163163_10002342 | Ga0163163_100023424 | 307 |
| 415 | 3300014325 | Ga0163163_10004974 | Ga0163163_100049742 | 307 |
| 416 | 3300014325 | Ga0163163_10018160 | Ga0163163_100181602 | 307 |
| 417 | 3300014325 | Ga0163163_10048137 | Ga0163163_100481372 | 307 |
| 418 | 3300014325 | Ga0163163_10074278 | Ga0163163_100742782 | 307 |
| 419 | 3300014325 | Ga0163163_10094424 | Ga0163163_100944242 | 307 |
| 420 | 3300014325 | Ga0163163_10237341 | Ga0163163_102373412 | 307 |
| 421 | 3300014326 | Ga0157380_10382101 | Ga0157380_103821012 | 307 |
| 422 | 3300014745 | Ga0157377_10106824 | Ga0157377_101068242 | 307 |
| 423 | 3300014969 | Ga0157376_10061364 | Ga0157376_100613642 | 307 |
| 424 | 3300014969 | Ga0157376_10069379 | Ga0157376_100693792 | 307 |
| 425 | 3300015265 | Ga0182005_1000004 | Ga0182005_1000004131 | 307 |
| 426 | 3300017792 | Ga0163161_10012424 | Ga0163161_100124243 | 307 |
| 427 | 3300025315 | Ga0207697_10088546 | Ga0207697_100885462 | 307 |
| 428 | 3300025899 | Ga0207642_10048586 | Ga0207642_100485862 | 307 |
| 429 | 3300025900 | Ga0207710_10001516 | Ga0207710_100015166 | 307 |
| 430 | 3300025903 | Ga0207680_10018308 | Ga0207680_100183083 | 307 |
| 431 | 3300025903 | Ga0207680_10085754 | Ga0207680_100857543 | 307 |
| 432 | 3300025904 | Ga0207647_10003108 | Ga0207647_100031082 | 307 |
| 433 | 3300025904 | Ga0207647_10098742 | Ga0207647_100987422 | 307 |
| 434 | 3300025908 | Ga0207643_10040090 | Ga0207643_100400902 | 307 |
| 435 | 3300025908 | Ga0207643_10135635 | Ga0207643_101356352 | 307 |
| 436 | 3300025910 | Ga0207684_10000053 | Ga0207684_1000005345 | 307 |
| 437 | 3300025910 | Ga0207684_10031170 | Ga0207684_100311703 | 307 |
| 438 | 3300025911 | Ga0207654_10014038 | Ga0207654_100140382 | 307 |
| 439 | 3300025912 | Ga0207707_10000004 | Ga0207707_10000004183 | 307 |
| 440 | 3300025912 | Ga0207707_10009356 | Ga0207707_100093566 | 307 |
| 441 | 3300025912 | Ga0207707_10114856 | Ga0207707_101148562 | 307 |
| 442 | 3300025913 | Ga0207695_10111010 | Ga0207695_101110102 | 307 |
| 443 | 3300025913 | Ga0207695_10151287 | Ga0207695_101512872 | 307 |
| 444 | 3300025913 | Ga0207695_10194026 | Ga0207695_101940261 | 307 |
| 445 | 3300025914 | Ga0207671_10043459 | Ga0207671_100434592 | 307 |
| 446 | 3300025917 | Ga0207660_10002498 | Ga0207660_100024982 | 307 |
| 447 | 3300025917 | Ga0207660_10126680 | Ga0207660_101266803 | 307 |
| 448 | 3300025917 | Ga0207660_10126851 | Ga0207660_101268511 | 307 |
| 449 | 3300025918 | Ga0207662_10024050 | Ga0207662_100240503 | 307 |
| 450 | 3300025921 | Ga0207652_10000087 | Ga0207652_1000008713 | 307 |
| 451 | 3300025921 | Ga0207652_10127830 | Ga0207652_101278302 | 307 |
| 452 | 3300025921 | Ga0207652_10135206 | Ga0207652_101352062 | 307 |
| 453 | 3300025922 | Ga0207646_10069952 | Ga0207646_100699522 | 307 |
| 454 | 3300025922 | Ga0207646_10226594 | Ga0207646_102265942 | 307 |
| 455 | 3300025922 | Ga0207646_10352112 | Ga0207646_103521122 | 307 |
| 456 | 3300025924 | Ga0207694_10003790 | Ga0207694_100037909 | 307 |
| 457 | 3300025924 | Ga0207694_10025335 | Ga0207694_100253355 | 307 |
| 458 | 3300025924 | Ga0207694_10028730 | Ga0207694_100287302 | 307 |
| 459 | 3300025925 | Ga0207650_10000007 | Ga0207650_10000007247 | 307 |
| 460 | 3300025925 | Ga0207650_10150340 | Ga0207650_101503402 | 307 |
| 461 | 3300025925 | Ga0207650_10271164 | Ga0207650_102711641 | 307 |
| 462 | 3300025926 | Ga0207659_10067416 | Ga0207659_100674161 | 307 |
| 463 | 3300025926 | Ga0207659_10265038 | Ga0207659_102650382 | 307 |
| 464 | 3300025927 | Ga0207687_10075007 | Ga0207687_100750072 | 307 |
| 465 | 3300025928 | Ga0207700_10102017 | Ga0207700_101020172 | 307 |
| 466 | 3300025928 | Ga0207700_10235088 | Ga0207700_102350882 | 307 |
| 467 | 3300025928 | Ga0207700_10434474 | Ga0207700_104344742 | 307 |
| 468 | 3300025929 | Ga0207664_10017642 | Ga0207664_100176425 | 307 |
| 469 | 3300025929 | Ga0207664_10189094 | Ga0207664_101890941 | 307 |
| 470 | 3300025931 | Ga0207644_10353218 | Ga0207644_103532181 | 307 |
| 471 | 3300025932 | Ga0207690_10062705 | Ga0207690_100627052 | 307 |
| 472 | 3300025933 | Ga0207706_10010126 | Ga0207706_100101263 | 307 |
| 473 | 3300025933 | Ga0207706_10216847 | Ga0207706_102168472 | 307 |
| 474 | 3300025934 | Ga0207686_10234572 | Ga0207686_102345722 | 307 |
| 475 | 3300025936 | Ga0207670_10244760 | Ga0207670_102447602 | 307 |
| 476 | 3300025938 | Ga0207704_10296128 | Ga0207704_102961281 | 307 |
| 477 | 3300025940 | Ga0207691_10014923 | Ga0207691_100149235 | 307 |
| 478 | 3300025941 | Ga0207711_10028499 | Ga0207711_100284993 | 307 |
| 479 | 3300025941 | Ga0207711_10114592 | Ga0207711_101145922 | 307 |
| 480 | 3300025942 | Ga0207689_10014720 | Ga0207689_100147203 | 307 |
| 481 | 3300025942 | Ga0207689_10047043 | Ga0207689_100470434 | 307 |
| 482 | 3300025942 | Ga0207689_10064957 | Ga0207689_100649572 | 307 |
| 483 | 3300025942 | Ga0207689_10132329 | Ga0207689_101323291 | 307 |
| 484 | 3300025942 | Ga0207689_10135406 | Ga0207689_101354062 | 307 |
| 485 | 3300025942 | Ga0207689_10179110 | Ga0207689_101791101 | 307 |
| 486 | 3300025942 | Ga0207689_10265932 | Ga0207689_102659321 | 307 |
| 487 | 3300025944 | Ga0207661_10093237 | Ga0207661_100932372 | 307 |
| 488 | 3300025949 | Ga0207667_10127757 | Ga0207667_101277572 | 307 |
| 489 | 3300025949 | Ga0207667_10146617 | Ga0207667_101466172 | 307 |
| 490 | 3300025960 | Ga0207651_10102670 | Ga0207651_101026702 | 307 |
| 491 | 3300025960 | Ga0207651_10109126 | Ga0207651_101091262 | 307 |
| 492 | 3300025960 | Ga0207651_10349593 | Ga0207651_103495932 | 307 |
| 493 | 3300025961 | Ga0207712_10001401 | Ga0207712_100014016 | 307 |
| 494 | 3300025961 | Ga0207712_10096231 | Ga0207712_100962312 | 307 |
| 495 | 3300025981 | Ga0207640_10068539 | Ga0207640_100685392 | 307 |
| 496 | 3300026023 | Ga0207677_10333314 | Ga0207677_103333142 | 307 |
| 497 | 3300026035 | Ga0207703_10036835 | Ga0207703_100368355 | 307 |
| 498 | 3300026035 | Ga0207703_10169093 | Ga0207703_101690932 | 307 |
| 499 | 3300026041 | Ga0207639_10008033 | Ga0207639_100080333 | 307 |
| 500 | 3300026041 | Ga0207639_10144576 | Ga0207639_101445762 | 307 |
| 501 | 3300026041 | Ga0207639_10386214 | Ga0207639_103862142 | 307 |
| 502 | 3300026067 | Ga0207678_10402809 | Ga0207678_104028092 | 307 |
| 503 | 3300026075 | Ga0207708_10000113 | Ga0207708_1000011337 | 307 |
| 504 | 3300026075 | Ga0207708_10014216 | Ga0207708_100142162 | 307 |
| 505 | 3300026075 | Ga0207708_10024164 | Ga0207708_100241642 | 307 |
| 506 | 3300026075 | Ga0207708_10299722 | Ga0207708_102997222 | 307 |
| 507 | 3300026078 | Ga0207702_10024438 | Ga0207702_100244384 | 307 |
| 508 | 3300026078 | Ga0207702_10055061 | Ga0207702_100550614 | 307 |
| 509 | 3300026088 | Ga0207641_10051511 | Ga0207641_100515112 | 307 |
| 510 | 3300026088 | Ga0207641_10086461 | Ga0207641_100864612 | 307 |
| 511 | 3300026088 | Ga0207641_10270818 | Ga0207641_102708182 | 307 |
| 512 | 3300026089 | Ga0207648_10012132 | Ga0207648_100121323 | 307 |
| 513 | 3300026089 | Ga0207648_10032894 | Ga0207648_100328942 | 307 |
| 514 | 3300026089 | Ga0207648_10095808 | Ga0207648_100958081 | 307 |
| 515 | 3300026095 | Ga0207676_10003576 | Ga0207676_100035768 | 307 |
| 516 | 3300026095 | Ga0207676_10054349 | Ga0207676_100543492 | 307 |
| 517 | 3300026116 | Ga0207674_10009239 | Ga0207674_100092396 | 307 |
| 518 | 3300026116 | Ga0207674_10092481 | Ga0207674_100924812 | 307 |
| 519 | 3300026116 | Ga0207674_10205464 | Ga0207674_102054642 | 307 |
| 520 | 3300026116 | Ga0207674_10221059 | Ga0207674_102210592 | 307 |
| 521 | 3300026116 | Ga0207674_10258053 | Ga0207674_102580532 | 307 |
| 522 | 3300026118 | Ga0207675_100006726 | Ga0207675_1000067264 | 307 |
| 523 | 3300026118 | Ga0207675_100096602 | Ga0207675_1000966022 | 307 |
| 524 | 3300026142 | Ga0207698_10048609 | Ga0207698_100486092 | 307 |
| 525 | 3300026142 | Ga0207698_10125428 | Ga0207698_101254281 | 307 |
| 526 | 3300026142 | Ga0207698_10294575 | Ga0207698_102945752 | 307 |
| 527 | 3300027907 | Ga0207428_10009063 | Ga0207428_100090632 | 307 |
| 528 | 3300028379 | Ga0268266_10000140 | Ga0268266_10000140103 | 307 |
| 529 | 3300028380 | Ga0268265_10106379 | Ga0268265_101063792 | 307 |
| 530 | 3300028380 | Ga0268265_10402435 | Ga0268265_104024352 | 307 |
| 531 | 3300028381 | Ga0268264_10012975 | Ga0268264_100129755 | 307 |
| 532 | 3300028381 | Ga0268264_10043066 | Ga0268264_100430663 | 307 |
| 533 | 3300028381 | Ga0268264_10086297 | Ga0268264_100862971 | 307 |
| 534 | 3300028381 | Ga0268264_10097643 | Ga0268264_100976432 | 307 |
| 535 | 3300031249 | Ga0265339_10163154 | Ga0265339_101631541 | 307 |
| 536 | 3300031731 | Ga0307405_10033920 | Ga0307405_100339203 | 307 |
| 537 | 3300031852 | Ga0307410_10013753 | Ga0307410_100137532 | 307 |
| 538 | 3300031852 | Ga0307410_10329450 | Ga0307410_103294501 | 307 |
| 539 | 3300031901 | Ga0307406_10000949 | Ga0307406_100009497 | 307 |
| 540 | 3300032004 | Ga0307414_10149131 | Ga0307414_101491312 | 307 |
| 541 | 3300033179 | Ga0307507_10033999 | Ga0307507_100339993 | 307 |
| 542 | 3300035207 | Ga0373942_0002748 | Ga0373942_0002748_1865_3004 | 307 |
| 543 | 3300035691 | Ga0373931_0228514 | Ga0373931_0228514_144_1103 | 307 |
| 544 | 3300035724 | Ga0373933_0143295 | Ga0373933_0143295_236_1192 | 307 |
| 545 | 3300036401 | Ga0373937_0107331 | Ga0373937_0107331_1253_2200 | 307 |
| 546 | 3300036401 | Ga0373937_0568774 | Ga0373937_0568774_25_981 | 307 |
| 547 | 3300037068 | Ga0373925_0284996 | Ga0373925_0284996_242_1207 | 307 |
| 548 | 3300037853 | Ga0436364_0681300 | Ga0436364_0681300_198_1133 | 307 |
| 549 | 3300038443 | Ga0395901_0033779 | Ga0395901_0033779_1399_2355 | 307 |
| 550 | 3300038996 | Ga0242420_000456 | Ga0242420_000456_1600_2538 | 307 |
| 551 | 3300039438 | Ga0436360_0258342 | Ga0436360_0258342_81_1031 | 307 |
| 552 | 3300046473 | Ga0495582_0217886 | Ga0495582_0217886_18_965 | 307 |
| 553 | 3300046477 | Ga0495664_0083564 | Ga0495664_0083564_643_1599 | 307 |
| 554 | 3300046511 | Ga0495608_0017001 | Ga0495608_0017001_2506_3462 | 307 |
| 555 | 3300046683 | Ga0495658_0094808 | Ga0495658_0094808_403_1350 | 307 |
| 556 | 3300048906 | Ga0496103_0134844 | Ga0496103_0134844_322_1281 | 307 |
| 557 | 3300048907 | Ga0496104_0102634 | Ga0496104_0102634_1256_2215 | 307 |
| 558 | 3300048907 | Ga0496104_0200665 | Ga0496104_0200665_886_1836 | 307 |
| 559 | 3300048908 | Ga0496105_0145498 | Ga0496105_0145498_511_1470 | 307 |
| 560 | 3300048911 | Ga0496108_0161645 | Ga0496108_0161645_504_1442 | 307 |
| 561 | 3300048912 | Ga0496109_0541876 | Ga0496109_0541876_67_1026 | 307 |
| 562 | 3300048913 | Ga0496110_0246020 | Ga0496110_0246020_90_1040 | 307 |
| 563 | 3300048915 | Ga0496112_0056264 | Ga0496112_0056264_1087_2025 | 307 |
| 564 | 3300048915 | Ga0496112_0366656 | Ga0496112_0366656_427_1365 | 307 |
| 565 | 3300049515 | Ga0501292_008074 | Ga0501292_008074_234_1184 | 307 |
| 566 | 3300049521 | Ga0501298_008826 | Ga0501298_008826_730_1674 | 307 |
| 567 | 3300049522 | Ga0501299_009095 | Ga0501299_009095_53_1009 | 307 |
| 568 | 3300049588 | Ga0501072_0411049 | Ga0501072_0411049_23_976 | 307 |
| 569 | 3300049665 | Ga0501227_014912 | Ga0501227_014912_443_1393 | 307 |
| 570 | 3300049667 | Ga0501230_007695 | Ga0501230_007695_192_1142 | 307 |
| 571 | 3300049668 | Ga0501233_014619 | Ga0501233_014619_241_1191 | 307 |
| 572 | 3300049686 | Ga0501257_007104 | Ga0501257_007104_987_1928 | 307 |
| 573 | 3300049704 | Ga0501221_018094 | Ga0501221_018094_284_1234 | 307 |
| 574 | 3300049705 | Ga0501225_0000594 | Ga0501225_0000594_513_1454 | 307 |
| 575 | 3300049768 | Ga0501271_005834 | Ga0501271_005834_99_1049 | 307 |
| 576 | 3300049770 | Ga0501273_000997 | Ga0501273_000997_636_1586 | 307 |
| 577 | 3300049823 | Ga0501044_0001575 | Ga0501044_0001575_1615_2550 | 307 |
| 578 | 3300050508 | nmdc:mga09592_118706_c1 | nmdc:mga09592_118706_c1_256_1203 | 307 |
| 579 | 3300050508 | nmdc:mga09592_45617_c1 | nmdc:mga09592_45617_c1_708_1655 | 307 |
| 580 | 3300050511 | nmdc:mga08y16_232319_c1 | nmdc:mga08y16_232319_c1_318_1265 | 307 |
| 581 | 3300050511 | nmdc:mga08y16_2741_c1 | nmdc:mga08y16_2741_c1_16811_17791 | 307 |
| 582 | 3300050513 | nmdc:mga0rr50_32695_c1 | nmdc:mga0rr50_32695_c1_1008_1946 | 307 |
| 583 | 3300050515 | nmdc:mga0a205_5488_c1 | nmdc:mga0a205_5488_c1_8774_9754 | 307 |
| 584 | 3300050516 | nmdc:mga0sz30_130319_c1 | nmdc:mga0sz30_130319_c1_64_1014 | 307 |
| 585 | 3300053077 | Ga0495601_0000786 | Ga0495601_0000786_6429_7385 | 307 |
| 586 | 3300053084 | Ga0495595_0035117 | Ga0495595_0035117_374_1330 | 307 |
| 587 | 3300053085 | Ga0495619_0002942 | Ga0495619_0002942_9784_10740 | 307 |
| 588 | 3300054114 | Ga0501084_0207999 | Ga0501084_0207999_491_1444 | 307 |
| 589 | iso_pu_bacteria | 2687453257 | 2688066733 | 307 |
| 590 | iso_pu_bacteria | 2919085039 | 2919085466 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j9x-assembly1.cif.gz_B | crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline | 0.9879 | 2 | 307 |
| 4k7x-assembly1.cif.gz_A-2 | crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains | 0.9862 | 2 | 305 |
| 2azp-assembly1.cif.gz_A | crystal structure of pa1268 solved by sulfur sad | 0.9812 | 2 | 307 |
| 4j9x-assembly1.cif.gz_B | crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline | 0.9751 | 2 | 307 |
| 2azp-assembly1.cif.gz_A | crystal structure of pa1268 solved by sulfur sad | 0.9749 | 2 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jd7A01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9723 | 2 | 127 | 3.10.310.10 |
| af_D3ZV91_5_159_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9374 | 1 | 119 | 3.10.310.10 |
| af_Q868H8_133_298_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9334 | 128 | 270 | 3.10.310.10 |
| 4q60B02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9286 | 129 | 281 | 3.10.310.10 |
| af_A0A0G2L1A2_13_139_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9197 | 1 | 116 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X4UMG3-F1-model_v4 | 4-hydroxyproline epimerase (EC 5.1.1.8) | 0.9969 | 2 | 119 |
GO:0047580
|
| AF-A0A4Q3N3F3-F1-model_v4 | deleted | 0.9933 | 24 | 206 |
|
| AF-A0A351G0Y7-F1-model_v4 | Hydroxyproline-2-epimerase | 0.992 | 1 | 269 |
GO:0003824
|
| AF-A0A429M5E5-F1-model_v4 | Hydroxyproline-2-epimerase | 0.9917 | 86 | 231 |
GO:0047580
|
| AF-Q1QU06-F1-model_v4 | 4-hydroxyproline 2-epimerase (4Hyp 2-epimerase) (4HypE) (EC 5.1.1.8) | 0.9916 | 2 | 307 |
GO:0047580
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar