F466980

General Info

Members Datasets Scaffolds Average Seq Length
590 293 578 315

Family's Representative Sequence

Representative Sequence 3300035207|Ga0373942_0002748|Ga0373942_0002748_1865_3004
Length 379
Sequence MIMGRVLRFIMCSFAVSTCASIVPTRFGEYLRQIRLRRRRKFRQLAQKFNAIPAFVTFAPFCGSICRMRRVRVIDSHTGGEPTRVVISGGPDLGSDSLANRLERFRNDHDDFRCAVVNEPRGSDGVVGALLCAPVDESCVTGLIFFDRSGYLGMCGHGTIGVVTTLAHLNRIGPGNHRIETPVGIVVAHLNENGKVEVTNVPSYRLATNVTIDVPGIGPVTGDVAWGGNWFFLVNDHGQQLEFENIDRLLEFTLRVREALARAGITGADGHEIDHVELFGPSQLPGVNSKNFVLCPSKTYDRSPCGTGTSAKLACLFADGKLQEGQVWKQESIVGTVFEGTIKLVDNMVHPRIKGSAFITAEADLILDARDPFAMGIGR

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
6 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
7 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
8 2919085039 Luteibacter sp. 1214 Isolate Unclassified
9 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
10 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
11 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
12 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
13 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
14 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
267 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
268 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
272 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
273 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
274 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
275 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
276 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
279 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
293 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 3.05
Nodule 0
Rhizoplane 1.86
Rhizosphere 90.68
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4046139 2162886011 Bacteria 2216
2 CNAas_1000687 3300000532 Unclassified 3256
3 LJNas_1000973 3300000546 Bacteria 4564
4 JGI25156J39149_1000222 3300002705 Bacteria 39568
5 JGI25156J39149_1000835 3300002705 Bacteria 15565
6 JGI25154J39366_1002986 3300002738 Bacteria 3860
7 JGI25157J39369_1000056 3300002741 Bacteria 107681
8 JGI25157J39369_1000100 3300002741 Bacteria 73363
9 rootH1_10002255 3300003316 Bacteria 2358
10 Ga0055539_1000400 3300003752 Bacteria 16967
11 Ga0055533_1000080 3300003756 Bacteria 131291
12 Ga0055525_1001850 3300003759 Bacteria 2847
13 Ga0055535_1000357 3300003761 Bacteria 44443
14 Ga0055529_1000433 3300003763 Bacteria 42325
15 Ga0055529_1000772 3300003763 Bacteria 20105
16 Ga0065714_10064425 3300005288 Bacteria 189652
17 Ga0065704_10084316 3300005289 Bacteria 3349
18 Ga0065712_10067727 3300005290 Bacteria 189643
19 Ga0065715_10000520 3300005293 Bacteria 22337
20 Ga0065715_10009366 3300005293 Bacteria 2974
21 Ga0065715_10122956 3300005293 Bacteria 2184
22 Ga0065707_10014475 3300005295 Bacteria 2744
23 Ga0070658_10008509 3300005327 Bacteria 8249
24 Ga0070658_10023738 3300005327 Bacteria 4918
25 Ga0070658_10055663 3300005327 Bacteria 3214
26 Ga0070658_10391693 3300005327 Bacteria 1193
27 Ga0070676_10306289 3300005328 Bacteria 1079
28 Ga0070683_100136737 3300005329 Unclassified 2321
29 Ga0070690_100013982 3300005330 Bacteria 4759
30 Ga0070670_100000190 3300005331 Bacteria 56382
31 Ga0070670_100107096 3300005331 Bacteria 2409
32 Ga0068869_100071495 3300005334 Unclassified 2569
33 Ga0068869_100143540 3300005334 Bacteria 1846
34 Ga0068869_100159889 3300005334 Bacteria 1753
35 Ga0068869_100184643 3300005334 Bacteria 1636
36 Ga0070666_10038327 3300005335 Bacteria 3188
37 Ga0070680_100097092 3300005336 Unclassified 2443
38 Ga0070680_100226177 3300005336 Unclassified 1580
39 Ga0070682_100028147 3300005337 Bacteria 3378
40 Ga0068868_100030083 3300005338 Bacteria 4163
41 Ga0068868_100405157 3300005338 Bacteria 1178
42 Ga0070660_100194307 3300005339 Bacteria 1644
43 Ga0070689_100011690 3300005340 Bacteria 6299
44 Ga0070687_100057980 3300005343 Bacteria 2033
45 Ga0070661_100011670 3300005344 Bacteria 6125
46 Ga0070661_100248856 3300005344 Unclassified 1371
47 Ga0070692_10038186 3300005345 Bacteria 2446
48 Ga0070692_10084609 3300005345 Bacteria 1714
49 Ga0070669_100025253 3300005353 Bacteria 4267
50 Ga0070669_100230629 3300005353 Bacteria 1467
51 Ga0070675_100098253 3300005354 Bacteria 2462
52 Ga0070675_100314201 3300005354 Unclassified 1383
53 Ga0070671_100058154 3300005355 Bacteria 3219
54 Ga0070673_100003539 3300005364 Bacteria 9740
55 Ga0070673_100168728 3300005364 Bacteria 1867
56 Ga0070659_100002688 3300005366 Bacteria 12637
57 Ga0070659_100040156 3300005366 Bacteria 3655
58 Ga0070667_100038272 3300005367 Bacteria 4021
59 Ga0070703_10055496 3300005406 Bacteria 1280
60 Ga0070709_10254185 3300005434 Bacteria 1267
61 Ga0070714_100178260 3300005435 Bacteria 1932
62 Ga0070713_100003514 3300005436 Bacteria 10353
63 Ga0070713_100065812 3300005436 Unclassified 3046
64 Ga0070701_10245812 3300005438 Bacteria 1078
65 Ga0070705_100160613 3300005440 Bacteria 1502
66 Ga0070700_100000047 3300005441 Bacteria 90040
67 Ga0070700_100009101 3300005441 Bacteria 5442
68 Ga0070700_100017991 3300005441 Bacteria 4055
69 Ga0070694_100031779 3300005444 Bacteria 3463
70 Ga0070694_100053848 3300005444 Bacteria 2724
71 Ga0070662_100305608 3300005457 Bacteria 1293
72 Ga0070681_10000991 3300005458 Bacteria 24026
73 Ga0070681_10011837 3300005458 Bacteria 8647
74 Ga0070681_10019055 3300005458 Bacteria 6868
75 Ga0070681_10062988 3300005458 Unclassified 3681
76 Ga0068867_100066515 3300005459 Bacteria 2685
77 Ga0070706_100000305 3300005467 Bacteria 59523
78 Ga0070707_100003309 3300005468 Bacteria 15219
79 Ga0070707_100030775 3300005468 Bacteria 5112
80 Ga0070698_100030109 3300005471 Bacteria 5631
81 Ga0070698_100055758 3300005471 Bacteria 4005
82 Ga0070698_100366511 3300005471 Bacteria 1373
83 Ga0070699_100000978 3300005518 Bacteria 26634
84 Ga0070699_100052966 3300005518 Bacteria 3512
85 Ga0070679_100015571 3300005530 Bacteria 7307
86 Ga0070679_100131172 3300005530 Unclassified 2487
87 Ga0070679_100159787 3300005530 Bacteria 2228
88 Ga0070684_100000038 3300005535 Bacteria 94959
89 Ga0070697_100171668 3300005536 Bacteria 1835
90 Ga0068853_100024960 3300005539 Bacteria 5016
91 Ga0070686_100159888 3300005544 Bacteria 1586
92 Ga0070695_100055708 3300005545 Bacteria 2549
93 Ga0070696_100115532 3300005546 Bacteria 1937
94 Ga0070696_100309414 3300005546 Bacteria 1213
95 Ga0070704_100063873 3300005549 Bacteria 2644
96 Ga0070704_100101781 3300005549 Bacteria 2166
97 Ga0070704_100339459 3300005549 Bacteria 1264
98 Ga0068855_100004750 3300005563 Bacteria 16587
99 Ga0068855_100043417 3300005563 Bacteria 5325
100 Ga0068855_100238384 3300005563 Bacteria 2033
101 Ga0070664_100002701 3300005564 Bacteria 14318
102 Ga0070664_100052266 3300005564 Bacteria 3460
103 Ga0070664_100056741 3300005564 Bacteria 3327
104 Ga0070664_100076952 3300005564 Bacteria 2868
105 Ga0070664_100531173 3300005564 Bacteria 1087
106 Ga0068857_100001183 3300005577 Bacteria 20375
107 Ga0068857_100003033 3300005577 Bacteria 13888
108 Ga0068857_100018023 3300005577 Bacteria 6194
109 Ga0068857_100028380 3300005577 Bacteria 4938
110 Ga0068857_100055661 3300005577 Bacteria 3510
111 Ga0068857_100234109 3300005577 Bacteria 1680
112 Ga0068857_100240734 3300005577 Bacteria 1656
113 Ga0068857_100394094 3300005577 Bacteria 1288
114 Ga0068854_100045828 3300005578 Bacteria 3111
115 Ga0068854_100260509 3300005578 Unclassified 1388
116 Ga0068856_100000247 3300005614 Bacteria 58943
117 Ga0068856_100000722 3300005614 Bacteria 35876
118 Ga0070702_100003608 3300005615 Bacteria 6953
119 Ga0070702_100224629 3300005615 Bacteria 1258
120 Ga0070702_100250324 3300005615 Bacteria 1201
121 Ga0068852_100031067 3300005616 Bacteria 4402
122 Ga0068852_100040345 3300005616 Bacteria 3937
123 Ga0068852_100072927 3300005616 Bacteria 3019
124 Ga0068852_100143422 3300005616 Bacteria 2213
125 Ga0068859_100006226 3300005617 Bacteria 12112
126 Ga0068859_100009958 3300005617 Bacteria 9589
127 Ga0068859_100019709 3300005617 Bacteria 6774
128 Ga0068859_100023383 3300005617 Bacteria 6202
129 Ga0068859_100028873 3300005617 Bacteria 5563
130 Ga0068859_100034560 3300005617 Bacteria 5073
131 Ga0068859_100060421 3300005617 Unclassified 3819
132 Ga0068859_100080936 3300005617 Bacteria 3289
133 Ga0068859_100090560 3300005617 Bacteria 3110
134 Ga0068859_100376924 3300005617 Unclassified 1514
135 Ga0068859_100528631 3300005617 Bacteria 1274
136 Ga0068864_100005438 3300005618 Bacteria 10444
137 Ga0068864_100060141 3300005618 Bacteria 3289
138 Ga0068864_100060926 3300005618 Unclassified 3268
139 Ga0068864_100216790 3300005618 Bacteria 1764
140 Ga0068864_100264708 3300005618 Bacteria 1600
141 Ga0068866_10130515 3300005718 Bacteria 1428
142 Ga0068861_100067771 3300005719 Bacteria 2756
143 Ga0068861_100139309 3300005719 Bacteria 1978
144 Ga0068861_100147422 3300005719 Bacteria 1927
145 Ga0068861_100372781 3300005719 Bacteria 1258
146 Ga0068851_10006676 3300005834 Bacteria 5279
147 Ga0068863_100041372 3300005841 Bacteria 4382
148 Ga0068863_100068757 3300005841 Bacteria 3350
149 Ga0068863_100092211 3300005841 Bacteria 2874
150 Ga0068863_100161928 3300005841 Bacteria 2144
151 Ga0068858_100048925 3300005842 Bacteria 3916
152 Ga0068858_100051777 3300005842 Bacteria 3799
153 Ga0068858_100103386 3300005842 Bacteria 2657
154 Ga0068858_100194295 3300005842 Bacteria 1918
155 Ga0068858_100285068 3300005842 Bacteria 1573
156 Ga0068860_100020977 3300005843 Bacteria 6331
157 Ga0068860_100046626 3300005843 Bacteria 4132
158 Ga0068860_100083605 3300005843 Bacteria 3036
159 Ga0068860_100087101 3300005843 Bacteria 2973
160 Ga0068860_100179005 3300005843 Bacteria 2049
161 Ga0068860_100335564 3300005843 Bacteria 1486
162 Ga0068862_100075016 3300005844 Bacteria 2924
163 Ga0068862_100131999 3300005844 Bacteria 2210
164 Ga0068862_100158387 3300005844 Bacteria 2020
165 Ga0081455_10083166 3300005937 Bacteria 2616
166 Ga0081539_10001529 3300005985 Bacteria 38746
167 Ga0081539_10005669 3300005985 Bacteria 12532
168 Ga0081539_10018864 3300005985 Bacteria 4754
169 Ga0081539_10083112 3300005985 Unclassified 1677
170 Ga0070717_10073137 3300006028 Bacteria 2864
171 Ga0070717_10097272 3300006028 Bacteria 2494
172 Ga0097621_100005230 3300006237 Bacteria 9125
173 Ga0097621_100010737 3300006237 Bacteria 6716
174 Ga0097621_100037611 3300006237 Bacteria 3880
175 Ga0097621_100047701 3300006237 Bacteria 3472
176 Ga0097621_100192884 3300006237 Bacteria 1765
177 Ga0068871_100019181 3300006358 Bacteria 5219
178 Ga0068871_100044637 3300006358 Bacteria 3566
179 Ga0068871_100070632 3300006358 Bacteria 2870
180 Ga0075428_100071806 3300006844 Bacteria 3783
181 Ga0075428_100497209 3300006844 Bacteria 1305
182 Ga0075431_100460325 3300006847 Bacteria 1267
183 Ga0075433_10088101 3300006852 Bacteria 2742
184 Ga0075433_10120465 3300006852 Bacteria 2330
185 Ga0075433_10178161 3300006852 Bacteria 1891
186 Ga0075434_100063142 3300006871 Bacteria 3686
187 Ga0075434_100196361 3300006871 Bacteria 2038
188 Ga0075434_100500056 3300006871 Bacteria 1237
189 Ga0075429_100058672 3300006880 Bacteria 3352
190 Ga0075429_100178375 3300006880 Bacteria 1861
191 Ga0068865_100023803 3300006881 Bacteria 4014
192 Ga0075436_100006391 3300006914 Bacteria 8076
193 Ga0075436_100050778 3300006914 Bacteria 2862
194 Ga0075436_100220045 3300006914 Bacteria 1347
195 Ga0097620_100006226 3300006931 Bacteria 12112
196 Ga0097620_100009957 3300006931 Bacteria 9589
197 Ga0097620_100019709 3300006931 Bacteria 6774
198 Ga0097620_100023383 3300006931 Bacteria 6202
199 Ga0097620_100028871 3300006931 Bacteria 5563
200 Ga0097620_100034558 3300006931 Bacteria 5073
201 Ga0097620_100060422 3300006931 Unclassified 3819
202 Ga0097620_100080935 3300006931 Bacteria 3289
203 Ga0097620_100090559 3300006931 Bacteria 3110
204 Ga0097620_100315517 3300006931 Bacteria 1657
205 Ga0097620_100376934 3300006931 Unclassified 1514
206 Ga0097620_100528607 3300006931 Bacteria 1274
207 Ga0075435_100305126 3300007076 Bacteria 1362
208 Ga0105251_10004327 3300009011 Bacteria 9721
209 Ga0105251_10042756 3300009011 Bacteria 2196
210 Ga0105251_10115148 3300009011 Bacteria 1223
211 Ga0105251_10117009 3300009011 Bacteria 1212
212 Ga0105244_10020684 3300009036 Bacteria 3652
213 Ga0105240_10037272 3300009093 Bacteria 6250
214 Ga0105240_10049969 3300009093 Bacteria 5275
215 Ga0105240_10122290 3300009093 Bacteria 3132
216 Ga0105240_10211213 3300009093 Bacteria 2268
217 Ga0111539_10024249 3300009094 Bacteria 7449
218 Ga0111539_10106009 3300009094 Bacteria 3297
219 Ga0111539_10139405 3300009094 Bacteria 2840
220 Ga0111539_10409110 3300009094 Bacteria 1580
221 Ga0105245_10136474 3300009098 Bacteria 2306
222 Ga0105247_10001923 3300009101 Bacteria 14491
223 Ga0114129_10013535 3300009147 Bacteria 11626
224 Ga0105243_10000144 3300009148 Bacteria 81484
225 Ga0105243_10002285 3300009148 Bacteria 16071
226 Ga0105243_10099965 3300009148 Bacteria 2406
227 Ga0105241_10021785 3300009174 Bacteria 4742
228 Ga0105241_10119423 3300009174 Bacteria 2121
229 Ga0105241_10138667 3300009174 Bacteria 1978
230 Ga0105241_10179691 3300009174 Bacteria 1754
231 Ga0105241_10246745 3300009174 Unclassified 1512
232 Ga0105242_10051934 3300009176 Bacteria 3343
233 Ga0105242_10122544 3300009176 Bacteria 2234
234 Ga0105242_10268931 3300009176 Bacteria 1543
235 Ga0105242_10326998 3300009176 Bacteria 1408
236 Ga0105248_10008342 3300009177 Bacteria 11380
237 Ga0105248_10026990 3300009177 Bacteria 6387
238 Ga0105248_10034742 3300009177 Bacteria 5641
239 Ga0105248_10038862 3300009177 Bacteria 5328
240 Ga0105248_10170110 3300009177 Bacteria 2456
241 Ga0105248_10207095 3300009177 Bacteria 2210
242 Ga0105248_10654933 3300009177 Bacteria 1185
243 Ga0105237_10000843 3300009545 Bacteria 41798
244 Ga0105237_10028407 3300009545 Bacteria 5698
245 Ga0105237_10231625 3300009545 Bacteria 1848
246 Ga0105238_10000370 3300009551 Bacteria 48257
247 Ga0105238_10006520 3300009551 Bacteria 11616
248 Ga0105238_10013280 3300009551 Bacteria 8312
249 Ga0105249_10000844 3300009553 Bacteria 27423
250 Ga0105249_10261993 3300009553 Bacteria 1718
251 Ga0105028_107051 3300009993 Bacteria 1173
252 Ga0105239_10040324 3300010375 Bacteria 5116
253 Ga0105239_10053571 3300010375 Bacteria 4425
254 Ga0105239_10124425 3300010375 Bacteria 2865
255 Ga0105239_10196306 3300010375 Bacteria 2260
256 Ga0105239_10401014 3300010375 Bacteria 1552
257 Ga0105246_10151469 3300011119 Bacteria 1756
258 Ga0105246_10167253 3300011119 Bacteria 1681
259 Ga0157373_10026181 3300013100 Bacteria 4215
260 Ga0157373_10071289 3300013100 Unclassified 2454
261 Ga0157373_10129172 3300013100 Unclassified 1777
262 Ga0157371_10015105 3300013102 Bacteria 5804
263 Ga0157370_10007038 3300013104 Bacteria 12279
264 Ga0157370_10055878 3300013104 Bacteria 3759
265 Ga0157370_10178711 3300013104 Bacteria 1972
266 Ga0157369_10000401 3300013105 Bacteria 57752
267 Ga0157369_10001968 3300013105 Bacteria 24775
268 Ga0157369_10016299 3300013105 Bacteria 8365
269 Ga0157369_10050147 3300013105 Bacteria 4522
270 Ga0157369_10113789 3300013105 Bacteria 2874
271 Ga0157369_10276000 3300013105 Bacteria 1751
272 Ga0157374_10008732 3300013296 Bacteria 8669
273 Ga0157374_10052985 3300013296 Unclassified 3781
274 Ga0157374_10105404 3300013296 Bacteria 2708
275 Ga0157378_10003679 3300013297 Bacteria 13600
276 Ga0157378_10020058 3300013297 Bacteria 5879
277 Ga0157378_10174563 3300013297 Bacteria 2018
278 Ga0157378_10194758 3300013297 Bacteria 1914
279 Ga0157378_10286708 3300013297 Unclassified 1589
280 Ga0163162_10004613 3300013306 Bacteria 13279
281 Ga0163162_10027304 3300013306 Bacteria 5644
282 Ga0163162_10043171 3300013306 Bacteria 4514
283 Ga0157372_10004845 3300013307 Bacteria 14308
284 Ga0157372_10010935 3300013307 Bacteria 9659
285 Ga0157372_10072929 3300013307 Bacteria 3869
286 Ga0157372_10090997 3300013307 Bacteria 3470
287 Ga0157372_10170897 3300013307 Bacteria 2515
288 Ga0157372_10215609 3300013307 Bacteria 2225
289 Ga0157372_10571390 3300013307 Bacteria 1318
290 Ga0157372_10880814 3300013307 Bacteria 1039
291 Ga0157375_10096948 3300013308 Bacteria 3022
292 Ga0157375_10113584 3300013308 Bacteria 2809
293 Ga0157375_10674334 3300013308 Bacteria 1189
294 Ga0163163_10000209 3300014325 Bacteria 60592
295 Ga0163163_10002342 3300014325 Bacteria 16028
296 Ga0163163_10004974 3300014325 Bacteria 11444
297 Ga0163163_10018160 3300014325 Bacteria 6576
298 Ga0163163_10048137 3300014325 Bacteria 4191
299 Ga0163163_10074278 3300014325 Bacteria 3392
300 Ga0163163_10094424 3300014325 Bacteria 3009
301 Ga0163163_10237341 3300014325 Bacteria 1873
302 Ga0157380_10023612 3300014326 Bacteria 4641
303 Ga0157380_10382101 3300014326 Bacteria 1329
304 Ga0157377_10000074 3300014745 Bacteria 77443
305 Ga0157377_10106824 3300014745 Bacteria 1677
306 Ga0157379_10046382 3300014968 Bacteria 3876
307 Ga0157376_10061364 3300014969 Bacteria 3160
308 Ga0157376_10069379 3300014969 Bacteria 2988
309 Ga0182005_1000004 3300015265 Bacteria 609645
310 Ga0163161_10012424 3300017792 Bacteria 5913
311 Ga0209674_100003 3300025226 Bacteria 2196646
312 Ga0209563_100049 3300025230 Bacteria 358472
313 Ga0207427_101398 3300025231 Bacteria 8819
314 Ga0209258_100189 3300025242 Bacteria 128268
315 Ga0209646_1000124 3300025246 Bacteria 138207
316 Ga0209026_1000085 3300025250 Bacteria 185778
317 Ga0209677_100135 3300025253 Bacteria 69251
318 Ga0209677_100203 3300025253 Bacteria 47561
319 Ga0209677_103161 3300025253 Bacteria 5556
320 Ga0209759_1000068 3300025256 Bacteria 183479
321 Ga0209759_1000729 3300025256 Bacteria 28835
322 Ga0209759_1002917 3300025256 Bacteria 7174
323 Ga0209759_1010734 3300025256 Bacteria 2662
324 Ga0209455_1000092 3300025272 Bacteria 220516
325 Ga0209051_1004213 3300025303 Bacteria 8973
326 Ga0207697_10088546 3300025315 Bacteria 1310
327 Ga0207656_10003975 3300025321 Bacteria 5122
328 Ga0207713_1029389 3300025735 Bacteria 2463
329 Ga0207653_10000894 3300025885 Bacteria 9903
330 Ga0207642_10048586 3300025899 Bacteria 1903
331 Ga0207710_10001516 3300025900 Bacteria 11506
332 Ga0207680_10018308 3300025903 Bacteria 3721
333 Ga0207680_10085754 3300025903 Bacteria 1990
334 Ga0207647_10003108 3300025904 Bacteria 12466
335 Ga0207647_10098742 3300025904 Bacteria 1735
336 Ga0207645_10041276 3300025907 Bacteria 2954
337 Ga0207643_10010983 3300025908 Bacteria 4886
338 Ga0207643_10040090 3300025908 Bacteria 2636
339 Ga0207643_10135635 3300025908 Bacteria 1467
340 Ga0207705_10010139 3300025909 Bacteria 6857
341 Ga0207705_10043903 3300025909 Bacteria 3211
342 Ga0207684_10000053 3300025910 Bacteria 225260
343 Ga0207684_10031170 3300025910 Bacteria 4538
344 Ga0207654_10014038 3300025911 Bacteria 4132
345 Ga0207707_10000004 3300025912 Bacteria 391281
346 Ga0207707_10009356 3300025912 Bacteria 8498
347 Ga0207707_10114856 3300025912 Bacteria 2353
348 Ga0207695_10024272 3300025913 Bacteria 6827
349 Ga0207695_10111010 3300025913 Bacteria 2721
350 Ga0207695_10151287 3300025913 Bacteria 2260
351 Ga0207695_10194026 3300025913 Bacteria 1947
352 Ga0207671_10043459 3300025914 Bacteria 3323
353 Ga0207660_10002498 3300025917 Bacteria 12095
354 Ga0207660_10126680 3300025917 Unclassified 1940
355 Ga0207660_10126851 3300025917 Unclassified 1938
356 Ga0207662_10024050 3300025918 Bacteria 3505
357 Ga0207662_10151478 3300025918 Bacteria 1475
358 Ga0207657_10084610 3300025919 Bacteria 2658
359 Ga0207652_10000087 3300025921 Bacteria 99945
360 Ga0207652_10008111 3300025921 Bacteria 8432
361 Ga0207652_10127830 3300025921 Bacteria 2264
362 Ga0207652_10135206 3300025921 Unclassified 2201
363 Ga0207646_10069952 3300025922 Bacteria 3134
364 Ga0207646_10226594 3300025922 Bacteria 1688
365 Ga0207646_10352112 3300025922 Bacteria 1331
366 Ga0207694_10003790 3300025924 Bacteria 11963
367 Ga0207694_10025335 3300025924 Bacteria 4508
368 Ga0207694_10028730 3300025924 Bacteria 4241
369 Ga0207650_10000007 3300025925 Bacteria 530810
370 Ga0207650_10150340 3300025925 Bacteria 1837
371 Ga0207650_10271164 3300025925 Bacteria 1379
372 Ga0207659_10067416 3300025926 Bacteria 2599
373 Ga0207659_10137334 3300025926 Bacteria 1894
374 Ga0207659_10265038 3300025926 Bacteria 1399
375 Ga0207687_10075007 3300025927 Bacteria 2426
376 Ga0207700_10102017 3300025928 Bacteria 2290
377 Ga0207700_10108400 3300025928 Bacteria 2230
378 Ga0207700_10235088 3300025928 Bacteria 1560
379 Ga0207700_10434474 3300025928 Unclassified 1155
380 Ga0207664_10017642 3300025929 Bacteria 5238
381 Ga0207664_10189094 3300025929 Bacteria 1771
382 Ga0207644_10353218 3300025931 Bacteria 1194
383 Ga0207690_10045759 3300025932 Bacteria 2893
384 Ga0207690_10062705 3300025932 Unclassified 2532
385 Ga0207690_10090434 3300025932 Bacteria 2161
386 Ga0207690_10185748 3300025932 Bacteria 1568
387 Ga0207706_10010126 3300025933 Bacteria 8632
388 Ga0207706_10216847 3300025933 Bacteria 1676
389 Ga0207686_10234572 3300025934 Bacteria 1332
390 Ga0207686_10257850 3300025934 Bacteria 1277
391 Ga0207670_10001523 3300025936 Bacteria 12188
392 Ga0207670_10244760 3300025936 Bacteria 1383
393 Ga0207704_10296128 3300025938 Bacteria 1237
394 Ga0207691_10014923 3300025940 Bacteria 7402
395 Ga0207711_10028499 3300025941 Unclassified 4699
396 Ga0207711_10114592 3300025941 Bacteria 2401
397 Ga0207689_10014720 3300025942 Bacteria 6643
398 Ga0207689_10047043 3300025942 Bacteria 3564
399 Ga0207689_10048650 3300025942 Bacteria 3498
400 Ga0207689_10064957 3300025942 Bacteria 3002
401 Ga0207689_10132329 3300025942 Bacteria 2053
402 Ga0207689_10135406 3300025942 Bacteria 2028
403 Ga0207689_10179110 3300025942 Bacteria 1748
404 Ga0207689_10265932 3300025942 Bacteria 1419
405 Ga0207661_10093237 3300025944 Unclassified 2513
406 Ga0207667_10002685 3300025949 Bacteria 22003
407 Ga0207667_10074935 3300025949 Bacteria 3514
408 Ga0207667_10127757 3300025949 Bacteria 2618
409 Ga0207667_10146617 3300025949 Bacteria 2430
410 Ga0207651_10082845 3300025960 Bacteria 2317
411 Ga0207651_10102670 3300025960 Bacteria 2126
412 Ga0207651_10109126 3300025960 Bacteria 2073
413 Ga0207651_10349593 3300025960 Bacteria 1244
414 Ga0207712_10001401 3300025961 Bacteria 16456
415 Ga0207712_10096231 3300025961 Bacteria 2191
416 Ga0207640_10035617 3300025981 Bacteria 3116
417 Ga0207640_10068539 3300025981 Bacteria 2378
418 Ga0207677_10333314 3300026023 Bacteria 1265
419 Ga0207703_10036835 3300026035 Bacteria 3895
420 Ga0207703_10169093 3300026035 Bacteria 1921
421 Ga0207703_10249169 3300026035 Bacteria 1600
422 Ga0207639_10008033 3300026041 Bacteria 7212
423 Ga0207639_10144576 3300026041 Bacteria 1985
424 Ga0207639_10386214 3300026041 Bacteria 1258
425 Ga0207678_10402809 3300026067 Unclassified 1185
426 Ga0207708_10000113 3300026075 Bacteria 62692
427 Ga0207708_10014216 3300026075 Bacteria 5952
428 Ga0207708_10024164 3300026075 Bacteria 4596
429 Ga0207708_10084634 3300026075 Bacteria 2438
430 Ga0207708_10299722 3300026075 Bacteria 1307
431 Ga0207702_10000235 3300026078 Bacteria 64091
432 Ga0207702_10001127 3300026078 Bacteria 27289
433 Ga0207702_10024438 3300026078 Bacteria 5014
434 Ga0207702_10055061 3300026078 Bacteria 3373
435 Ga0207641_10051511 3300026088 Unclassified 3487
436 Ga0207641_10086461 3300026088 Bacteria 2734
437 Ga0207641_10270818 3300026088 Bacteria 1593
438 Ga0207641_10409312 3300026088 Bacteria 1304
439 Ga0207648_10012132 3300026089 Bacteria 8080
440 Ga0207648_10032894 3300026089 Bacteria 4576
441 Ga0207648_10095808 3300026089 Unclassified 2596
442 Ga0207676_10003576 3300026095 Bacteria 10980
443 Ga0207676_10014396 3300026095 Bacteria 5690
444 Ga0207676_10054349 3300026095 Bacteria 3138
445 Ga0207674_10003076 3300026116 Bacteria 20639
446 Ga0207674_10009239 3300026116 Bacteria 11299
447 Ga0207674_10045026 3300026116 Bacteria 4541
448 Ga0207674_10047263 3300026116 Bacteria 4413
449 Ga0207674_10050907 3300026116 Bacteria 4228
450 Ga0207674_10092481 3300026116 Bacteria 3014
451 Ga0207674_10205464 3300026116 Bacteria 1919
452 Ga0207674_10221059 3300026116 Bacteria 1842
453 Ga0207674_10258053 3300026116 Bacteria 1690
454 Ga0207674_10365984 3300026116 Bacteria 1394
455 Ga0207675_100006726 3300026118 Bacteria 10871
456 Ga0207675_100096602 3300026118 Bacteria 2782
457 Ga0207683_10247172 3300026121 Bacteria 1627
458 Ga0207698_10048609 3300026142 Bacteria 3222
459 Ga0207698_10116362 3300026142 Bacteria 2253
460 Ga0207698_10125428 3300026142 Bacteria 2182
461 Ga0207698_10294575 3300026142 Bacteria 1508
462 Ga0207428_10009063 3300027907 Bacteria 8949
463 Ga0268266_10000140 3300028379 Bacteria 140387
464 Ga0268265_10106379 3300028380 Bacteria 2279
465 Ga0268265_10402435 3300028380 Bacteria 1266
466 Ga0268265_10490876 3300028380 Bacteria 1155
467 Ga0268264_10012975 3300028381 Bacteria 6851
468 Ga0268264_10043066 3300028381 Bacteria 3739
469 Ga0268264_10086297 3300028381 Bacteria 2696
470 Ga0268264_10097643 3300028381 Bacteria 2547
471 Ga0268264_10105531 3300028381 Bacteria 2458
472 Ga0265336_10000006 3300028666 Bacteria 348453
473 Ga0307515_10097879 3300028794 Bacteria 3580
474 Ga0265324_10001517 3300029957 Bacteria 13111
475 Ga0265339_10163154 3300031249 Eukaryota 1120
476 Ga0307513_10115348 3300031456 Bacteria 2668
477 Ga0307516_10001445 3300031730 Bacteria 32809
478 Ga0307405_10033920 3300031731 Bacteria 3033
479 Ga0307410_10013753 3300031852 Bacteria 4736
480 Ga0307410_10329450 3300031852 Bacteria 1214
481 Ga0307406_10000949 3300031901 Bacteria 16238
482 Ga0307414_10149131 3300032004 Bacteria 1842
483 Ga0307507_10033999 3300033179 Bacteria 5279
484 Ga0373939_0044473 3300035114 Bacteria 1352
485 Ga0373942_0002748 3300035207 Bacteria 4202
486 Ga0373931_0228514 3300035691 Bacteria 1123
487 Ga0373935_0213960 3300035692 Bacteria 1336
488 Ga0373933_0143295 3300035724 Bacteria 1510
489 Ga0373937_0107331 3300036401 Bacteria 2596
490 Ga0373937_0568774 3300036401 Bacteria 1077
491 Ga0373925_0284996 3300037068 Bacteria 1331
492 Ga0395898_0123374 3300037466 Bacteria 2482
493 Ga0395905_0221084 3300037471 Bacteria 1772
494 Ga0436364_0681300 3300037853 Bacteria 3923
495 Ga0436364_1343081 3300037853 Bacteria 2671
496 Ga0395901_0033779 3300038443 Bacteria 5282
497 Ga0395901_0566583 3300038443 Bacteria 1149
498 Ga0242420_000456 3300038996 Bacteria 4628
499 Ga0436360_0258342 3300039438 Bacteria 1360
500 Ga0451577_0087014 3300042876 Bacteria 2788
501 Ga0451577_0270866 3300042876 Bacteria 1538
502 Ga0466969_0002921 3300044656 Bacteria 9118
503 Ga0466965_0003825 3300044683 Bacteria 6644
504 Ga0466966_0008102 3300044684 Bacteria 6966
505 Ga0466961_0037377 3300044693 Bacteria 3114
506 Ga0466964_0004764 3300044706 Bacteria 5016
507 Ga0466957_0020261 3300044842 Bacteria 3914
508 Ga0466959_0002303 3300045049 Bacteria 12179
509 Ga0451576_0016127 3300045051 Bacteria 8255
510 Ga0451576_0150474 3300045051 Bacteria 2427
511 Ga0451576_0458258 3300045051 Bacteria 1339
512 Ga0495582_0217886 3300046473 Bacteria 1092
513 Ga0495582_0341192 3300046473 Bacteria 862
514 Ga0495639_0011388 3300046475 Bacteria 3835
515 Ga0495639_0050284 3300046475 Bacteria 1893
516 Ga0495664_0083564 3300046477 Bacteria 1916
517 Ga0495583_0000224 3300046506 Bacteria 95810
518 Ga0495606_0001614 3300046507 Bacteria 29404
519 Ga0495608_0017001 3300046511 Bacteria 5032
520 Ga0495616_0007064 3300046513 Bacteria 6745
521 Ga0495630_0000667 3300046517 Bacteria 24749
522 Ga0495625_0031520 3300046660 Bacteria 3942
523 Ga0495635_0040140 3300046663 Bacteria 3235
524 Ga0495646_0188281 3300046680 Bacteria 1129
525 Ga0495658_0094808 3300046683 Bacteria 1773
526 Ga0495669_0007294 3300046684 Bacteria 4632
527 Ga0495624_0004031 3300046690 Bacteria 10804
528 Ga0495649_0002245 3300046694 Bacteria 13726
529 Ga0495589_0027344 3300046794 Bacteria 2884
530 Ga0495581_0033187 3300047315 Bacteria 2989
531 Ga0495676_0188098 3300047321 Bacteria 1442
532 Ga0495675_0302149 3300047444 Bacteria 950
533 Ga0495684_0006627 3300047471 Bacteria 8982
534 Ga0495686_0024061 3300047472 Bacteria 4005
535 Ga0496103_0134844 3300048906 Bacteria 1578
536 Ga0496104_0102634 3300048907 Bacteria 2739
537 Ga0496104_0200665 3300048907 Bacteria 1907
538 Ga0496105_0145498 3300048908 Bacteria 1949
539 Ga0496108_0161645 3300048911 Bacteria 1936
540 Ga0496109_0541876 3300048912 Bacteria 1098
541 Ga0496110_0246020 3300048913 Bacteria 1628
542 Ga0496112_0056264 3300048915 Bacteria 3871
543 Ga0496112_0060783 3300048915 Bacteria 3724
544 Ga0496112_0366656 3300048915 Bacteria 1382
545 Ga0496113_0195818 3300048916 Bacteria 1605
546 Ga0501292_008074 3300049515 Bacteria 1531
547 Ga0501298_008826 3300049521 Bacteria 1702
548 Ga0501299_009095 3300049522 Bacteria 1630
549 Ga0501070_0253588 3300049586 Bacteria 1439
550 Ga0501072_0411049 3300049588 Bacteria 1073
551 Ga0501227_014912 3300049665 Bacteria 1731
552 Ga0501230_007695 3300049667 Bacteria 1606
553 Ga0501233_014619 3300049668 Bacteria 1606
554 Ga0501257_007104 3300049686 Bacteria 2497
555 Ga0501221_018094 3300049704 Bacteria 1353
556 Ga0501225_0000594 3300049705 Bacteria 11294
557 Ga0501080_0031731 3300049742 Bacteria 4923
558 Ga0501271_005834 3300049768 Bacteria 1210
559 Ga0501273_000997 3300049770 Bacteria 2539
560 Ga0501044_0001575 3300049823 Bacteria 26679
561 nmdc:mga05p37_113313_c1 3300050507 Bacteria 3334
562 nmdc:mga05p37_86867_c1 3300050507 Bacteria 3855
563 nmdc:mga09592_118706_c1 3300050508 Bacteria 2270
564 nmdc:mga09592_45617_c1 3300050508 Bacteria 3692
565 nmdc:mga08y16_186121_c1 3300050511 Bacteria 2155
566 nmdc:mga08y16_232319_c1 3300050511 Bacteria 1907
567 nmdc:mga08y16_2741_c1 3300050511 Bacteria 18062
568 nmdc:mga08y16_79491_c1 3300050511 Bacteria 3418
569 nmdc:mga0rr50_32695_c1 3300050513 Bacteria 3709
570 nmdc:mga0a205_5488_c1 3300050515 Bacteria 11420
571 nmdc:mga0a205_82339_c1 3300050515 Bacteria 3108
572 nmdc:mga0sz30_130319_c1 3300050516 Bacteria 1108
573 Ga0495601_0000786 3300053077 Bacteria 17145
574 Ga0500635_0000057 3300053080 Bacteria 73077
575 Ga0495595_0035117 3300053084 Bacteria 2271
576 Ga0495619_0002942 3300053085 Bacteria 11061
577 Ga0501084_0207999 3300054114 Viruses 1651
578 Ga0500661_011670 3300055283 Bacteria 1588

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035114 Ga0373939_0044473 Ga0373939_0044473_583_1338 248
2 3300047444 Ga0495675_0302149 Ga0495675_0302149_29_784 248
3 3300046473 Ga0495582_0341192 Ga0495582_0341192_76_834 252
4 3300046680 Ga0495646_0188281 Ga0495646_0188281_23_781 252
5 3300047472 Ga0495686_0024061 Ga0495686_0024061_556_1509 262
6 3300005563 Ga0068855_100238384 Ga0068855_1002383842 273
7 3300009093 Ga0105240_10049969 Ga0105240_100499693 273
8 3300025913 Ga0207695_10024272 Ga0207695_100242723 273
9 3300013105 Ga0157369_10113789 Ga0157369_101137894 275
10 3300013296 Ga0157374_10008732 Ga0157374_100087328 275
11 3300048915 Ga0496112_0060783 Ga0496112_0060783_2211_3047 275
12 3300046660 Ga0495625_0031520 Ga0495625_0031520_1673_2677 276
13 3300003761 Ga0055535_1000357 Ga0055535_100035724 278
14 3300003763 Ga0055529_1000433 Ga0055529_100043315 278
15 3300003763 Ga0055529_1000772 Ga0055529_10007724 278
16 3300025242 Ga0209258_100189 Ga0209258_10018940 278
17 3300025256 Ga0209759_1000729 Ga0209759_10007294 278
18 3300025272 Ga0209455_1000092 Ga0209455_100009240 278
19 3300046475 Ga0495639_0050284 Ga0495639_0050284_870_1823 278
20 3300013105 Ga0157369_10000401 Ga0157369_1000040146 281
21 3300025253 Ga0209677_103161 Ga0209677_1031614 283
22 3300053080 Ga0500635_0000057 Ga0500635_0000057_13873_14826 283
23 3300025256 Ga0209759_1010734 Ga0209759_10107342 284
24 3300046506 Ga0495583_0000224 Ga0495583_0000224_6430_7383 284
25 3300046507 Ga0495606_0001614 Ga0495606_0001614_10848_11801 284
26 3300046684 Ga0495669_0007294 Ga0495669_0007294_574_1527 284
27 3300046694 Ga0495649_0002245 Ga0495649_0002245_11355_12308 284
28 3300046794 Ga0495589_0027344 Ga0495589_0027344_1555_2508 284
29 3300055283 Ga0500661_011670 Ga0500661_011670_49_1002 284
30 3300002705 JGI25156J39149_1000222 JGI25156J39149_100022228 285
31 3300002705 JGI25156J39149_1000835 JGI25156J39149_10008354 285
32 3300002738 JGI25154J39366_1002986 JGI25154J39366_10029864 285
33 3300002741 JGI25157J39369_1000056 JGI25157J39369_100005646 285
34 3300002741 JGI25157J39369_1000100 JGI25157J39369_10001008 285
35 3300005577 Ga0068857_100001183 Ga0068857_1000011835 285
36 3300005578 Ga0068854_100045828 Ga0068854_1000458282 285
37 3300005614 Ga0068856_100000722 Ga0068856_10000072229 285
38 3300005616 Ga0068852_100031067 Ga0068852_1000310673 285
39 3300013105 Ga0157369_10276000 Ga0157369_102760002 285
40 3300025246 Ga0209646_1000124 Ga0209646_100012463 285
41 3300025250 Ga0209026_1000085 Ga0209026_100008563 285
42 3300025253 Ga0209677_100203 Ga0209677_10020337 285
43 3300025256 Ga0209759_1000068 Ga0209759_100006861 285
44 3300025949 Ga0207667_10074935 Ga0207667_100749353 285
45 3300025981 Ga0207640_10035617 Ga0207640_100356173 285
46 3300026078 Ga0207702_10000235 Ga0207702_100002357 285
47 3300026116 Ga0207674_10003076 Ga0207674_1000307615 285
48 3300026142 Ga0207698_10116362 Ga0207698_101163622 285
49 3300031730 Ga0307516_10001445 Ga0307516_100014453 286
50 3300025256 Ga0209759_1002917 Ga0209759_10029173 291
51 3300005563 Ga0068855_100004750 Ga0068855_10000475013 293
52 3300025949 Ga0207667_10002685 Ga0207667_1000268519 293
53 3300005577 Ga0068857_100394094 Ga0068857_1003940941 294
54 3300026116 Ga0207674_10365984 Ga0207674_103659842 294
55 3300042876 Ga0451577_0087014 Ga0451577_0087014_687_1640 294
56 3300045051 Ga0451576_0150474 Ga0451576_0150474_1227_2180 294
57 3300005330 Ga0070690_100013982 Ga0070690_1000139823 295
58 3300005334 Ga0068869_100184643 Ga0068869_1001846432 295
59 3300005338 Ga0068868_100405157 Ga0068868_1004051571 295
60 3300009176 Ga0105242_10326998 Ga0105242_103269981 295
61 3300013297 Ga0157378_10194758 Ga0157378_101947582 295
62 3300025934 Ga0207686_10257850 Ga0207686_102578501 295
63 3300025942 Ga0207689_10048650 Ga0207689_100486502 295
64 3300003752 Ga0055539_1000400 Ga0055539_10004006 296
65 3300003756 Ga0055533_1000080 Ga0055533_1000080122 296
66 3300003759 Ga0055525_1001850 Ga0055525_10018504 296
67 3300005328 Ga0070676_10306289 Ga0070676_103062891 296
68 3300005438 Ga0070701_10245812 Ga0070701_102458121 296
69 3300005441 Ga0070700_100009101 Ga0070700_1000091013 296
70 3300013308 Ga0157375_10113584 Ga0157375_101135842 296
71 3300014326 Ga0157380_10023612 Ga0157380_100236125 296
72 3300025226 Ga0209674_100003 Ga0209674_1000031855 296
73 3300025230 Ga0209563_100049 Ga0209563_100049317 296
74 3300025231 Ga0207427_101398 Ga0207427_1013988 296
75 3300025253 Ga0209677_100135 Ga0209677_10013524 296
76 3300025907 Ga0207645_10041276 Ga0207645_100412763 296
77 3300028666 Ga0265336_10000006 Ga0265336_10000006314 296
78 3300029957 Ga0265324_10001517 Ga0265324_100015177 296
79 3300003316 rootH1_10002255 rootH1_100022551 297
80 3300025932 Ga0207690_10045759 Ga0207690_100457594 297
81 3300031456 Ga0307513_10115348 Ga0307513_101153483 299
82 3300044842 Ga0466957_0020261 Ga0466957_0020261_1536_2540 299
83 3300005344 Ga0070661_100011670 Ga0070661_1000116702 300
84 3300005458 Ga0070681_10011837 Ga0070681_100118372 300
85 3300005530 Ga0070679_100015571 Ga0070679_1000155713 300
86 3300005564 Ga0070664_100052266 Ga0070664_1000522663 300
87 3300005577 Ga0068857_100018023 Ga0068857_1000180236 300
88 3300005614 Ga0068856_100000247 Ga0068856_10000024743 300
89 3300013100 Ga0157373_10026181 Ga0157373_100261815 300
90 3300013104 Ga0157370_10007038 Ga0157370_1000703813 300
91 3300025921 Ga0207652_10008111 Ga0207652_100081118 300
92 3300025932 Ga0207690_10090434 Ga0207690_100904342 300
93 3300026078 Ga0207702_10001127 Ga0207702_1000112720 300
94 3300026116 Ga0207674_10050907 Ga0207674_100509074 300
95 3300035692 Ga0373935_0213960 Ga0373935_0213960_283_1221 300
96 3300046513 Ga0495616_0007064 Ga0495616_0007064_3616_4542 300
97 3300049586 Ga0501070_0253588 Ga0501070_0253588_218_1144 300
98 3300049742 Ga0501080_0031731 Ga0501080_0031731_1575_2501 300
99 3300010375 Ga0105239_10401014 Ga0105239_104010141 301
100 3300013307 Ga0157372_10170897 Ga0157372_101708972 301
101 3300045051 Ga0451576_0458258 Ga0451576_0458258_209_1138 301
102 3300037853 Ga0436364_1343081 Ga0436364_1343081_158_1081 302
103 3300005457 Ga0070662_100305608 Ga0070662_1003056082 303
104 3300025926 Ga0207659_10137334 Ga0207659_101373341 303
105 3300026121 Ga0207683_10247172 Ga0207683_102471722 303
106 3300005327 Ga0070658_10023738 Ga0070658_100237382 304
107 3300005327 Ga0070658_10055663 Ga0070658_100556633 304
108 3300005327 Ga0070658_10391693 Ga0070658_103916931 304
109 3300005339 Ga0070660_100194307 Ga0070660_1001943072 304
110 3300005364 Ga0070673_100003539 Ga0070673_1000035393 304
111 3300009148 Ga0105243_10000144 Ga0105243_1000014438 304
112 3300025909 Ga0207705_10043903 Ga0207705_100439034 304
113 3300025919 Ga0207657_10084610 Ga0207657_100846102 304
114 3300025960 Ga0207651_10082845 Ga0207651_100828452 304
115 3300037466 Ga0395898_0123374 Ga0395898_0123374_1373_2383 304
116 3300037471 Ga0395905_0221084 Ga0395905_0221084_141_1073 304
117 3300038443 Ga0395901_0566583 Ga0395901_0566583_126_1136 304
118 3300044656 Ga0466969_0002921 Ga0466969_0002921_6944_7975 304
119 3300044683 Ga0466965_0003825 Ga0466965_0003825_4404_5435 304
120 3300044684 Ga0466966_0008102 Ga0466966_0008102_1117_2142 304
121 3300044693 Ga0466961_0037377 Ga0466961_0037377_385_1338 304
122 3300044706 Ga0466964_0004764 Ga0466964_0004764_2936_3967 304
123 3300045049 Ga0466959_0002303 Ga0466959_0002303_5902_6933 304
124 3300045051 Ga0451576_0016127 Ga0451576_0016127_5357_6286 304
125 3300005327 Ga0070658_10008509 Ga0070658_100085096 305
126 3300005436 Ga0070713_100003514 Ga0070713_1000035146 305
127 3300005937 Ga0081455_10083166 Ga0081455_100831662 305
128 3300013307 Ga0157372_10072929 Ga0157372_100729293 305
129 3300025909 Ga0207705_10010139 Ga0207705_100101391 305
130 3300025928 Ga0207700_10108400 Ga0207700_101084001 305
131 3300028794 Ga0307515_10097879 Ga0307515_100978792 305
132 3300046475 Ga0495639_0011388 Ga0495639_0011388_1595_2542 305
133 3300046517 Ga0495630_0000667 Ga0495630_0000667_7230_8177 305
134 3300046663 Ga0495635_0040140 Ga0495635_0040140_759_1706 305
135 3300046690 Ga0495624_0004031 Ga0495624_0004031_7741_8688 305
136 3300047315 Ga0495581_0033187 Ga0495581_0033187_917_1864 305
137 3300047321 Ga0495676_0188098 Ga0495676_0188098_419_1366 305
138 3300047471 Ga0495684_0006627 Ga0495684_0006627_6567_7514 305
139 3300005340 Ga0070689_100011690 Ga0070689_1000116905 306
140 3300005345 Ga0070692_10038186 Ga0070692_100381862 306
141 3300005345 Ga0070692_10084609 Ga0070692_100846092 306
142 3300005366 Ga0070659_100040156 Ga0070659_1000401561 306
143 3300005406 Ga0070703_10055496 Ga0070703_100554962 306
144 3300005444 Ga0070694_100031779 Ga0070694_1000317794 306
145 3300005444 Ga0070694_100053848 Ga0070694_1000538481 306
146 3300005471 Ga0070698_100366511 Ga0070698_1003665111 306
147 3300005546 Ga0070696_100309414 Ga0070696_1003094141 306
148 3300005549 Ga0070704_100101781 Ga0070704_1001017812 306
149 3300005549 Ga0070704_100339459 Ga0070704_1003394591 306
150 3300005577 Ga0068857_100055661 Ga0068857_1000556612 306
151 3300005615 Ga0070702_100250324 Ga0070702_1002503241 306
152 3300005617 Ga0068859_100034560 Ga0068859_1000345602 306
153 3300005617 Ga0068859_100090560 Ga0068859_1000905603 306
154 3300005618 Ga0068864_100005438 Ga0068864_1000054387 306
155 3300005719 Ga0068861_100372781 Ga0068861_1003727811 306
156 3300005834 Ga0068851_10006676 Ga0068851_100066764 306
157 3300005841 Ga0068863_100041372 Ga0068863_1000413722 306
158 3300005842 Ga0068858_100285068 Ga0068858_1002850682 306
159 3300005843 Ga0068860_100087101 Ga0068860_1000871014 306
160 3300005844 Ga0068862_100075016 Ga0068862_1000750162 306
161 3300005844 Ga0068862_100158387 Ga0068862_1001583872 306
162 3300006931 Ga0097620_100034558 Ga0097620_1000345582 306
163 3300006931 Ga0097620_100090559 Ga0097620_1000905593 306
164 3300009011 Ga0105251_10004327 Ga0105251_100043276 306
165 3300009036 Ga0105244_10020684 Ga0105244_100206843 306
166 3300009093 Ga0105240_10037272 Ga0105240_100372724 306
167 3300009094 Ga0111539_10106009 Ga0111539_101060092 306
168 3300009545 Ga0105237_10000843 Ga0105237_1000084333 306
169 3300013102 Ga0157371_10015105 Ga0157371_100151055 306
170 3300013105 Ga0157369_10001968 Ga0157369_1000196812 306
171 3300013307 Ga0157372_10004845 Ga0157372_1000484510 306
172 3300013307 Ga0157372_10090997 Ga0157372_100909973 306
173 3300014745 Ga0157377_10000074 Ga0157377_1000007470 306
174 3300014968 Ga0157379_10046382 Ga0157379_100463822 306
175 3300025303 Ga0209051_1004213 Ga0209051_10042132 306
176 3300025321 Ga0207656_10003975 Ga0207656_100039754 306
177 3300025735 Ga0207713_1029389 Ga0207713_10293892 306
178 3300025885 Ga0207653_10000894 Ga0207653_1000089410 306
179 3300025908 Ga0207643_10010983 Ga0207643_100109834 306
180 3300025918 Ga0207662_10151478 Ga0207662_101514782 306
181 3300025932 Ga0207690_10185748 Ga0207690_101857482 306
182 3300025936 Ga0207670_10001523 Ga0207670_100015237 306
183 3300026035 Ga0207703_10249169 Ga0207703_102491692 306
184 3300026075 Ga0207708_10084634 Ga0207708_100846342 306
185 3300026088 Ga0207641_10409312 Ga0207641_104093122 306
186 3300026095 Ga0207676_10014396 Ga0207676_100143964 306
187 3300026116 Ga0207674_10045026 Ga0207674_100450262 306
188 3300026116 Ga0207674_10047263 Ga0207674_100472632 306
189 3300028380 Ga0268265_10490876 Ga0268265_104908762 306
190 3300028381 Ga0268264_10105531 Ga0268264_101055313 306
191 3300042876 Ga0451577_0270866 Ga0451577_0270866_340_1269 306
192 3300048916 Ga0496113_0195818 Ga0496113_0195818_607_1548 306
193 3300050507 nmdc:mga05p37_113313_c1 nmdc:mga05p37_113313_c1_1066_1998 306
194 3300050507 nmdc:mga05p37_86867_c1 nmdc:mga05p37_86867_c1_2390_3331 306
195 3300050511 nmdc:mga08y16_186121_c1 nmdc:mga08y16_186121_c1_535_1476 306
196 3300050511 nmdc:mga08y16_79491_c1 nmdc:mga08y16_79491_c1_2291_3226 306
197 3300050515 nmdc:mga0a205_82339_c1 nmdc:mga0a205_82339_c1_690_1637 306
198 iso_pu_bacteria 2510065053 2510282664 306
199 iso_pu_bacteria 2510065055 2510295318 306
200 iso_pu_bacteria 2510065058 2510311056 306
201 iso_pu_bacteria 2773857672 2774129151 306
202 iso_pu_bacteria 2917832318 2917833278 306
203 iso_pu_bacteria 2919125081 2919126182 306
204 iso_pu_bacteria 2974298342 2974302405 306
205 iso_pu_bacteria 2984499530 2984500042 306
206 iso_pu_bacteria 2984504281 2984506580 306
207 iso_pu_bacteria 8016728285 8016731400 306
208 2162886011 MRS1b_contig_4046139 MRS1b_0433.00002280 307
209 3300000532 CNAas_1000687 CNAas_10006872 307
210 3300000546 LJNas_1000973 LJNas_10009733 307
211 3300005288 Ga0065714_10064425 Ga0065714_10064425139 307
212 3300005289 Ga0065704_10084316 Ga0065704_100843162 307
213 3300005290 Ga0065712_10067727 Ga0065712_10067727141 307
214 3300005293 Ga0065715_10000520 Ga0065715_100005205 307
215 3300005293 Ga0065715_10009366 Ga0065715_100093662 307
216 3300005293 Ga0065715_10122956 Ga0065715_101229562 307
217 3300005295 Ga0065707_10014475 Ga0065707_100144751 307
218 3300005329 Ga0070683_100136737 Ga0070683_1001367372 307
219 3300005331 Ga0070670_100000190 Ga0070670_10000019017 307
220 3300005331 Ga0070670_100107096 Ga0070670_1001070962 307
221 3300005334 Ga0068869_100071495 Ga0068869_1000714951 307
222 3300005334 Ga0068869_100143540 Ga0068869_1001435402 307
223 3300005334 Ga0068869_100159889 Ga0068869_1001598892 307
224 3300005335 Ga0070666_10038327 Ga0070666_100383272 307
225 3300005336 Ga0070680_100097092 Ga0070680_1000970921 307
226 3300005336 Ga0070680_100226177 Ga0070680_1002261771 307
227 3300005337 Ga0070682_100028147 Ga0070682_1000281473 307
228 3300005338 Ga0068868_100030083 Ga0068868_1000300832 307
229 3300005343 Ga0070687_100057980 Ga0070687_1000579802 307
230 3300005344 Ga0070661_100248856 Ga0070661_1002488562 307
231 3300005353 Ga0070669_100025253 Ga0070669_1000252534 307
232 3300005353 Ga0070669_100230629 Ga0070669_1002306292 307
233 3300005354 Ga0070675_100098253 Ga0070675_1000982532 307
234 3300005354 Ga0070675_100314201 Ga0070675_1003142012 307
235 3300005355 Ga0070671_100058154 Ga0070671_1000581542 307
236 3300005364 Ga0070673_100168728 Ga0070673_1001687282 307
237 3300005366 Ga0070659_100002688 Ga0070659_1000026884 307
238 3300005367 Ga0070667_100038272 Ga0070667_1000382723 307
239 3300005434 Ga0070709_10254185 Ga0070709_102541851 307
240 3300005435 Ga0070714_100178260 Ga0070714_1001782602 307
241 3300005436 Ga0070713_100065812 Ga0070713_1000658122 307
242 3300005440 Ga0070705_100160613 Ga0070705_1001606132 307
243 3300005441 Ga0070700_100000047 Ga0070700_10000004717 307
244 3300005441 Ga0070700_100017991 Ga0070700_1000179912 307
245 3300005458 Ga0070681_10000991 Ga0070681_1000099112 307
246 3300005458 Ga0070681_10019055 Ga0070681_100190554 307
247 3300005458 Ga0070681_10062988 Ga0070681_100629883 307
248 3300005459 Ga0068867_100066515 Ga0068867_1000665151 307
249 3300005467 Ga0070706_100000305 Ga0070706_10000030519 307
250 3300005468 Ga0070707_100003309 Ga0070707_1000033092 307
251 3300005468 Ga0070707_100030775 Ga0070707_1000307754 307
252 3300005471 Ga0070698_100030109 Ga0070698_1000301093 307
253 3300005471 Ga0070698_100055758 Ga0070698_1000557584 307
254 3300005518 Ga0070699_100000978 Ga0070699_1000009782 307
255 3300005518 Ga0070699_100052966 Ga0070699_1000529663 307
256 3300005530 Ga0070679_100131172 Ga0070679_1001311722 307
257 3300005530 Ga0070679_100159787 Ga0070679_1001597872 307
258 3300005535 Ga0070684_100000038 Ga0070684_10000003824 307
259 3300005536 Ga0070697_100171668 Ga0070697_1001716681 307
260 3300005539 Ga0068853_100024960 Ga0068853_1000249603 307
261 3300005544 Ga0070686_100159888 Ga0070686_1001598882 307
262 3300005545 Ga0070695_100055708 Ga0070695_1000557082 307
263 3300005546 Ga0070696_100115532 Ga0070696_1001155322 307
264 3300005549 Ga0070704_100063873 Ga0070704_1000638734 307
265 3300005563 Ga0068855_100043417 Ga0068855_1000434171 307
266 3300005564 Ga0070664_100002701 Ga0070664_10000270110 307
267 3300005564 Ga0070664_100056741 Ga0070664_1000567412 307
268 3300005564 Ga0070664_100076952 Ga0070664_1000769523 307
269 3300005564 Ga0070664_100531173 Ga0070664_1005311731 307
270 3300005577 Ga0068857_100003033 Ga0068857_1000030336 307
271 3300005577 Ga0068857_100028380 Ga0068857_1000283802 307
272 3300005577 Ga0068857_100234109 Ga0068857_1002341092 307
273 3300005577 Ga0068857_100240734 Ga0068857_1002407341 307
274 3300005578 Ga0068854_100260509 Ga0068854_1002605092 307
275 3300005615 Ga0070702_100003608 Ga0070702_1000036086 307
276 3300005615 Ga0070702_100224629 Ga0070702_1002246292 307
277 3300005616 Ga0068852_100040345 Ga0068852_1000403452 307
278 3300005616 Ga0068852_100072927 Ga0068852_1000729272 307
279 3300005616 Ga0068852_100143422 Ga0068852_1001434222 307
280 3300005617 Ga0068859_100006226 Ga0068859_1000062262 307
281 3300005617 Ga0068859_100009958 Ga0068859_1000099587 307
282 3300005617 Ga0068859_100019709 Ga0068859_1000197098 307
283 3300005617 Ga0068859_100023383 Ga0068859_1000233836 307
284 3300005617 Ga0068859_100028873 Ga0068859_1000288734 307
285 3300005617 Ga0068859_100060421 Ga0068859_1000604215 307
286 3300005617 Ga0068859_100080936 Ga0068859_1000809364 307
287 3300005617 Ga0068859_100376924 Ga0068859_1003769242 307
288 3300005617 Ga0068859_100528631 Ga0068859_1005286312 307
289 3300005618 Ga0068864_100060141 Ga0068864_1000601411 307
290 3300005618 Ga0068864_100060926 Ga0068864_1000609262 307
291 3300005618 Ga0068864_100216790 Ga0068864_1002167901 307
292 3300005618 Ga0068864_100264708 Ga0068864_1002647082 307
293 3300005718 Ga0068866_10130515 Ga0068866_101305152 307
294 3300005719 Ga0068861_100067771 Ga0068861_1000677712 307
295 3300005719 Ga0068861_100139309 Ga0068861_1001393092 307
296 3300005719 Ga0068861_100147422 Ga0068861_1001474222 307
297 3300005841 Ga0068863_100068757 Ga0068863_1000687573 307
298 3300005841 Ga0068863_100092211 Ga0068863_1000922112 307
299 3300005841 Ga0068863_100161928 Ga0068863_1001619282 307
300 3300005842 Ga0068858_100048925 Ga0068858_1000489252 307
301 3300005842 Ga0068858_100051777 Ga0068858_1000517772 307
302 3300005842 Ga0068858_100103386 Ga0068858_1001033863 307
303 3300005842 Ga0068858_100194295 Ga0068858_1001942952 307
304 3300005843 Ga0068860_100020977 Ga0068860_1000209774 307
305 3300005843 Ga0068860_100046626 Ga0068860_1000466263 307
306 3300005843 Ga0068860_100083605 Ga0068860_1000836053 307
307 3300005843 Ga0068860_100179005 Ga0068860_1001790052 307
308 3300005843 Ga0068860_100335564 Ga0068860_1003355641 307
309 3300005844 Ga0068862_100131999 Ga0068862_1001319993 307
310 3300005985 Ga0081539_10001529 Ga0081539_1000152919 307
311 3300005985 Ga0081539_10005669 Ga0081539_100056694 307
312 3300005985 Ga0081539_10018864 Ga0081539_100188643 307
313 3300005985 Ga0081539_10083112 Ga0081539_100831122 307
314 3300006028 Ga0070717_10073137 Ga0070717_100731373 307
315 3300006028 Ga0070717_10097272 Ga0070717_100972722 307
316 3300006237 Ga0097621_100005230 Ga0097621_1000052304 307
317 3300006237 Ga0097621_100010737 Ga0097621_1000107376 307
318 3300006237 Ga0097621_100037611 Ga0097621_1000376114 307
319 3300006237 Ga0097621_100047701 Ga0097621_1000477013 307
320 3300006237 Ga0097621_100192884 Ga0097621_1001928842 307
321 3300006358 Ga0068871_100019181 Ga0068871_1000191813 307
322 3300006358 Ga0068871_100044637 Ga0068871_1000446372 307
323 3300006358 Ga0068871_100070632 Ga0068871_1000706322 307
324 3300006844 Ga0075428_100071806 Ga0075428_1000718061 307
325 3300006844 Ga0075428_100497209 Ga0075428_1004972092 307
326 3300006847 Ga0075431_100460325 Ga0075431_1004603251 307
327 3300006852 Ga0075433_10088101 Ga0075433_100881013 307
328 3300006852 Ga0075433_10120465 Ga0075433_101204652 307
329 3300006852 Ga0075433_10178161 Ga0075433_101781612 307
330 3300006871 Ga0075434_100063142 Ga0075434_1000631421 307
331 3300006871 Ga0075434_100196361 Ga0075434_1001963611 307
332 3300006871 Ga0075434_100500056 Ga0075434_1005000562 307
333 3300006880 Ga0075429_100058672 Ga0075429_1000586724 307
334 3300006880 Ga0075429_100178375 Ga0075429_1001783752 307
335 3300006881 Ga0068865_100023803 Ga0068865_1000238034 307
336 3300006914 Ga0075436_100006391 Ga0075436_1000063916 307
337 3300006914 Ga0075436_100050778 Ga0075436_1000507783 307
338 3300006914 Ga0075436_100220045 Ga0075436_1002200451 307
339 3300006931 Ga0097620_100006226 Ga0097620_1000062262 307
340 3300006931 Ga0097620_100009957 Ga0097620_1000099577 307
341 3300006931 Ga0097620_100019709 Ga0097620_1000197098 307
342 3300006931 Ga0097620_100023383 Ga0097620_1000233832 307
343 3300006931 Ga0097620_100028871 Ga0097620_1000288714 307
344 3300006931 Ga0097620_100060422 Ga0097620_1000604222 307
345 3300006931 Ga0097620_100080935 Ga0097620_1000809352 307
346 3300006931 Ga0097620_100315517 Ga0097620_1003155172 307
347 3300006931 Ga0097620_100376934 Ga0097620_1003769342 307
348 3300006931 Ga0097620_100528607 Ga0097620_1005286072 307
349 3300007076 Ga0075435_100305126 Ga0075435_1003051261 307
350 3300009011 Ga0105251_10042756 Ga0105251_100427562 307
351 3300009011 Ga0105251_10115148 Ga0105251_101151482 307
352 3300009011 Ga0105251_10117009 Ga0105251_101170092 307
353 3300009093 Ga0105240_10122290 Ga0105240_101222902 307
354 3300009093 Ga0105240_10211213 Ga0105240_102112132 307
355 3300009094 Ga0111539_10024249 Ga0111539_100242493 307
356 3300009094 Ga0111539_10139405 Ga0111539_101394053 307
357 3300009094 Ga0111539_10409110 Ga0111539_104091102 307
358 3300009098 Ga0105245_10136474 Ga0105245_101364741 307
359 3300009101 Ga0105247_10001923 Ga0105247_100019235 307
360 3300009147 Ga0114129_10013535 Ga0114129_100135357 307
361 3300009148 Ga0105243_10002285 Ga0105243_100022857 307
362 3300009148 Ga0105243_10099965 Ga0105243_100999652 307
363 3300009174 Ga0105241_10021785 Ga0105241_100217852 307
364 3300009174 Ga0105241_10119423 Ga0105241_101194232 307
365 3300009174 Ga0105241_10138667 Ga0105241_101386672 307
366 3300009174 Ga0105241_10179691 Ga0105241_101796912 307
367 3300009174 Ga0105241_10246745 Ga0105241_102467452 307
368 3300009176 Ga0105242_10051934 Ga0105242_100519344 307
369 3300009176 Ga0105242_10122544 Ga0105242_101225442 307
370 3300009176 Ga0105242_10268931 Ga0105242_102689313 307
371 3300009177 Ga0105248_10008342 Ga0105248_1000834212 307
372 3300009177 Ga0105248_10026990 Ga0105248_100269903 307
373 3300009177 Ga0105248_10034742 Ga0105248_100347422 307
374 3300009177 Ga0105248_10038862 Ga0105248_100388623 307
375 3300009177 Ga0105248_10170110 Ga0105248_101701102 307
376 3300009177 Ga0105248_10207095 Ga0105248_102070952 307
377 3300009177 Ga0105248_10654933 Ga0105248_106549331 307
378 3300009545 Ga0105237_10028407 Ga0105237_100284072 307
379 3300009545 Ga0105237_10231625 Ga0105237_102316252 307
380 3300009551 Ga0105238_10000370 Ga0105238_100003701 307
381 3300009551 Ga0105238_10006520 Ga0105238_100065202 307
382 3300009551 Ga0105238_10013280 Ga0105238_100132802 307
383 3300009553 Ga0105249_10000844 Ga0105249_1000084411 307
384 3300009553 Ga0105249_10261993 Ga0105249_102619932 307
385 3300009993 Ga0105028_107051 Ga0105028_1070512 307
386 3300010375 Ga0105239_10040324 Ga0105239_100403244 307
387 3300010375 Ga0105239_10053571 Ga0105239_100535714 307
388 3300010375 Ga0105239_10124425 Ga0105239_101244252 307
389 3300010375 Ga0105239_10196306 Ga0105239_101963062 307
390 3300011119 Ga0105246_10151469 Ga0105246_101514692 307
391 3300011119 Ga0105246_10167253 Ga0105246_101672532 307
392 3300013100 Ga0157373_10071289 Ga0157373_100712893 307
393 3300013100 Ga0157373_10129172 Ga0157373_101291723 307
394 3300013104 Ga0157370_10055878 Ga0157370_100558784 307
395 3300013104 Ga0157370_10178711 Ga0157370_101787112 307
396 3300013105 Ga0157369_10016299 Ga0157369_100162994 307
397 3300013105 Ga0157369_10050147 Ga0157369_100501474 307
398 3300013296 Ga0157374_10052985 Ga0157374_100529852 307
399 3300013296 Ga0157374_10105404 Ga0157374_101054042 307
400 3300013297 Ga0157378_10003679 Ga0157378_100036793 307
401 3300013297 Ga0157378_10020058 Ga0157378_100200584 307
402 3300013297 Ga0157378_10174563 Ga0157378_101745632 307
403 3300013297 Ga0157378_10286708 Ga0157378_102867082 307
404 3300013306 Ga0163162_10004613 Ga0163162_100046139 307
405 3300013306 Ga0163162_10027304 Ga0163162_100273044 307
406 3300013306 Ga0163162_10043171 Ga0163162_100431715 307
407 3300013307 Ga0157372_10010935 Ga0157372_100109357 307
408 3300013307 Ga0157372_10215609 Ga0157372_102156092 307
409 3300013307 Ga0157372_10571390 Ga0157372_105713902 307
410 3300013307 Ga0157372_10880814 Ga0157372_108808141 307
411 3300013308 Ga0157375_10096948 Ga0157375_100969482 307
412 3300013308 Ga0157375_10674334 Ga0157375_106743342 307
413 3300014325 Ga0163163_10000209 Ga0163163_1000020934 307
414 3300014325 Ga0163163_10002342 Ga0163163_100023424 307
415 3300014325 Ga0163163_10004974 Ga0163163_100049742 307
416 3300014325 Ga0163163_10018160 Ga0163163_100181602 307
417 3300014325 Ga0163163_10048137 Ga0163163_100481372 307
418 3300014325 Ga0163163_10074278 Ga0163163_100742782 307
419 3300014325 Ga0163163_10094424 Ga0163163_100944242 307
420 3300014325 Ga0163163_10237341 Ga0163163_102373412 307
421 3300014326 Ga0157380_10382101 Ga0157380_103821012 307
422 3300014745 Ga0157377_10106824 Ga0157377_101068242 307
423 3300014969 Ga0157376_10061364 Ga0157376_100613642 307
424 3300014969 Ga0157376_10069379 Ga0157376_100693792 307
425 3300015265 Ga0182005_1000004 Ga0182005_1000004131 307
426 3300017792 Ga0163161_10012424 Ga0163161_100124243 307
427 3300025315 Ga0207697_10088546 Ga0207697_100885462 307
428 3300025899 Ga0207642_10048586 Ga0207642_100485862 307
429 3300025900 Ga0207710_10001516 Ga0207710_100015166 307
430 3300025903 Ga0207680_10018308 Ga0207680_100183083 307
431 3300025903 Ga0207680_10085754 Ga0207680_100857543 307
432 3300025904 Ga0207647_10003108 Ga0207647_100031082 307
433 3300025904 Ga0207647_10098742 Ga0207647_100987422 307
434 3300025908 Ga0207643_10040090 Ga0207643_100400902 307
435 3300025908 Ga0207643_10135635 Ga0207643_101356352 307
436 3300025910 Ga0207684_10000053 Ga0207684_1000005345 307
437 3300025910 Ga0207684_10031170 Ga0207684_100311703 307
438 3300025911 Ga0207654_10014038 Ga0207654_100140382 307
439 3300025912 Ga0207707_10000004 Ga0207707_10000004183 307
440 3300025912 Ga0207707_10009356 Ga0207707_100093566 307
441 3300025912 Ga0207707_10114856 Ga0207707_101148562 307
442 3300025913 Ga0207695_10111010 Ga0207695_101110102 307
443 3300025913 Ga0207695_10151287 Ga0207695_101512872 307
444 3300025913 Ga0207695_10194026 Ga0207695_101940261 307
445 3300025914 Ga0207671_10043459 Ga0207671_100434592 307
446 3300025917 Ga0207660_10002498 Ga0207660_100024982 307
447 3300025917 Ga0207660_10126680 Ga0207660_101266803 307
448 3300025917 Ga0207660_10126851 Ga0207660_101268511 307
449 3300025918 Ga0207662_10024050 Ga0207662_100240503 307
450 3300025921 Ga0207652_10000087 Ga0207652_1000008713 307
451 3300025921 Ga0207652_10127830 Ga0207652_101278302 307
452 3300025921 Ga0207652_10135206 Ga0207652_101352062 307
453 3300025922 Ga0207646_10069952 Ga0207646_100699522 307
454 3300025922 Ga0207646_10226594 Ga0207646_102265942 307
455 3300025922 Ga0207646_10352112 Ga0207646_103521122 307
456 3300025924 Ga0207694_10003790 Ga0207694_100037909 307
457 3300025924 Ga0207694_10025335 Ga0207694_100253355 307
458 3300025924 Ga0207694_10028730 Ga0207694_100287302 307
459 3300025925 Ga0207650_10000007 Ga0207650_10000007247 307
460 3300025925 Ga0207650_10150340 Ga0207650_101503402 307
461 3300025925 Ga0207650_10271164 Ga0207650_102711641 307
462 3300025926 Ga0207659_10067416 Ga0207659_100674161 307
463 3300025926 Ga0207659_10265038 Ga0207659_102650382 307
464 3300025927 Ga0207687_10075007 Ga0207687_100750072 307
465 3300025928 Ga0207700_10102017 Ga0207700_101020172 307
466 3300025928 Ga0207700_10235088 Ga0207700_102350882 307
467 3300025928 Ga0207700_10434474 Ga0207700_104344742 307
468 3300025929 Ga0207664_10017642 Ga0207664_100176425 307
469 3300025929 Ga0207664_10189094 Ga0207664_101890941 307
470 3300025931 Ga0207644_10353218 Ga0207644_103532181 307
471 3300025932 Ga0207690_10062705 Ga0207690_100627052 307
472 3300025933 Ga0207706_10010126 Ga0207706_100101263 307
473 3300025933 Ga0207706_10216847 Ga0207706_102168472 307
474 3300025934 Ga0207686_10234572 Ga0207686_102345722 307
475 3300025936 Ga0207670_10244760 Ga0207670_102447602 307
476 3300025938 Ga0207704_10296128 Ga0207704_102961281 307
477 3300025940 Ga0207691_10014923 Ga0207691_100149235 307
478 3300025941 Ga0207711_10028499 Ga0207711_100284993 307
479 3300025941 Ga0207711_10114592 Ga0207711_101145922 307
480 3300025942 Ga0207689_10014720 Ga0207689_100147203 307
481 3300025942 Ga0207689_10047043 Ga0207689_100470434 307
482 3300025942 Ga0207689_10064957 Ga0207689_100649572 307
483 3300025942 Ga0207689_10132329 Ga0207689_101323291 307
484 3300025942 Ga0207689_10135406 Ga0207689_101354062 307
485 3300025942 Ga0207689_10179110 Ga0207689_101791101 307
486 3300025942 Ga0207689_10265932 Ga0207689_102659321 307
487 3300025944 Ga0207661_10093237 Ga0207661_100932372 307
488 3300025949 Ga0207667_10127757 Ga0207667_101277572 307
489 3300025949 Ga0207667_10146617 Ga0207667_101466172 307
490 3300025960 Ga0207651_10102670 Ga0207651_101026702 307
491 3300025960 Ga0207651_10109126 Ga0207651_101091262 307
492 3300025960 Ga0207651_10349593 Ga0207651_103495932 307
493 3300025961 Ga0207712_10001401 Ga0207712_100014016 307
494 3300025961 Ga0207712_10096231 Ga0207712_100962312 307
495 3300025981 Ga0207640_10068539 Ga0207640_100685392 307
496 3300026023 Ga0207677_10333314 Ga0207677_103333142 307
497 3300026035 Ga0207703_10036835 Ga0207703_100368355 307
498 3300026035 Ga0207703_10169093 Ga0207703_101690932 307
499 3300026041 Ga0207639_10008033 Ga0207639_100080333 307
500 3300026041 Ga0207639_10144576 Ga0207639_101445762 307
501 3300026041 Ga0207639_10386214 Ga0207639_103862142 307
502 3300026067 Ga0207678_10402809 Ga0207678_104028092 307
503 3300026075 Ga0207708_10000113 Ga0207708_1000011337 307
504 3300026075 Ga0207708_10014216 Ga0207708_100142162 307
505 3300026075 Ga0207708_10024164 Ga0207708_100241642 307
506 3300026075 Ga0207708_10299722 Ga0207708_102997222 307
507 3300026078 Ga0207702_10024438 Ga0207702_100244384 307
508 3300026078 Ga0207702_10055061 Ga0207702_100550614 307
509 3300026088 Ga0207641_10051511 Ga0207641_100515112 307
510 3300026088 Ga0207641_10086461 Ga0207641_100864612 307
511 3300026088 Ga0207641_10270818 Ga0207641_102708182 307
512 3300026089 Ga0207648_10012132 Ga0207648_100121323 307
513 3300026089 Ga0207648_10032894 Ga0207648_100328942 307
514 3300026089 Ga0207648_10095808 Ga0207648_100958081 307
515 3300026095 Ga0207676_10003576 Ga0207676_100035768 307
516 3300026095 Ga0207676_10054349 Ga0207676_100543492 307
517 3300026116 Ga0207674_10009239 Ga0207674_100092396 307
518 3300026116 Ga0207674_10092481 Ga0207674_100924812 307
519 3300026116 Ga0207674_10205464 Ga0207674_102054642 307
520 3300026116 Ga0207674_10221059 Ga0207674_102210592 307
521 3300026116 Ga0207674_10258053 Ga0207674_102580532 307
522 3300026118 Ga0207675_100006726 Ga0207675_1000067264 307
523 3300026118 Ga0207675_100096602 Ga0207675_1000966022 307
524 3300026142 Ga0207698_10048609 Ga0207698_100486092 307
525 3300026142 Ga0207698_10125428 Ga0207698_101254281 307
526 3300026142 Ga0207698_10294575 Ga0207698_102945752 307
527 3300027907 Ga0207428_10009063 Ga0207428_100090632 307
528 3300028379 Ga0268266_10000140 Ga0268266_10000140103 307
529 3300028380 Ga0268265_10106379 Ga0268265_101063792 307
530 3300028380 Ga0268265_10402435 Ga0268265_104024352 307
531 3300028381 Ga0268264_10012975 Ga0268264_100129755 307
532 3300028381 Ga0268264_10043066 Ga0268264_100430663 307
533 3300028381 Ga0268264_10086297 Ga0268264_100862971 307
534 3300028381 Ga0268264_10097643 Ga0268264_100976432 307
535 3300031249 Ga0265339_10163154 Ga0265339_101631541 307
536 3300031731 Ga0307405_10033920 Ga0307405_100339203 307
537 3300031852 Ga0307410_10013753 Ga0307410_100137532 307
538 3300031852 Ga0307410_10329450 Ga0307410_103294501 307
539 3300031901 Ga0307406_10000949 Ga0307406_100009497 307
540 3300032004 Ga0307414_10149131 Ga0307414_101491312 307
541 3300033179 Ga0307507_10033999 Ga0307507_100339993 307
542 3300035207 Ga0373942_0002748 Ga0373942_0002748_1865_3004 307
543 3300035691 Ga0373931_0228514 Ga0373931_0228514_144_1103 307
544 3300035724 Ga0373933_0143295 Ga0373933_0143295_236_1192 307
545 3300036401 Ga0373937_0107331 Ga0373937_0107331_1253_2200 307
546 3300036401 Ga0373937_0568774 Ga0373937_0568774_25_981 307
547 3300037068 Ga0373925_0284996 Ga0373925_0284996_242_1207 307
548 3300037853 Ga0436364_0681300 Ga0436364_0681300_198_1133 307
549 3300038443 Ga0395901_0033779 Ga0395901_0033779_1399_2355 307
550 3300038996 Ga0242420_000456 Ga0242420_000456_1600_2538 307
551 3300039438 Ga0436360_0258342 Ga0436360_0258342_81_1031 307
552 3300046473 Ga0495582_0217886 Ga0495582_0217886_18_965 307
553 3300046477 Ga0495664_0083564 Ga0495664_0083564_643_1599 307
554 3300046511 Ga0495608_0017001 Ga0495608_0017001_2506_3462 307
555 3300046683 Ga0495658_0094808 Ga0495658_0094808_403_1350 307
556 3300048906 Ga0496103_0134844 Ga0496103_0134844_322_1281 307
557 3300048907 Ga0496104_0102634 Ga0496104_0102634_1256_2215 307
558 3300048907 Ga0496104_0200665 Ga0496104_0200665_886_1836 307
559 3300048908 Ga0496105_0145498 Ga0496105_0145498_511_1470 307
560 3300048911 Ga0496108_0161645 Ga0496108_0161645_504_1442 307
561 3300048912 Ga0496109_0541876 Ga0496109_0541876_67_1026 307
562 3300048913 Ga0496110_0246020 Ga0496110_0246020_90_1040 307
563 3300048915 Ga0496112_0056264 Ga0496112_0056264_1087_2025 307
564 3300048915 Ga0496112_0366656 Ga0496112_0366656_427_1365 307
565 3300049515 Ga0501292_008074 Ga0501292_008074_234_1184 307
566 3300049521 Ga0501298_008826 Ga0501298_008826_730_1674 307
567 3300049522 Ga0501299_009095 Ga0501299_009095_53_1009 307
568 3300049588 Ga0501072_0411049 Ga0501072_0411049_23_976 307
569 3300049665 Ga0501227_014912 Ga0501227_014912_443_1393 307
570 3300049667 Ga0501230_007695 Ga0501230_007695_192_1142 307
571 3300049668 Ga0501233_014619 Ga0501233_014619_241_1191 307
572 3300049686 Ga0501257_007104 Ga0501257_007104_987_1928 307
573 3300049704 Ga0501221_018094 Ga0501221_018094_284_1234 307
574 3300049705 Ga0501225_0000594 Ga0501225_0000594_513_1454 307
575 3300049768 Ga0501271_005834 Ga0501271_005834_99_1049 307
576 3300049770 Ga0501273_000997 Ga0501273_000997_636_1586 307
577 3300049823 Ga0501044_0001575 Ga0501044_0001575_1615_2550 307
578 3300050508 nmdc:mga09592_118706_c1 nmdc:mga09592_118706_c1_256_1203 307
579 3300050508 nmdc:mga09592_45617_c1 nmdc:mga09592_45617_c1_708_1655 307
580 3300050511 nmdc:mga08y16_232319_c1 nmdc:mga08y16_232319_c1_318_1265 307
581 3300050511 nmdc:mga08y16_2741_c1 nmdc:mga08y16_2741_c1_16811_17791 307
582 3300050513 nmdc:mga0rr50_32695_c1 nmdc:mga0rr50_32695_c1_1008_1946 307
583 3300050515 nmdc:mga0a205_5488_c1 nmdc:mga0a205_5488_c1_8774_9754 307
584 3300050516 nmdc:mga0sz30_130319_c1 nmdc:mga0sz30_130319_c1_64_1014 307
585 3300053077 Ga0495601_0000786 Ga0495601_0000786_6429_7385 307
586 3300053084 Ga0495595_0035117 Ga0495595_0035117_374_1330 307
587 3300053085 Ga0495619_0002942 Ga0495619_0002942_9784_10740 307
588 3300054114 Ga0501084_0207999 Ga0501084_0207999_491_1444 307
589 iso_pu_bacteria 2687453257 2688066733 307
590 iso_pu_bacteria 2919085039 2919085466 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05544

Pro_racemase

Proline racemase

73

378

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j9x-assembly1.cif.gz_B crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline 0.9879 2 307
4k7x-assembly1.cif.gz_A-2 crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains 0.9862 2 305
2azp-assembly1.cif.gz_A crystal structure of pa1268 solved by sulfur sad 0.9812 2 307
4j9x-assembly1.cif.gz_B crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline 0.9751 2 307
2azp-assembly1.cif.gz_A crystal structure of pa1268 solved by sulfur sad 0.9749 2 307
ID Description Score Start End Superfamily
4jd7A01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9723 2 127 3.10.310.10
af_D3ZV91_5_159_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9374 1 119 3.10.310.10
af_Q868H8_133_298_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9334 128 270 3.10.310.10
4q60B02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9286 129 281 3.10.310.10
af_A0A0G2L1A2_13_139_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9197 1 116 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2X4UMG3-F1-model_v4 4-hydroxyproline epimerase (EC 5.1.1.8) 0.9969 2 119 GO:0047580
AF-A0A4Q3N3F3-F1-model_v4 deleted 0.9933 24 206
AF-A0A351G0Y7-F1-model_v4 Hydroxyproline-2-epimerase 0.992 1 269 GO:0003824
AF-A0A429M5E5-F1-model_v4 Hydroxyproline-2-epimerase 0.9917 86 231 GO:0047580
AF-Q1QU06-F1-model_v4 4-hydroxyproline 2-epimerase (4Hyp 2-epimerase) (4HypE) (EC 5.1.1.8) 0.9916 2 307 GO:0047580

Feature Viewer

pLDDT pTM Quality
95.03 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map