F466888

General Info

Members Datasets Scaffolds Average Seq Length
589 301 1178 213

Family's Representative Sequence

Representative Sequence 3300042127|Ga0450890_009538|Ga0450890_009538_86_778
Length 230
Sequence MVATRGGEVNHLVLQSRDMSRPAIRHLSTVDPVMRALIRRVGLCGLAVRNQQPFETLVRAIAHQQIHGRAAEAILGRFIALFPGRRFPRPEDIATVDARKMRRAGFSRAKIRSIKDIARKTRSGLIPTRAACHRLSDAELIERLIAVRGVGQWTVEMLLIFTLGRPDVLPVDDFGVREGFKIAYGRRKQPTPKQLRRYGARWEPYRSVAAWYLWRAAEKALHRKIEPKIT

Samples

Sample ID Description Type Environment
1 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
214 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
215 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
216 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
300 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
301 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 0.68
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450890_009538 3300042127 Bacteria 1245
2 JGI25406J46586_10000099 3300003203 Bacteria 38165
3 rootH2_10111164 3300003320 Bacteria 2842
4 JGI26141J51220_1000843 3300003503 Bacteria 1784
5 Ga0065707_10172669 3300005295 Bacteria 1473
6 Ga0070676_10000686 3300005328 Bacteria 16596
7 Ga0070683_100096318 3300005329 Bacteria 2783
8 Ga0070690_100089122 3300005330 Bacteria 2029
9 Ga0070670_100002483 3300005331 Bacteria 15208
10 Ga0068869_100000136 3300005334 Bacteria 35581
11 Ga0070666_10158420 3300005335 Bacteria 1582
12 Ga0070680_100000125 3300005336 Bacteria 45537
13 Ga0070680_100286399 3300005336 Bacteria 1396
14 Ga0070680_100348607 3300005336 Bacteria 1259
15 Ga0070680_100427691 3300005336 Bacteria 1130
16 Ga0070682_100000189 3300005337 Bacteria 46408
17 Ga0068868_100008402 3300005338 Bacteria 7390
18 Ga0070660_100001383 3300005339 Bacteria 16493
19 Ga0070689_100002437 3300005340 Bacteria 12158
20 Ga0070691_10005006 3300005341 Bacteria 6028
21 Ga0070687_100167368 3300005343 Bacteria 1305
22 Ga0070661_100001580 3300005344 Bacteria 15799
23 Ga0070692_10097358 3300005345 Bacteria 1608
24 Ga0070669_100031122 3300005353 Bacteria 3854
25 Ga0070671_100135014 3300005355 Bacteria 2080
26 Ga0070674_100604860 3300005356 Bacteria 927
27 Ga0070673_100036990 3300005364 Bacteria 3716
28 Ga0070659_100000654 3300005366 Bacteria 25209
29 Ga0070703_10238554 3300005406 Unclassified 732
30 Ga0070709_10347338 3300005434 Bacteria 1095
31 Ga0070714_100005704 3300005435 Bacteria 9536
32 Ga0070714_100006557 3300005435 Bacteria 9003
33 Ga0070714_100038894 3300005435 Bacteria 4002
34 Ga0070713_100006881 3300005436 Bacteria 7929
35 Ga0070713_100158069 3300005436 Bacteria 2021
36 Ga0070713_100630656 3300005436 Bacteria 1020
37 Ga0070713_101050774 3300005436 Unclassified 786
38 Ga0070710_10019165 3300005437 Bacteria 3532
39 Ga0070710_10453926 3300005437 Bacteria 869
40 Ga0070711_100037992 3300005439 Bacteria 3233
41 Ga0070711_100044436 3300005439 Unclassified 3016
42 Ga0070711_100214862 3300005439 Bacteria 1491
43 Ga0070705_100000888 3300005440 Bacteria 16673
44 Ga0070705_100080175 3300005440 Bacteria 2002
45 Ga0070705_100228425 3300005440 Bacteria 1293
46 Ga0070705_100494820 3300005440 Bacteria 927
47 Ga0070700_100265911 3300005441 Bacteria 1237
48 Ga0070694_100000248 3300005444 Bacteria 28528
49 Ga0070694_100003274 3300005444 Bacteria 9672
50 Ga0070694_100007836 3300005444 Bacteria 6519
51 Ga0070694_100018022 3300005444 Bacteria 4474
52 Ga0070708_100004788 3300005445 Bacteria 10671
53 Ga0070708_100020227 3300005445 Bacteria 5609
54 Ga0070708_100056738 3300005445 Unclassified 3485
55 Ga0070708_100062209 3300005445 Bacteria 3337
56 Ga0070708_100122800 3300005445 Bacteria 2397
57 Ga0070708_100132640 3300005445 Bacteria 2306
58 Ga0070663_100134426 3300005455 Bacteria 1882
59 Ga0070678_100255085 3300005456 Bacteria 1472
60 Ga0070662_100015097 3300005457 Bacteria 5167
61 Ga0070662_100023844 3300005457 Bacteria 4208
62 Ga0070662_100351382 3300005457 Bacteria 1208
63 Ga0070681_10063800 3300005458 Bacteria 3656
64 Ga0070681_10293918 3300005458 Bacteria 1534
65 Ga0070681_10305621 3300005458 Bacteria 1500
66 Ga0068867_100001823 3300005459 Bacteria 14847
67 Ga0070706_100011403 3300005467 Bacteria 8256
68 Ga0070706_100015825 3300005467 Bacteria 6965
69 Ga0070706_100018969 3300005467 Bacteria 6344
70 Ga0070706_100024202 3300005467 Bacteria 5589
71 Ga0070706_100060162 3300005467 Bacteria 3506
72 Ga0070706_100095782 3300005467 Bacteria 2755
73 Ga0070706_100118671 3300005467 Bacteria 2465
74 Ga0070706_100125094 3300005467 Bacteria 2397
75 Ga0070706_100201241 3300005467 Bacteria 1860
76 Ga0070707_100020752 3300005468 Bacteria 6202
77 Ga0070707_100030175 3300005468 Bacteria 5159
78 Ga0070707_100035890 3300005468 Bacteria 4730
79 Ga0070707_100046446 3300005468 Bacteria 4156
80 Ga0070707_100073209 3300005468 Bacteria 3303
81 Ga0070707_100090236 3300005468 Bacteria 2966
82 Ga0070707_100132676 3300005468 Bacteria 2422
83 Ga0070707_100582979 3300005468 Bacteria 1081
84 Ga0070698_100003046 3300005471 Bacteria 18470
85 Ga0070698_100022957 3300005471 Bacteria 6524
86 Ga0070698_100032478 3300005471 Bacteria 5407
87 Ga0070698_100044644 3300005471 Bacteria 4536
88 Ga0070698_100077567 3300005471 Bacteria 3322
89 Ga0070698_100137415 3300005471 Bacteria 2397
90 Ga0070699_100007687 3300005518 Bacteria 9372
91 Ga0070699_100020304 3300005518 Bacteria 5729
92 Ga0070699_100041553 3300005518 Bacteria 3980
93 Ga0070699_100082768 3300005518 Bacteria 2798
94 Ga0070699_100095575 3300005518 Bacteria 2602
95 Ga0070699_100416964 3300005518 Bacteria 1215
96 Ga0070679_100006871 3300005530 Bacteria 10610
97 Ga0070679_100536216 3300005530 Bacteria 1114
98 Ga0070684_100342223 3300005535 Bacteria 1375
99 Ga0070697_100002527 3300005536 Bacteria 14083
100 Ga0070697_100032923 3300005536 Bacteria 4173
101 Ga0070697_100064720 3300005536 Bacteria 2986
102 Ga0070697_100069599 3300005536 Bacteria 2882
103 Ga0070697_100118393 3300005536 Bacteria 2213
104 Ga0068853_100012733 3300005539 Bacteria 6849
105 Ga0070672_100517973 3300005543 Bacteria 1033
106 Ga0070695_100002444 3300005545 Bacteria 10682
107 Ga0070695_100009206 3300005545 Bacteria 5871
108 Ga0070695_100602814 3300005545 Unclassified 862
109 Ga0070695_100754272 3300005545 Bacteria 776
110 Ga0070696_100000114 3300005546 Bacteria 41488
111 Ga0070696_100364786 3300005546 Unclassified 1122
112 Ga0070693_100000119 3300005547 Bacteria 35136
113 Ga0070704_100000769 3300005549 Bacteria 15800
114 Ga0070704_100170895 3300005549 Unclassified 1729
115 Ga0070704_100274187 3300005549 Bacteria 1395
116 Ga0068855_100000315 3300005563 Bacteria 60189
117 Ga0068855_100792411 3300005563 Bacteria 1008
118 Ga0070664_100002564 3300005564 Bacteria 14657
119 Ga0068854_100000615 3300005578 Bacteria 21032
120 Ga0068856_100082394 3300005614 Bacteria 3193
121 Ga0068856_100131808 3300005614 Bacteria 2504
122 Ga0070702_100641401 3300005615 Bacteria 802
123 Ga0068852_100406591 3300005616 Bacteria 1340
124 Ga0068859_100200239 3300005617 Bacteria 2081
125 Ga0068859_100360144 3300005617 Bacteria 1549
126 Ga0068864_100018595 3300005618 Bacteria 5806
127 Ga0068861_100002751 3300005719 Bacteria 11530
128 Ga0068870_10000338 3300005840 Bacteria 17504
129 Ga0068863_100005064 3300005841 Bacteria 13000
130 Ga0068863_100077067 3300005841 Bacteria 3154
131 Ga0068863_100147574 3300005841 Bacteria 2250
132 Ga0068863_100601904 3300005841 Bacteria 1088
133 Ga0068858_100125993 3300005842 Bacteria 2399
134 Ga0068860_100004554 3300005843 Bacteria 14146
135 Ga0081455_10002726 3300005937 Bacteria 20849
136 Ga0081539_10000322 3300005985 Bacteria 106875
137 Ga0070717_10100239 3300006028 Bacteria 2459
138 Ga0070717_10627939 3300006028 Bacteria 975
139 Ga0070717_10692578 3300006028 Bacteria 926
140 Ga0070715_10162293 3300006163 Unclassified 1105
141 Ga0070716_100113613 3300006173 Bacteria 1682
142 Ga0070712_100010489 3300006175 Bacteria 5849
143 Ga0070712_100115942 3300006175 Unclassified 2008
144 Ga0070712_100250063 3300006175 Unclassified 1416
145 Ga0070712_100627223 3300006175 Bacteria 912
146 Ga0097621_100169120 3300006237 Bacteria 1883
147 Ga0075428_100001686 3300006844 Bacteria 23553
148 Ga0075428_100051690 3300006844 Bacteria 4506
149 Ga0075428_100410477 3300006844 Bacteria 1451
150 Ga0075430_100000034 3300006846 Bacteria 70046
151 Ga0075430_100010092 3300006846 Bacteria 7991
152 Ga0075430_100109966 3300006846 Bacteria 2298
153 Ga0075431_100000968 3300006847 Bacteria 25514
154 Ga0075431_100008260 3300006847 Bacteria 10407
155 Ga0075431_100017344 3300006847 Bacteria 7318
156 Ga0075431_100827275 3300006847 Bacteria 898
157 Ga0075433_10004231 3300006852 Bacteria 11143
158 Ga0075433_10029369 3300006852 Bacteria 4683
159 Ga0075433_10095734 3300006852 Bacteria 2627
160 Ga0075433_10133902 3300006852 Bacteria 2202
161 Ga0075433_10167735 3300006852 Bacteria 1954
162 Ga0075433_10453103 3300006852 Bacteria 1131
163 Ga0075434_100003291 3300006871 Bacteria 14444
164 Ga0075434_100004886 3300006871 Bacteria 12144
165 Ga0075434_100006301 3300006871 Bacteria 10871
166 Ga0075434_100016191 3300006871 Bacteria 7166
167 Ga0075434_100083732 3300006871 Bacteria 3187
168 Ga0075434_100175070 3300006871 Bacteria 2165
169 Ga0075429_100005440 3300006880 Bacteria 10967
170 Ga0075429_100352511 3300006880 Bacteria 1288
171 Ga0075429_100539003 3300006880 Bacteria 1023
172 Ga0068865_100420345 3300006881 Bacteria 1099
173 Ga0075436_100059326 3300006914 Bacteria 2643
174 Ga0075436_100089458 3300006914 Bacteria 2139
175 Ga0075436_100107556 3300006914 Bacteria 1945
176 Ga0097620_100200244 3300006931 Bacteria 2081
177 Ga0097620_100360151 3300006931 Bacteria 1549
178 Ga0075435_100004255 3300007076 Bacteria 9834
179 Ga0075435_100079903 3300007076 Bacteria 2684
180 Ga0075435_100155561 3300007076 Bacteria 1923
181 Ga0075435_100384356 3300007076 Bacteria 1206
182 Ga0099794_10011476 3300007265 Bacteria 3793
183 Ga0099794_10080705 3300007265 Unclassified 1604
184 Ga0111539_10002043 3300009094 Bacteria 26984
185 Ga0111539_10011105 3300009094 Bacteria 11331
186 Ga0105245_10182043 3300009098 Bacteria 2008
187 Ga0105245_10239626 3300009098 Bacteria 1757
188 Ga0114129_10000394 3300009147 Bacteria 50959
189 Ga0114129_10007963 3300009147 Bacteria 15085
190 Ga0114129_10013280 3300009147 Bacteria 11735
191 Ga0114129_10080259 3300009147 Bacteria 4535
192 Ga0114129_10111037 3300009147 Bacteria 3784
193 Ga0114129_10211840 3300009147 Bacteria 2619
194 Ga0114129_11036493 3300009147 Bacteria 1031
195 Ga0105243_11062289 3300009148 Bacteria 816
196 Ga0105241_10007101 3300009174 Bacteria 8247
197 Ga0105241_10466561 3300009174 Bacteria 1120
198 Ga0105242_10259877 3300009176 Unclassified 1568
199 Ga0105248_10453308 3300009177 Unclassified 1445
200 Ga0105237_10206187 3300009545 Bacteria 1966
201 Ga0105239_10287205 3300010375 Bacteria 1852
202 Ga0105246_10109144 3300011119 Bacteria 2029
203 Ga0157373_10000317 3300013100 Bacteria 38873
204 Ga0157371_10148630 3300013102 Bacteria 1671
205 Ga0157370_10386404 3300013104 Bacteria 1289
206 Ga0157369_10004085 3300013105 Bacteria 17279
207 Ga0157378_10141278 3300013297 Bacteria 2236
208 Ga0163162_10134498 3300013306 Bacteria 2583
209 Ga0163162_10188516 3300013306 Bacteria 2190
210 Ga0157372_10002617 3300013307 Bacteria 19479
211 Ga0157375_10447324 3300013308 Bacteria 1458
212 Ga0163163_10040391 3300014325 Bacteria 4555
213 Ga0163163_10202626 3300014325 Bacteria 2033
214 Ga0157380_10132956 3300014326 Bacteria 2125
215 Ga0157380_11461037 3300014326 Bacteria 736
216 Ga0182008_10133214 3300014497 Bacteria 1240
217 Ga0157377_10014084 3300014745 Bacteria 4063
218 Ga0157376_10107657 3300014969 Bacteria 2448
219 Ga0157376_11063172 3300014969 Bacteria 834
220 Ga0213872_10000850 3300021361 Bacteria 22085
221 Ga0213872_10168890 3300021361 Bacteria 949
222 Ga0213874_10024748 3300021377 Bacteria 1687
223 Ga0213875_10005078 3300021388 Bacteria 7123
224 Ga0213871_10072592 3300021441 Bacteria 975
225 Ga0207692_10016937 3300025898 Bacteria 3239
226 Ga0207692_10031088 3300025898 Bacteria 2553
227 Ga0207647_10060037 3300025904 Bacteria 2325
228 Ga0207685_10212042 3300025905 Unclassified 916
229 Ga0207699_10069573 3300025906 Bacteria 2146
230 Ga0207699_10225468 3300025906 Bacteria 1281
231 Ga0207699_10302160 3300025906 Bacteria 1118
232 Ga0207645_10000442 3300025907 Bacteria 34471
233 Ga0207643_10000296 3300025908 Bacteria 34571
234 Ga0207684_10000406 3300025910 Bacteria 57724
235 Ga0207684_10010296 3300025910 Bacteria 8234
236 Ga0207684_10013022 3300025910 Bacteria 7200
237 Ga0207684_10027617 3300025910 Bacteria 4834
238 Ga0207684_10069539 3300025910 Bacteria 2992
239 Ga0207684_10099132 3300025910 Bacteria 2488
240 Ga0207684_10268985 3300025910 Bacteria 1470
241 Ga0207684_10286228 3300025910 Bacteria 1421
242 Ga0207684_10332773 3300025910 Bacteria 1308
243 Ga0207654_10007397 3300025911 Bacteria 5530
244 Ga0207654_10265286 3300025911 Bacteria 1156
245 Ga0207707_10000443 3300025912 Bacteria 43041
246 Ga0207707_10177862 3300025912 Bacteria 1858
247 Ga0207707_10331654 3300025912 Bacteria 1313
248 Ga0207671_10879250 3300025914 Bacteria 709
249 Ga0207693_10001194 3300025915 Bacteria 23199
250 Ga0207693_10059163 3300025915 Bacteria 3001
251 Ga0207693_10384924 3300025915 Bacteria 1097
252 Ga0207663_10013015 3300025916 Unclassified 4512
253 Ga0207660_10000319 3300025917 Bacteria 31395
254 Ga0207657_10000095 3300025919 Bacteria 85098
255 Ga0207652_10000761 3300025921 Bacteria 30972
256 Ga0207646_10000441 3300025922 Bacteria 55513
257 Ga0207646_10036998 3300025922 Bacteria 4402
258 Ga0207646_10071916 3300025922 Bacteria 3089
259 Ga0207646_10093460 3300025922 Unclassified 2693
260 Ga0207646_10128760 3300025922 Bacteria 2277
261 Ga0207646_10132003 3300025922 Bacteria 2248
262 Ga0207646_10151523 3300025922 Bacteria 2091
263 Ga0207646_10253135 3300025922 Bacteria 1591
264 Ga0207646_10742328 3300025922 Bacteria 876
265 Ga0207681_10027855 3300025923 Bacteria 3658
266 Ga0207681_10568478 3300025923 Bacteria 934
267 Ga0207650_10088261 3300025925 Bacteria 2364
268 Ga0207687_10049477 3300025927 Bacteria 2923
269 Ga0207700_10083640 3300025928 Bacteria 2499
270 Ga0207700_10177401 3300025928 Bacteria 1781
271 Ga0207700_10287155 3300025928 Bacteria 1417
272 Ga0207700_10420989 3300025928 Bacteria 1173
273 Ga0207700_10502323 3300025928 Bacteria 1073
274 Ga0207664_10032552 3300025929 Bacteria 3998
275 Ga0207664_10043189 3300025929 Bacteria 3524
276 Ga0207664_10061950 3300025929 Bacteria 2986
277 Ga0207664_10096739 3300025929 Bacteria 2431
278 Ga0207664_10312163 3300025929 Bacteria 1385
279 Ga0207690_10003975 3300025932 Bacteria 8740
280 Ga0207706_10001514 3300025933 Bacteria 23029
281 Ga0207706_10100689 3300025933 Bacteria 2542
282 Ga0207706_10501891 3300025933 Bacteria 1047
283 Ga0207686_10282660 3300025934 Unclassified 1225
284 Ga0207670_10242451 3300025936 Bacteria 1389
285 Ga0207665_10001563 3300025939 Bacteria 15426
286 Ga0207691_10123058 3300025940 Bacteria 2296
287 Ga0207691_10323648 3300025940 Bacteria 1322
288 Ga0207711_10548586 3300025941 Bacteria 1078
289 Ga0207689_10000121 3300025942 Bacteria 65023
290 Ga0207661_10107844 3300025944 Bacteria 2350
291 Ga0207679_10002239 3300025945 Bacteria 11951
292 Ga0207667_10003214 3300025949 Bacteria 20174
293 Ga0207667_10640785 3300025949 Bacteria 1069
294 Ga0207651_10025193 3300025960 Bacteria 3695
295 Ga0207712_10279623 3300025961 Bacteria 1362
296 Ga0207640_10003488 3300025981 Bacteria 8470
297 Ga0207677_10020418 3300026023 Bacteria 4022
298 Ga0207703_10116854 3300026035 Bacteria 2284
299 Ga0207639_10006785 3300026041 Bacteria 7794
300 Ga0207678_10051048 3300026067 Bacteria 3571
301 Ga0207708_10370643 3300026075 Bacteria 1179
302 Ga0207702_10001684 3300026078 Bacteria 21826
303 Ga0207702_10285041 3300026078 Bacteria 1563
304 Ga0207641_10049557 3300026088 Bacteria 3549
305 Ga0207641_10370443 3300026088 Unclassified 1369
306 Ga0207648_10002571 3300026089 Bacteria 19440
307 Ga0207648_10600441 3300026089 Bacteria 1014
308 Ga0207676_10009122 3300026095 Bacteria 7064
309 Ga0207674_10000307 3300026116 Bacteria 62207
310 Ga0207675_100003470 3300026118 Bacteria 15404
311 Ga0207675_100782009 3300026118 Bacteria 967
312 Ga0207683_10121784 3300026121 Bacteria 2343
313 Ga0207698_10865287 3300026142 Bacteria 909
314 Ga0209969_1002012 3300027360 Bacteria 2804
315 Ga0209967_1003130 3300027364 Bacteria 2169
316 Ga0209995_1001091 3300027471 Bacteria 4169
317 Ga0209999_1002220 3300027543 Bacteria 3408
318 Ga0209982_1004158 3300027552 Bacteria 2069
319 Ga0209983_1004198 3300027665 Bacteria 3039
320 Ga0209588_1002172 3300027671 Bacteria 5295
321 Ga0209971_1000026 3300027682 Bacteria 54898
322 Ga0209998_10000060 3300027717 Bacteria 45561
323 Ga0209974_10004112 3300027876 Bacteria 5199
324 Ga0207428_10000263 3300027907 Bacteria 71650
325 Ga0207428_10034101 3300027907 Bacteria 4174
326 Ga0268265_10008453 3300028380 Bacteria 6953
327 Ga0268265_10255455 3300028380 Bacteria 1555
328 Ga0268264_10003751 3300028381 Bacteria 13049
329 Ga0268264_10580329 3300028381 Bacteria 1103
330 Ga0268264_10932196 3300028381 Bacteria 873
331 Ga0265334_10000010 3300028573 Bacteria 188179
332 Ga0265334_10103364 3300028573 Bacteria 1029
333 Ga0265338_10057941 3300028800 Bacteria 3423
334 Ga0265331_10020582 3300031250 Bacteria 3385
335 Ga0265327_10000878 3300031251 Bacteria 44430
336 Ga0307408_100064502 3300031548 Bacteria 2683
337 Ga0265313_10000068 3300031595 Bacteria 100563
338 Ga0307407_10013409 3300031903 Bacteria 3978
339 Ga0307409_100107156 3300031995 Bacteria 2334
340 Ga0307416_100450123 3300032002 Bacteria 1340
341 Ga0307414_10000023 3300032004 Bacteria 208037
342 Ga0307414_10014131 3300032004 Bacteria 4772
343 Ga0307414_10507939 3300032004 Bacteria 1068
344 Ga0373948_0008621 3300034817 Bacteria 1740
345 Ga0373940_0040834 3300035088 Bacteria 1274
346 Ga0373940_0045683 3300035088 Unclassified 1216
347 Ga0373949_0011658 3300035090 Bacteria 1938
348 Ga0373951_0002768 3300035091 Bacteria 4387
349 Ga0373923_0096778 3300035111 Bacteria 1297
350 Ga0373932_0005014 3300035112 Bacteria 3118
351 Ga0373953_0224151 3300035117 Bacteria 815
352 Ga0373943_0055707 3300035170 Bacteria 1959
353 Ga0373946_0018726 3300035171 Bacteria 2661
354 Ga0373955_0044589 3300035172 Bacteria 2390
355 Ga0373955_0078450 3300035172 Bacteria 1861
356 Ga0373962_0026881 3300035242 Bacteria 1554
357 Ga0373962_0071020 3300035242 Bacteria 1040
358 Ga0373924_0036915 3300035410 Unclassified 1987
359 Ga0373924_0161144 3300035410 Bacteria 984
360 Ga0373931_0003993 3300035691 Bacteria 6682
361 Ga0373931_0468991 3300035691 Bacteria 808
362 Ga0373927_0034321 3300035695 Bacteria 3301
363 Ga0373927_0073303 3300035695 Bacteria 2217
364 Ga0373927_0083304 3300035695 Bacteria 2074
365 Ga0373933_0002430 3300035724 Bacteria 10506
366 Ga0373933_0032458 3300035724 Bacteria 3035
367 Ga0373947_0038500 3300035725 Bacteria 2841
368 Ga0373937_0007721 3300036401 Bacteria 9321
369 Ga0373937_0075716 3300036401 Bacteria 3107
370 Ga0373937_0107746 3300036401 Bacteria 2590
371 Ga0373937_0509991 3300036401 Bacteria 1143
372 Ga0373937_0600564 3300036401 Bacteria 1045
373 Ga0373925_0753616 3300037068 Bacteria 803
374 Ga0395900_0058810 3300037418 Bacteria 3957
375 Ga0395898_0002962 3300037466 Bacteria 19296
376 Ga0395905_0428255 3300037471 Bacteria 1220
377 Ga0436364_0407262 3300037853 Bacteria 2324
378 Ga0436364_0590706 3300037853 Bacteria 3245
379 Ga0436364_1118507 3300037853 Bacteria 39511
380 Ga0436364_1243781 3300037853 Bacteria 4934
381 Ga0395901_0001791 3300038443 Bacteria 22154
382 Ga0436365_0080955 3300039437 Bacteria 2124
383 Ga0436365_0708594 3300039437 Bacteria 1215
384 Ga0436365_1438780 3300039437 Bacteria 3817
385 Ga0436360_0068333 3300039438 Bacteria 759
386 Ga0436360_0364829 3300039438 Bacteria 1774
387 Ga0436360_0639665 3300039438 Bacteria 2705
388 Ga0436360_0929237 3300039438 Bacteria 2675
389 Ga0436360_1260834 3300039438 Bacteria 8848
390 Ga0436361_0461669 3300039447 Bacteria 17404
391 Ga0436361_1044226 3300039447 Bacteria 4402
392 Ga0436361_1065280 3300039447 Bacteria 4984
393 Ga0436361_1164679 3300039447 Bacteria 942
394 Ga0436363_0147135 3300039450 Bacteria 2131
395 Ga0436362_0208546 3300039453 Bacteria 2536
396 Ga0436362_0641270 3300039453 Bacteria 829
397 Ga0436362_0936441 3300039453 Bacteria 1875
398 Ga0439437_014634 3300042000 Bacteria 917
399 Ga0439448_0004055 3300042005 Bacteria 4114
400 Ga0439448_0093160 3300042005 Bacteria 1019
401 Ga0450889_008434 3300042144 Bacteria 1046
402 Ga0450889_010140 3300042144 Bacteria 970
403 Ga0439458_0008348 3300042157 Bacteria 2306
404 Ga0439459_0002786 3300042438 Bacteria 2725
405 Ga0439460_0004062 3300042461 Bacteria 3554
406 Ga0451577_0005046 3300042876 Bacteria 13638
407 Ga0451577_0014218 3300042876 Bacteria 7419
408 Ga0451577_0043598 3300042876 Bacteria 4019
409 Ga0451577_0047221 3300042876 Bacteria 3850
410 Ga0451577_0231661 3300042876 Bacteria 1671
411 Ga0451577_0404344 3300042876 Unclassified 1239
412 Ga0453683_0109398 3300044673 Bacteria 1737
413 Ga0453684_0003900 3300044712 Bacteria 32765
414 Ga0453684_0022770 3300044712 Bacteria 9277
415 Ga0453684_0081547 3300044712 Bacteria 4034
416 Ga0453684_0188782 3300044712 Bacteria 2412
417 Ga0453684_0475131 3300044712 Bacteria 1388
418 Ga0453684_0898547 3300044712 Bacteria 949
419 Ga0453684_1101480 3300044712 Bacteria 839
420 Ga0451576_0006407 3300045051 Bacteria 14439
421 Ga0451576_0018358 3300045051 Bacteria 7670
422 Ga0451576_0022521 3300045051 Bacteria 6831
423 Ga0451576_0062109 3300045051 Unclassified 3895
424 Ga0451576_0285729 3300045051 Bacteria 1724
425 Ga0451576_0308229 3300045051 Bacteria 1656
426 Ga0451576_0829917 3300045051 Bacteria 970
427 Ga0451576_0872432 3300045051 Bacteria 944
428 Ga0466958_0323274 3300045836 Bacteria 992
429 Ga0466967_0563898 3300045976 Bacteria 1122
430 Ga0495592_0048204 3300046454 Bacteria 3170
431 Ga0495629_0182591 3300046459 Bacteria 1454
432 Ga0495651_0038654 3300046462 Bacteria 3717
433 Ga0495651_0114841 3300046462 Bacteria 1986
434 Ga0495653_0315388 3300046463 Bacteria 1015
435 Ga0495580_0183526 3300046472 Bacteria 1444
436 Ga0495664_0022181 3300046477 Bacteria 3677
437 Ga0495594_0360833 3300046499 Bacteria 827
438 Ga0495608_0037812 3300046511 Bacteria 3244
439 Ga0495628_0594699 3300046516 Bacteria 791
440 Ga0495630_0007282 3300046517 Bacteria 7895
441 Ga0495630_0311047 3300046517 Bacteria 1204
442 Ga0495666_0253254 3300046526 Unclassified 802
443 Ga0495640_0039828 3300046533 Bacteria 3295
444 Ga0495640_0065052 3300046533 Bacteria 2464
445 Ga0495587_0003018 3300046536 Bacteria 11256
446 Ga0495587_0271008 3300046536 Bacteria 952
447 Ga0495621_0204444 3300046539 Bacteria 795
448 Ga0495645_0001664 3300046543 Bacteria 15096
449 Ga0495645_0053962 3300046543 Unclassified 2921
450 Ga0495645_0124292 3300046543 Bacteria 1814
451 Ga0495667_0015846 3300046559 Bacteria 5096
452 Ga0495667_0018449 3300046559 Bacteria 4713
453 Ga0495667_0118980 3300046559 Bacteria 1706
454 Ga0495656_0276157 3300046615 Bacteria 855
455 Ga0495635_0079429 3300046663 Bacteria 2245
456 Ga0495657_0382996 3300046675 Unclassified 829
457 Ga0495599_0032858 3300046678 Bacteria 3258
458 Ga0495623_0043011 3300046679 Bacteria 2875
459 Ga0495647_0205550 3300046681 Unclassified 865
460 Ga0495604_0072598 3300047317 Bacteria 2600
461 Ga0495604_0260767 3300047317 Bacteria 1178
462 Ga0495674_0057170 3300047319 Bacteria 3415
463 Ga0495674_1157316 3300047319 Bacteria 586
464 Ga0495680_0090750 3300047322 Bacteria 2291
465 Ga0495680_0169850 3300047322 Bacteria 1579
466 Ga0495675_0003966 3300047444 Bacteria 8973
467 Ga0495675_0091005 3300047444 Bacteria 1915
468 Ga0495684_0351686 3300047471 Bacteria 1046
469 Ga0495602_0001287 3300048088 Bacteria 24718
470 Ga0495602_0485273 3300048088 Bacteria 866
471 Ga0496102_0019312 3300048905 Bacteria 6005
472 Ga0496102_0028295 3300048905 Bacteria 5005
473 Ga0496106_0523505 3300048909 Bacteria 952
474 Ga0496112_0160940 3300048915 Bacteria 2211
475 Ga0496120_0029220 3300048923 Bacteria 3367
476 Ga0501031_0095948 3300049568 Bacteria 1935
477 Ga0501032_0070906 3300049569 Bacteria 2323
478 Ga0501036_0122854 3300049572 Bacteria 2192
479 Ga0501036_0216659 3300049572 Bacteria 1608
480 Ga0501037_0036716 3300049573 Bacteria 3610
481 Ga0501037_0188079 3300049573 Bacteria 1463
482 Ga0501038_0038676 3300049574 Bacteria 4176
483 Ga0501039_0016664 3300049575 Bacteria 5629
484 Ga0501039_0243472 3300049575 Bacteria 1414
485 Ga0501040_0003929 3300049576 Bacteria 9646
486 Ga0501040_0016517 3300049576 Bacteria 4888
487 Ga0501040_0325181 3300049576 Bacteria 1100
488 Ga0501041_0031294 3300049577 Bacteria 3215
489 Ga0501041_0161618 3300049577 Bacteria 1400
490 Ga0501042_0000025 3300049578 Bacteria 48562
491 Ga0501042_0014495 3300049578 Bacteria 5383
492 Ga0501042_0314968 3300049578 Bacteria 1130
493 Ga0501046_0000526 3300049580 Bacteria 37973
494 Ga0501046_0075922 3300049580 Bacteria 2605
495 Ga0501046_0193432 3300049580 Bacteria 1516
496 Ga0501046_0470728 3300049580 Bacteria 902
497 Ga0501047_0273336 3300049581 Bacteria 1536
498 Ga0501048_0320326 3300049582 Bacteria 1104
499 Ga0501048_0348993 3300049582 Bacteria 1055
500 Ga0501067_0090044 3300049583 Bacteria 1703
501 Ga0501068_0105321 3300049584 Bacteria 1750
502 Ga0501068_0350532 3300049584 Bacteria 949
503 Ga0501069_0257322 3300049585 Bacteria 1019
504 Ga0501072_0092712 3300049588 Bacteria 2399
505 Ga0501072_0129164 3300049588 Bacteria 2014
506 Ga0501072_0156027 3300049588 Bacteria 1820
507 Ga0501072_0618698 3300049588 Bacteria 853
508 Ga0501074_0083016 3300049590 Bacteria 2297
509 Ga0501075_0065265 3300049591 Bacteria 2746
510 Ga0501075_0100723 3300049591 Bacteria 2194
511 Ga0501076_0086601 3300049592 Bacteria 2518
512 Ga0501076_0234204 3300049592 Bacteria 1501
513 Ga0501077_0003730 3300049593 Bacteria 9166
514 Ga0501077_0014977 3300049593 Bacteria 4876
515 Ga0501077_0155128 3300049593 Bacteria 1453
516 Ga0501079_0005165 3300049741 Bacteria 9705
517 Ga0501079_0009918 3300049741 Bacteria 7228
518 Ga0501079_0185219 3300049741 Bacteria 1625
519 Ga0501079_0211211 3300049741 Bacteria 1516
520 Ga0501080_0022229 3300049742 Bacteria 5875
521 Ga0501080_0357573 3300049742 Bacteria 1318
522 Ga0501080_0588328 3300049742 Bacteria 989
523 Ga0501081_0008191 3300049743 Bacteria 6783
524 Ga0501081_0043190 3300049743 Bacteria 3091
525 Ga0501081_0215724 3300049743 Bacteria 1394
526 Ga0501083_0022141 3300049744 Bacteria 4411
527 Ga0501280_000521 3300049776 Bacteria 9054
528 Ga0501035_0068350 3300049822 Bacteria 3150
529 Ga0501045_0000034 3300049824 Bacteria 58823
530 Ga0501045_0070190 3300049824 Bacteria 2577
531 Ga0501045_0503628 3300049824 Bacteria 899
532 nmdc:mga05p37_109769_c1 3300050507 Bacteria 3394
533 nmdc:mga05p37_111758_c1 3300050507 Bacteria 3360
534 nmdc:mga05p37_48008_c1 3300050507 Bacteria 5251
535 nmdc:mga05p37_675257_c1 3300050507 Bacteria 1152
536 nmdc:mga05p37_9340_c1 3300050507 Bacteria 11601
537 nmdc:mga05p37_98293_c1 3300050507 Bacteria 3605
538 nmdc:mga05p37_98838_c1 3300050507 Bacteria 3595
539 nmdc:mga09592_461755_c1 3300050508 Bacteria 1095
540 nmdc:mga09592_49479_c1 3300050508 Bacteria 3544
541 nmdc:mga09592_932_c1 3300050508 Bacteria 22961
542 nmdc:mga0qj67_152824_c1 3300050509 Bacteria 1873
543 nmdc:mga0qj67_28173_c1 3300050509 Bacteria 4359
544 nmdc:mga0qj67_5855_c1 3300050509 Bacteria 9001
545 nmdc:mga06r32_2967_c1 3300050510 Bacteria 15203
546 nmdc:mga06r32_357116_c1 3300050510 Bacteria 1446
547 nmdc:mga08y16_21023_c1 3300050511 Bacteria 6890
548 nmdc:mga08y16_618_c1 3300050511 Bacteria 33199
549 nmdc:mga0n895_12419_c1 3300050512 Bacteria 7640
550 nmdc:mga0n895_187091_c1 3300050512 Bacteria 2102
551 nmdc:mga0n895_18902_c1 3300050512 Bacteria 6391
552 nmdc:mga0n895_483053_c1 3300050512 Bacteria 1249
553 nmdc:mga0n895_90686_c1 3300050512 Bacteria 3059
554 nmdc:mga0rr50_1063758_c1 3300050513 Bacteria 689
555 nmdc:mga0rr50_124621_c1 3300050513 Bacteria 2055
556 nmdc:mga0rr50_138812_c1 3300050513 Bacteria 1954
557 nmdc:mga0rr50_207055_c1 3300050513 Bacteria 1615
558 nmdc:mga0rr50_324773_c1 3300050513 Bacteria 1291
559 nmdc:mga0rr50_53356_c1 3300050513 Bacteria 3007
560 nmdc:mga0rr50_83516_c1 3300050513 Bacteria 2470
561 nmdc:mga0rr50_90033_c1 3300050513 Bacteria 2387
562 nmdc:mga08x19_27554_c1 3300050514 Bacteria 3554
563 nmdc:mga08x19_4209_c1 3300050514 Bacteria 8529
564 nmdc:mga08x19_596029_c1 3300050514 Bacteria 783
565 nmdc:mga08x19_930018_c1 3300050514 Bacteria 618
566 nmdc:mga0a205_158466_c1 3300050515 Unclassified 2161
567 nmdc:mga0a205_16044_c1 3300050515 Bacteria 7011
568 nmdc:mga0a205_19301_c1 3300050515 Bacteria 6425
569 nmdc:mga0a205_232916_c1 3300050515 Bacteria 1724
570 nmdc:mga0a205_46906_c1 3300050515 Bacteria 4168
571 nmdc:mga0a205_74937_c1 3300050515 Bacteria 3270
572 Ga0495601_0203375 3300053077 Bacteria 1294
573 Ga0495612_0000560 3300053078 Bacteria 14939
574 Ga0495595_0044108 3300053084 Bacteria 2048
575 Ga0495619_0047034 3300053085 Bacteria 2839
576 Ga0495619_0072794 3300053085 Bacteria 2302
577 Ga0500616_0188038 3300053153 Bacteria 924
578 Ga0501084_0004032 3300054114 Bacteria 11961
579 Ga0501084_0105382 3300054114 Bacteria 2368
580 Ga0501082_0008066 3300060353 Bacteria 9086
581 Ga0501082_0031472 3300060353 Bacteria 4575
582 Ga0501082_0273247 3300060353 Bacteria 1471
583 Ga0501082_0357737 3300060353 Bacteria 1273
584 Ga0501082_0794613 3300060353 Bacteria 828
585 Ga0530510_0009846 3300061734 Bacteria 6706
586 Ga0530510_0171861 3300061734 Bacteria 1605
587 2909402569 2909399089 Bacteria 3922598
588 641334478 641228493 Bacteria 3999591
589 643391017 643348555 Bacteria 3914947
590 Ga0450890_009538
591 JGI25406J46586_10000099
592 rootH2_10111164
593 JGI26141J51220_1000843
594 Ga0065707_10172669
595 Ga0070676_10000686
596 Ga0070683_100096318
597 Ga0070690_100089122
598 Ga0070670_100002483
599 Ga0068869_100000136
600 Ga0070666_10158420
601 Ga0070680_100000125
602 Ga0070680_100286399
603 Ga0070680_100348607
604 Ga0070680_100427691
605 Ga0070682_100000189
606 Ga0068868_100008402
607 Ga0070660_100001383
608 Ga0070689_100002437
609 Ga0070691_10005006
610 Ga0070687_100167368
611 Ga0070661_100001580
612 Ga0070692_10097358
613 Ga0070669_100031122
614 Ga0070671_100135014
615 Ga0070674_100604860
616 Ga0070673_100036990
617 Ga0070659_100000654
618 Ga0070703_10238554
619 Ga0070709_10347338
620 Ga0070714_100005704
621 Ga0070714_100006557
622 Ga0070714_100038894
623 Ga0070713_100006881
624 Ga0070713_100158069
625 Ga0070713_100630656
626 Ga0070713_101050774
627 Ga0070710_10019165
628 Ga0070710_10453926
629 Ga0070711_100037992
630 Ga0070711_100044436
631 Ga0070711_100214862
632 Ga0070705_100000888
633 Ga0070705_100080175
634 Ga0070705_100228425
635 Ga0070705_100494820
636 Ga0070700_100265911
637 Ga0070694_100000248
638 Ga0070694_100003274
639 Ga0070694_100007836
640 Ga0070694_100018022
641 Ga0070708_100004788
642 Ga0070708_100020227
643 Ga0070708_100056738
644 Ga0070708_100062209
645 Ga0070708_100122800
646 Ga0070708_100132640
647 Ga0070663_100134426
648 Ga0070678_100255085
649 Ga0070662_100015097
650 Ga0070662_100023844
651 Ga0070662_100351382
652 Ga0070681_10063800
653 Ga0070681_10293918
654 Ga0070681_10305621
655 Ga0068867_100001823
656 Ga0070706_100011403
657 Ga0070706_100015825
658 Ga0070706_100018969
659 Ga0070706_100024202
660 Ga0070706_100060162
661 Ga0070706_100095782
662 Ga0070706_100118671
663 Ga0070706_100125094
664 Ga0070706_100201241
665 Ga0070707_100020752
666 Ga0070707_100030175
667 Ga0070707_100035890
668 Ga0070707_100046446
669 Ga0070707_100073209
670 Ga0070707_100090236
671 Ga0070707_100132676
672 Ga0070707_100582979
673 Ga0070698_100003046
674 Ga0070698_100022957
675 Ga0070698_100032478
676 Ga0070698_100044644
677 Ga0070698_100077567
678 Ga0070698_100137415
679 Ga0070699_100007687
680 Ga0070699_100020304
681 Ga0070699_100041553
682 Ga0070699_100082768
683 Ga0070699_100095575
684 Ga0070699_100416964
685 Ga0070679_100006871
686 Ga0070679_100536216
687 Ga0070684_100342223
688 Ga0070697_100002527
689 Ga0070697_100032923
690 Ga0070697_100064720
691 Ga0070697_100069599
692 Ga0070697_100118393
693 Ga0068853_100012733
694 Ga0070672_100517973
695 Ga0070695_100002444
696 Ga0070695_100009206
697 Ga0070695_100602814
698 Ga0070695_100754272
699 Ga0070696_100000114
700 Ga0070696_100364786
701 Ga0070693_100000119
702 Ga0070704_100000769
703 Ga0070704_100170895
704 Ga0070704_100274187
705 Ga0068855_100000315
706 Ga0068855_100792411
707 Ga0070664_100002564
708 Ga0068854_100000615
709 Ga0068856_100082394
710 Ga0068856_100131808
711 Ga0070702_100641401
712 Ga0068852_100406591
713 Ga0068859_100200239
714 Ga0068859_100360144
715 Ga0068864_100018595
716 Ga0068861_100002751
717 Ga0068870_10000338
718 Ga0068863_100005064
719 Ga0068863_100077067
720 Ga0068863_100147574
721 Ga0068863_100601904
722 Ga0068858_100125993
723 Ga0068860_100004554
724 Ga0081455_10002726
725 Ga0081539_10000322
726 Ga0070717_10100239
727 Ga0070717_10627939
728 Ga0070717_10692578
729 Ga0070715_10162293
730 Ga0070716_100113613
731 Ga0070712_100010489
732 Ga0070712_100115942
733 Ga0070712_100250063
734 Ga0070712_100627223
735 Ga0097621_100169120
736 Ga0075428_100001686
737 Ga0075428_100051690
738 Ga0075428_100410477
739 Ga0075430_100000034
740 Ga0075430_100010092
741 Ga0075430_100109966
742 Ga0075431_100000968
743 Ga0075431_100008260
744 Ga0075431_100017344
745 Ga0075431_100827275
746 Ga0075433_10004231
747 Ga0075433_10029369
748 Ga0075433_10095734
749 Ga0075433_10133902
750 Ga0075433_10167735
751 Ga0075433_10453103
752 Ga0075434_100003291
753 Ga0075434_100004886
754 Ga0075434_100006301
755 Ga0075434_100016191
756 Ga0075434_100083732
757 Ga0075434_100175070
758 Ga0075429_100005440
759 Ga0075429_100352511
760 Ga0075429_100539003
761 Ga0068865_100420345
762 Ga0075436_100059326
763 Ga0075436_100089458
764 Ga0075436_100107556
765 Ga0097620_100200244
766 Ga0097620_100360151
767 Ga0075435_100004255
768 Ga0075435_100079903
769 Ga0075435_100155561
770 Ga0075435_100384356
771 Ga0099794_10011476
772 Ga0099794_10080705
773 Ga0111539_10002043
774 Ga0111539_10011105
775 Ga0105245_10182043
776 Ga0105245_10239626
777 Ga0114129_10000394
778 Ga0114129_10007963
779 Ga0114129_10013280
780 Ga0114129_10080259
781 Ga0114129_10111037
782 Ga0114129_10211840
783 Ga0114129_11036493
784 Ga0105243_11062289
785 Ga0105241_10007101
786 Ga0105241_10466561
787 Ga0105242_10259877
788 Ga0105248_10453308
789 Ga0105237_10206187
790 Ga0105239_10287205
791 Ga0105246_10109144
792 Ga0157373_10000317
793 Ga0157371_10148630
794 Ga0157370_10386404
795 Ga0157369_10004085
796 Ga0157378_10141278
797 Ga0163162_10134498
798 Ga0163162_10188516
799 Ga0157372_10002617
800 Ga0157375_10447324
801 Ga0163163_10040391
802 Ga0163163_10202626
803 Ga0157380_10132956
804 Ga0157380_11461037
805 Ga0182008_10133214
806 Ga0157377_10014084
807 Ga0157376_10107657
808 Ga0157376_11063172
809 Ga0213872_10000850
810 Ga0213872_10168890
811 Ga0213874_10024748
812 Ga0213875_10005078
813 Ga0213871_10072592
814 Ga0207692_10016937
815 Ga0207692_10031088
816 Ga0207647_10060037
817 Ga0207685_10212042
818 Ga0207699_10069573
819 Ga0207699_10225468
820 Ga0207699_10302160
821 Ga0207645_10000442
822 Ga0207643_10000296
823 Ga0207684_10000406
824 Ga0207684_10010296
825 Ga0207684_10013022
826 Ga0207684_10027617
827 Ga0207684_10069539
828 Ga0207684_10099132
829 Ga0207684_10268985
830 Ga0207684_10286228
831 Ga0207684_10332773
832 Ga0207654_10007397
833 Ga0207654_10265286
834 Ga0207707_10000443
835 Ga0207707_10177862
836 Ga0207707_10331654
837 Ga0207671_10879250
838 Ga0207693_10001194
839 Ga0207693_10059163
840 Ga0207693_10384924
841 Ga0207663_10013015
842 Ga0207660_10000319
843 Ga0207657_10000095
844 Ga0207652_10000761
845 Ga0207646_10000441
846 Ga0207646_10036998
847 Ga0207646_10071916
848 Ga0207646_10093460
849 Ga0207646_10128760
850 Ga0207646_10132003
851 Ga0207646_10151523
852 Ga0207646_10253135
853 Ga0207646_10742328
854 Ga0207681_10027855
855 Ga0207681_10568478
856 Ga0207650_10088261
857 Ga0207687_10049477
858 Ga0207700_10083640
859 Ga0207700_10177401
860 Ga0207700_10287155
861 Ga0207700_10420989
862 Ga0207700_10502323
863 Ga0207664_10032552
864 Ga0207664_10043189
865 Ga0207664_10061950
866 Ga0207664_10096739
867 Ga0207664_10312163
868 Ga0207690_10003975
869 Ga0207706_10001514
870 Ga0207706_10100689
871 Ga0207706_10501891
872 Ga0207686_10282660
873 Ga0207670_10242451
874 Ga0207665_10001563
875 Ga0207691_10123058
876 Ga0207691_10323648
877 Ga0207711_10548586
878 Ga0207689_10000121
879 Ga0207661_10107844
880 Ga0207679_10002239
881 Ga0207667_10003214
882 Ga0207667_10640785
883 Ga0207651_10025193
884 Ga0207712_10279623
885 Ga0207640_10003488
886 Ga0207677_10020418
887 Ga0207703_10116854
888 Ga0207639_10006785
889 Ga0207678_10051048
890 Ga0207708_10370643
891 Ga0207702_10001684
892 Ga0207702_10285041
893 Ga0207641_10049557
894 Ga0207641_10370443
895 Ga0207648_10002571
896 Ga0207648_10600441
897 Ga0207676_10009122
898 Ga0207674_10000307
899 Ga0207675_100003470
900 Ga0207675_100782009
901 Ga0207683_10121784
902 Ga0207698_10865287
903 Ga0209969_1002012
904 Ga0209967_1003130
905 Ga0209995_1001091
906 Ga0209999_1002220
907 Ga0209982_1004158
908 Ga0209983_1004198
909 Ga0209588_1002172
910 Ga0209971_1000026
911 Ga0209998_10000060
912 Ga0209974_10004112
913 Ga0207428_10000263
914 Ga0207428_10034101
915 Ga0268265_10008453
916 Ga0268265_10255455
917 Ga0268264_10003751
918 Ga0268264_10580329
919 Ga0268264_10932196
920 Ga0265334_10000010
921 Ga0265334_10103364
922 Ga0265338_10057941
923 Ga0265331_10020582
924 Ga0265327_10000878
925 Ga0307408_100064502
926 Ga0265313_10000068
927 Ga0307407_10013409
928 Ga0307409_100107156
929 Ga0307416_100450123
930 Ga0307414_10000023
931 Ga0307414_10014131
932 Ga0307414_10507939
933 Ga0373948_0008621
934 Ga0373940_0040834
935 Ga0373940_0045683
936 Ga0373949_0011658
937 Ga0373951_0002768
938 Ga0373923_0096778
939 Ga0373932_0005014
940 Ga0373953_0224151
941 Ga0373943_0055707
942 Ga0373946_0018726
943 Ga0373955_0044589
944 Ga0373955_0078450
945 Ga0373962_0026881
946 Ga0373962_0071020
947 Ga0373924_0036915
948 Ga0373924_0161144
949 Ga0373931_0003993
950 Ga0373931_0468991
951 Ga0373927_0034321
952 Ga0373927_0073303
953 Ga0373927_0083304
954 Ga0373933_0002430
955 Ga0373933_0032458
956 Ga0373947_0038500
957 Ga0373937_0007721
958 Ga0373937_0075716
959 Ga0373937_0107746
960 Ga0373937_0509991
961 Ga0373937_0600564
962 Ga0373925_0753616
963 Ga0395900_0058810
964 Ga0395898_0002962
965 Ga0395905_0428255
966 Ga0436364_0407262
967 Ga0436364_0590706
968 Ga0436364_1118507
969 Ga0436364_1243781
970 Ga0395901_0001791
971 Ga0436365_0080955
972 Ga0436365_0708594
973 Ga0436365_1438780
974 Ga0436360_0068333
975 Ga0436360_0364829
976 Ga0436360_0639665
977 Ga0436360_0929237
978 Ga0436360_1260834
979 Ga0436361_0461669
980 Ga0436361_1044226
981 Ga0436361_1065280
982 Ga0436361_1164679
983 Ga0436363_0147135
984 Ga0436362_0208546
985 Ga0436362_0641270
986 Ga0436362_0936441
987 Ga0439437_014634
988 Ga0439448_0004055
989 Ga0439448_0093160
990 Ga0450889_008434
991 Ga0450889_010140
992 Ga0439458_0008348
993 Ga0439459_0002786
994 Ga0439460_0004062
995 Ga0451577_0005046
996 Ga0451577_0014218
997 Ga0451577_0043598
998 Ga0451577_0047221
999 Ga0451577_0231661
1000 Ga0451577_0404344
1001 Ga0453683_0109398
1002 Ga0453684_0003900
1003 Ga0453684_0022770
1004 Ga0453684_0081547
1005 Ga0453684_0188782
1006 Ga0453684_0475131
1007 Ga0453684_0898547
1008 Ga0453684_1101480
1009 Ga0451576_0006407
1010 Ga0451576_0018358
1011 Ga0451576_0022521
1012 Ga0451576_0062109
1013 Ga0451576_0285729
1014 Ga0451576_0308229
1015 Ga0451576_0829917
1016 Ga0451576_0872432
1017 Ga0466958_0323274
1018 Ga0466967_0563898
1019 Ga0495592_0048204
1020 Ga0495629_0182591
1021 Ga0495651_0038654
1022 Ga0495651_0114841
1023 Ga0495653_0315388
1024 Ga0495580_0183526
1025 Ga0495664_0022181
1026 Ga0495594_0360833
1027 Ga0495608_0037812
1028 Ga0495628_0594699
1029 Ga0495630_0007282
1030 Ga0495630_0311047
1031 Ga0495666_0253254
1032 Ga0495640_0039828
1033 Ga0495640_0065052
1034 Ga0495587_0003018
1035 Ga0495587_0271008
1036 Ga0495621_0204444
1037 Ga0495645_0001664
1038 Ga0495645_0053962
1039 Ga0495645_0124292
1040 Ga0495667_0015846
1041 Ga0495667_0018449
1042 Ga0495667_0118980
1043 Ga0495656_0276157
1044 Ga0495635_0079429
1045 Ga0495657_0382996
1046 Ga0495599_0032858
1047 Ga0495623_0043011
1048 Ga0495647_0205550
1049 Ga0495604_0072598
1050 Ga0495604_0260767
1051 Ga0495674_0057170
1052 Ga0495674_1157316
1053 Ga0495680_0090750
1054 Ga0495680_0169850
1055 Ga0495675_0003966
1056 Ga0495675_0091005
1057 Ga0495684_0351686
1058 Ga0495602_0001287
1059 Ga0495602_0485273
1060 Ga0496102_0019312
1061 Ga0496102_0028295
1062 Ga0496106_0523505
1063 Ga0496112_0160940
1064 Ga0496120_0029220
1065 Ga0501031_0095948
1066 Ga0501032_0070906
1067 Ga0501036_0122854
1068 Ga0501036_0216659
1069 Ga0501037_0036716
1070 Ga0501037_0188079
1071 Ga0501038_0038676
1072 Ga0501039_0016664
1073 Ga0501039_0243472
1074 Ga0501040_0003929
1075 Ga0501040_0016517
1076 Ga0501040_0325181
1077 Ga0501041_0031294
1078 Ga0501041_0161618
1079 Ga0501042_0000025
1080 Ga0501042_0014495
1081 Ga0501042_0314968
1082 Ga0501046_0000526
1083 Ga0501046_0075922
1084 Ga0501046_0193432
1085 Ga0501046_0470728
1086 Ga0501047_0273336
1087 Ga0501048_0320326
1088 Ga0501048_0348993
1089 Ga0501067_0090044
1090 Ga0501068_0105321
1091 Ga0501068_0350532
1092 Ga0501069_0257322
1093 Ga0501072_0092712
1094 Ga0501072_0129164
1095 Ga0501072_0156027
1096 Ga0501072_0618698
1097 Ga0501074_0083016
1098 Ga0501075_0065265
1099 Ga0501075_0100723
1100 Ga0501076_0086601
1101 Ga0501076_0234204
1102 Ga0501077_0003730
1103 Ga0501077_0014977
1104 Ga0501077_0155128
1105 Ga0501079_0005165
1106 Ga0501079_0009918
1107 Ga0501079_0185219
1108 Ga0501079_0211211
1109 Ga0501080_0022229
1110 Ga0501080_0357573
1111 Ga0501080_0588328
1112 Ga0501081_0008191
1113 Ga0501081_0043190
1114 Ga0501081_0215724
1115 Ga0501083_0022141
1116 Ga0501280_000521
1117 Ga0501035_0068350
1118 Ga0501045_0000034
1119 Ga0501045_0070190
1120 Ga0501045_0503628
1121 nmdc:mga05p37_109769_c1
1122 nmdc:mga05p37_111758_c1
1123 nmdc:mga05p37_48008_c1
1124 nmdc:mga05p37_675257_c1
1125 nmdc:mga05p37_9340_c1
1126 nmdc:mga05p37_98293_c1
1127 nmdc:mga05p37_98838_c1
1128 nmdc:mga09592_461755_c1
1129 nmdc:mga09592_49479_c1
1130 nmdc:mga09592_932_c1
1131 nmdc:mga0qj67_152824_c1
1132 nmdc:mga0qj67_28173_c1
1133 nmdc:mga0qj67_5855_c1
1134 nmdc:mga06r32_2967_c1
1135 nmdc:mga06r32_357116_c1
1136 nmdc:mga08y16_21023_c1
1137 nmdc:mga08y16_618_c1
1138 nmdc:mga0n895_12419_c1
1139 nmdc:mga0n895_187091_c1
1140 nmdc:mga0n895_18902_c1
1141 nmdc:mga0n895_483053_c1
1142 nmdc:mga0n895_90686_c1
1143 nmdc:mga0rr50_1063758_c1
1144 nmdc:mga0rr50_124621_c1
1145 nmdc:mga0rr50_138812_c1
1146 nmdc:mga0rr50_207055_c1
1147 nmdc:mga0rr50_324773_c1
1148 nmdc:mga0rr50_53356_c1
1149 nmdc:mga0rr50_83516_c1
1150 nmdc:mga0rr50_90033_c1
1151 nmdc:mga08x19_27554_c1
1152 nmdc:mga08x19_4209_c1
1153 nmdc:mga08x19_596029_c1
1154 nmdc:mga08x19_930018_c1
1155 nmdc:mga0a205_158466_c1
1156 nmdc:mga0a205_16044_c1
1157 nmdc:mga0a205_19301_c1
1158 nmdc:mga0a205_232916_c1
1159 nmdc:mga0a205_46906_c1
1160 nmdc:mga0a205_74937_c1
1161 Ga0495601_0203375
1162 Ga0495612_0000560
1163 Ga0495595_0044108
1164 Ga0495619_0047034
1165 Ga0495619_0072794
1166 Ga0500616_0188038
1167 Ga0501084_0004032
1168 Ga0501084_0105382
1169 Ga0501082_0008066
1170 Ga0501082_0031472
1171 Ga0501082_0273247
1172 Ga0501082_0357737
1173 Ga0501082_0794613
1174 Ga0530510_0009846
1175 Ga0530510_0171861
1176 2909402569
1177 641334478
1178 643391017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

58

204

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yg9-assembly2.cif.gz_B structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans 0.902 14 215
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.8922 15 212
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.8912 10 214
4b21-assembly1.cif.gz_A unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 0.884 15 207
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.8561 15 212
ID Description Score Start End Superfamily
af_Q92383_49_162_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9538 45 157 1.10.340.30
3s6iA01 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2; 0.9398 158 212 1.10.1670.40
af_Q92383_49_162_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9379 45 157 1.10.340.30
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9285 45 157 1.10.340.30
af_A0A1D8PI96_136_252_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9223 46 155 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A6M1LGC6-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.998 11 218 GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A1J5R7E2-F1-model_v4 DNA-3-methyladenine glycosylase 2 (EC 3.2.2.21) 0.988 15 210 GO:0005634
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
GO:0052821
GO:0052822
GO:1990053
AF-A0A6M1LGC6-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9838 11 218 GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A432IC28-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9824 15 211 GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A833HBV8-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9822 15 210 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Map