F466765

General Info

Members Datasets Scaffolds Average Seq Length
588 352 528 386

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10082264|Ga0105243_100822642
Length 415
Sequence MNDVQQPLYDLAPLLRLMLLGALIALGPLAWVWLRNRRSSPLRRVQALTVLTLFLTFDLVMFGAFTRLTDSGLGCPDWPGCYGNASPVGAHAEISAAQQAMPTGPVTHGKAWVEMIHRYLATSVGVLIIVLTVIAWRQWQHARRSGVAAHGPALSPWWPTATLVWVCLQGAFGALTVTMKLFPAIVTLHLIGGIVLLALLCVQAVRQTQAAQGTARLPVGTGLRWLLGVTTALVALQIVLGGWVSTNYAVLACTTFPTCHGSWWPDMAFAQGFEIWRPLGMLQDGSNISFAGLTAIHYVHRLAAYVVLAALALLVWRLRRAGALPSQARWLAGLALMQFATGLSNVVLDWPLVAAVLHTGGAAALVVVLTWALTSSRSALPGEVAGNASLFPPADPVPPSTSTPAPHHGATRISA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
13 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
16 2643221652 Acidovorax sp. Root402 Isolate Unclassified
17 2643221658 Variovorax sp. Root411 Isolate Unclassified
18 2643221672 Variovorax sp. Root434 Isolate Unclassified
19 2643221683 Variovorax sp. Root473 Isolate Unclassified
20 2643221717 Acidovorax sp. Root267 Isolate Unclassified
21 2721755523 Delftia sp. HK171 Isolate Unclassified
22 2738541277 Variovorax sp. GV051 Isolate Unclassified
23 2738541307 Variovorax sp. GV008 Isolate Unclassified
24 2738543012 Acidovorax sp. CF301 Isolate Unclassified
25 2738543013 Variovorax sp. BT01 Isolate Unclassified
26 2738543019 Variovorax sp. GV040 Isolate Unclassified
27 2816332133 Acidovorax radicis 2721A Isolate Unclassified
28 2818991446 Variovorax sp. 1180 Isolate Unclassified
29 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
30 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
31 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
32 2842677519 Variovorax sp. R-72495 Isolate Unclassified
33 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
34 2842733646 Variovorax sp. R-72446 Isolate Unclassified
35 2842747753 Variovorax sp. R-72060 Isolate Unclassified
36 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
37 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
38 2885198086 Variovorax sp. 679 Isolate Unclassified
39 2885211737 Variovorax sp. 553 Isolate Unclassified
40 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
41 2899924645 Variovorax sp. 369 Isolate Unclassified
42 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
43 2904456579 Variovorax sp. 2002 Isolate Unclassified
44 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
45 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
46 2928037797 Variovorax sp. 1126 Isolate Unclassified
47 2928044640 Variovorax sp. 1128 Isolate Unclassified
48 2928051484 Variovorax sp. 1133 Isolate Unclassified
49 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
50 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
51 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
52 2929520902 Variovorax beijingensis 502 Isolate Unclassified
53 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
54 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
55 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
56 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
57 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
58 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
59 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
60 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
65 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
66 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
67 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
68 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
69 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
70 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
71 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
72 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
73 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
74 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
75 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
76 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
77 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
78 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
79 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
80 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
81 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
82 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
83 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
86 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
87 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
92 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
93 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
98 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
99 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
100 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
198 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
207 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
208 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
209 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
210 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
211 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
238 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
239 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
240 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
241 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
242 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
243 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
244 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
245 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
246 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
247 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
250 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
251 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
252 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
253 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
254 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
255 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
256 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
257 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
275 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
276 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
280 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
314 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
317 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
318 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
319 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
330 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
331 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
334 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
335 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
336 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
337 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
338 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
342 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
343 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
344 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
348 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
349 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
350 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
351 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.46
Metatranscriptomes 0.34
Isolates 10.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.1
Nodule 1.02
Rhizoplane 2.21
Rhizosphere 52.04
Stem 0
Stem Tuber 0
Unclassified 14.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000752 3300002773 Bacteria 16498
2 JGI25152J39213_1004689 3300002773 Bacteria 4229
3 JGI25152J39213_1004789 3300002773 Bacteria 4152
4 JGI25159J45721_1005503 3300002987 Bacteria 3973
5 JGI25159J45721_1006777 3300002987 Bacteria 3373
6 JGI25151J46595_10003608 3300003187 Bacteria 8469
7 JGI25151J46595_10006860 3300003187 Bacteria 5655
8 JGI25153J46596_10006922 3300003215 Bacteria 5655
9 JGI25153J46596_10008440 3300003215 Bacteria 4923
10 JGI25153J46596_10008693 3300003215 Bacteria 4822
11 JGI25153J46596_10011325 3300003215 Bacteria 3950
12 JGI26128J50194_1000314 3300003347 Bacteria 2488
13 JGI25160J50197_1010375 3300003354 Bacteria 3373
14 JGI25161J50226_1002812 3300003374 Bacteria 4276
15 JGI25161J50226_1005361 3300003374 Bacteria 2497
16 Ga0006562J51391_1098951 3300003578 Bacteria 3590
17 Ga0006562J51391_1098954 3300003578 Bacteria 1900
18 Ga0055525_1000004 3300003759 Bacteria 888039
19 Ga0055535_1001208 3300003761 Bacteria 14670
20 Ga0055542_1000074 3300003762 Bacteria 141185
21 Ga0055526_1006915 3300003771 Bacteria 6038
22 Ga0055526_1006930 3300003771 Bacteria 6029
23 Ga0055537_1002155 3300003773 Bacteria 6876
24 Ga0055537_1002771 3300003773 Bacteria 5655
25 Ga0055524_1004952 3300003775 Bacteria 6038
26 Ga0055524_1004968 3300003775 Bacteria 6029
27 Ga0055536_1006002 3300003781 Bacteria 5775
28 Ga0055536_1006585 3300003781 Bacteria 5376
29 Ga0055536_1007725 3300003781 Bacteria 4758
30 Ga0055534_1000049 3300003784 Bacteria 92974
31 Ga0055534_1002437 3300003784 Bacteria 6437
32 Ga0055534_1003010 3300003784 Bacteria 5540
33 Ga0055534_1005545 3300003784 Bacteria 3350
34 Ga0055528_1000357 3300003790 Bacteria 37139
35 Ga0055528_1005328 3300003790 Bacteria 6009
36 Ga0055528_1007771 3300003790 Bacteria 4692
37 Ga0055530_10005199 3300003791 Bacteria 6317
38 Ga0055530_10018184 3300003791 Bacteria 2177
39 Ga0055540_1004393 3300003792 Bacteria 6383
40 Ga0055540_1004492 3300003792 Bacteria 6260
41 Ga0055540_1009536 3300003792 Bacteria 3341
42 Ga0055531_10006998 3300003794 Bacteria 6263
43 Ga0055531_10009815 3300003794 Bacteria 4851
44 Ga0055531_10015568 3300003794 Bacteria 3341
45 Ga0055543_1001765 3300004625 Bacteria 8061
46 Ga0055543_1005006 3300004625 Bacteria 3465
47 Ga0065165_1001501 3300005262 Bacteria 24680
48 Ga0065165_1005078 3300005262 Bacteria 7649
49 Ga0065165_1024940 3300005262 Bacteria 1998
50 Ga0065704_10084587 3300005289 Bacteria 3319
51 Ga0070658_10115877 3300005327 Bacteria 2223
52 Ga0070670_100007394 3300005331 Bacteria 9328
53 Ga0070677_10008030 3300005333 Bacteria 3538
54 Ga0070666_10098326 3300005335 Bacteria 2015
55 Ga0070660_100206458 3300005339 Bacteria 1594
56 Ga0070661_100007719 3300005344 Bacteria 7431
57 Ga0070668_100204226 3300005347 Bacteria 1623
58 Ga0070669_100032936 3300005353 Bacteria 3746
59 Ga0070669_100086762 3300005353 Bacteria 2339
60 Ga0070675_100009273 3300005354 Bacteria 7649
61 Ga0070675_100235334 3300005354 Bacteria 1599
62 Ga0070671_100006635 3300005355 Bacteria 9250
63 Ga0070671_100007158 3300005355 Bacteria 8919
64 Ga0070671_100009262 3300005355 Bacteria 7910
65 Ga0070671_100038584 3300005355 Bacteria 3964
66 Ga0070674_100001710 3300005356 Bacteria 11893
67 Ga0070674_100002407 3300005356 Bacteria 10331
68 Ga0070673_100010080 3300005364 Bacteria 6377
69 Ga0070659_100001726 3300005366 Bacteria 15700
70 Ga0070659_100080483 3300005366 Bacteria 2601
71 Ga0070667_100010858 3300005367 Bacteria 7530
72 Ga0070667_100139274 3300005367 Bacteria 2123
73 Ga0070678_100004379 3300005456 Bacteria 7998
74 Ga0070662_100003686 3300005457 Bacteria 9578
75 Ga0070662_100011245 3300005457 Bacteria 5900
76 Ga0068867_100011197 3300005459 Bacteria 6328
77 Ga0068867_100035060 3300005459 Bacteria 3638
78 Ga0070672_100014240 3300005543 Bacteria 5631
79 Ga0070672_100154402 3300005543 Bacteria 1901
80 Ga0070672_100234882 3300005543 Bacteria 1541
81 Ga0070665_100255353 3300005548 Bacteria 1754
82 Ga0070665_100366565 3300005548 Bacteria 1447
83 Ga0068855_100064188 3300005563 Bacteria 4282
84 Ga0070664_100016250 3300005564 Bacteria 6101
85 Ga0070664_100035272 3300005564 Bacteria 4199
86 Ga0070664_100111858 3300005564 Bacteria 2384
87 Ga0070664_100301511 3300005564 Bacteria 1448
88 Ga0068857_100054327 3300005577 Bacteria 3554
89 Ga0068854_100067480 3300005578 Bacteria 2606
90 Ga0068852_100160790 3300005616 Bacteria 2097
91 Ga0068852_100167363 3300005616 Bacteria 2058
92 Ga0068864_100017128 3300005618 Bacteria 6043
93 Ga0068864_100077585 3300005618 Bacteria 2905
94 Ga0068864_100143804 3300005618 Bacteria 2154
95 Ga0068851_10003699 3300005834 Bacteria 6830
96 Ga0068870_10008654 3300005840 Bacteria 4588
97 Ga0068863_100307281 3300005841 Bacteria 1539
98 Ga0068862_100008979 3300005844 Bacteria 8277
99 Ga0075365_10032838 3300006038 Bacteria 3340
100 Ga0075368_10073101 3300006042 Bacteria 1387
101 Ga0075363_100008797 3300006048 Bacteria 4721
102 Ga0075363_100020905 3300006048 Bacteria 3288
103 Ga0075363_100032110 3300006048 Bacteria 2725
104 Ga0075363_100046475 3300006048 Bacteria 2303
105 Ga0075363_100105768 3300006048 Bacteria 1561
106 Ga0075432_10012075 3300006058 Bacteria 2935
107 Ga0075362_10045642 3300006177 Bacteria 1946
108 Ga0075367_10145549 3300006178 Bacteria 1469
109 Ga0075369_10011708 3300006186 Bacteria 3454
110 Ga0075366_10000238 3300006195 Bacteria 24452
111 Ga0075366_10002896 3300006195 Bacteria 8909
112 Ga0075366_10006604 3300006195 Bacteria 6364
113 Ga0075366_10017161 3300006195 Bacteria 4164
114 Ga0075366_10026477 3300006195 Bacteria 3397
115 Ga0075366_10076515 3300006195 Bacteria 1997
116 Ga0097621_100145552 3300006237 Bacteria 2028
117 Ga0075370_10001826 3300006353 Bacteria 9524
118 Ga0075370_10006807 3300006353 Bacteria 5778
119 Ga0075370_10027185 3300006353 Bacteria 3173
120 Ga0075370_10059270 3300006353 Bacteria 2178
121 Ga0075370_10102504 3300006353 Bacteria 1657
122 Ga0068871_100098749 3300006358 Bacteria 2443
123 Ga0079104_1000007 3300006946 Bacteria 390531
124 Ga0099826_10003969 3300006948 Bacteria 10245
125 Ga0105244_10002225 3300009036 Bacteria 14779
126 Ga0114129_10067958 3300009147 Bacteria 4969
127 Ga0105243_10000435 3300009148 Bacteria 43795
128 Ga0105243_10000616 3300009148 Bacteria 35443
129 Ga0105243_10023521 3300009148 Bacteria 4693
130 Ga0105243_10047353 3300009148 Bacteria 3384
131 Ga0105243_10082264 3300009148 Bacteria 2631
132 Ga0105242_10041963 3300009176 Bacteria 3692
133 Ga0105237_10140345 3300009545 Bacteria 2410
134 Ga0105239_10007927 3300010375 Bacteria 12142
135 Ga0105246_10052786 3300011119 Bacteria 2795
136 Ga0157373_10029652 3300013100 Bacteria 3940
137 Ga0157371_10053112 3300013102 Bacteria 2877
138 Ga0157370_10002648 3300013104 Bacteria 21500
139 Ga0157370_10131926 3300013104 Bacteria 2330
140 Ga0157369_10022851 3300013105 Bacteria 6973
141 Ga0163162_10088242 3300013306 Bacteria 3181
142 Ga0163162_10144941 3300013306 Bacteria 2490
143 Ga0163163_10208710 3300014325 Bacteria 2002
144 Ga0182008_10001459 3300014497 Bacteria 15807
145 Ga0182008_10003510 3300014497 Bacteria 9451
146 Ga0182008_10005914 3300014497 Bacteria 6910
147 Ga0182008_10052585 3300014497 Bacteria 2018
148 Ga0157379_10049102 3300014968 Bacteria 3767
149 Ga0157376_10121191 3300014969 Bacteria 2318
150 Ga0182006_1001630 3300015261 Bacteria 13257
151 Ga0182007_10000319 3300015262 Bacteria 30540
152 Ga0182007_10001800 3300015262 Bacteria 11181
153 Ga0183362_10005 3300015683 Bacteria 437616
154 Ga0163161_10005248 3300017792 Bacteria 9016
155 Ga0163161_10008385 3300017792 Bacteria 7153
156 Ga0163161_10017609 3300017792 Bacteria 5003
157 Ga0163161_10034947 3300017792 Bacteria 3596
158 Ga0163161_10118687 3300017792 Bacteria 1985
159 Ga0163161_10135195 3300017792 Bacteria 1863
160 Ga0213872_10000068 3300021361 Bacteria 91693
161 Ga0213872_10000132 3300021361 Bacteria 67609
162 Ga0213872_10005641 3300021361 Bacteria 6387
163 Ga0209672_101404 3300025228 Bacteria 8811
164 Ga0209147_100958 3300025229 Bacteria 12672
165 Ga0209563_100013 3300025230 Bacteria 941463
166 Ga0209258_100176 3300025242 Bacteria 141261
167 Ga0207425_1000274 3300025245 Bacteria 37943
168 Ga0207425_1004328 3300025245 Bacteria 4292
169 Ga0209148_1000033 3300025254 Bacteria 555508
170 Ga0209129_1000062 3300025258 Bacteria 240655
171 Ga0209129_1000270 3300025258 Bacteria 50956
172 Ga0209129_1003482 3300025258 Bacteria 6811
173 Ga0209565_1000020 3300025263 Bacteria 432627
174 Ga0209565_1002017 3300025263 Bacteria 7836
175 Ga0209673_1000209 3300025273 Bacteria 117670
176 Ga0209673_1000295 3300025273 Bacteria 92499
177 Ga0209673_1004212 3300025273 Bacteria 7836
178 Ga0209673_1017691 3300025273 Bacteria 2620
179 Ga0209130_1000558 3300025284 Bacteria 36936
180 Ga0209130_1001877 3300025284 Bacteria 11970
181 Ga0209130_1003855 3300025284 Bacteria 6056
182 Ga0209675_1000014 3300025291 Bacteria 421902
183 Ga0209675_1005255 3300025291 Bacteria 5469
184 Ga0209675_1006340 3300025291 Bacteria 4766
185 Ga0209675_1009891 3300025291 Bacteria 3315
186 Ga0209676_1000048 3300025292 Bacteria 403716
187 Ga0209676_1000124 3300025292 Bacteria 194206
188 Ga0209676_1000604 3300025292 Bacteria 52933
189 Ga0209676_1016955 3300025292 Bacteria 2600
190 Ga0209025_1000204 3300025294 Bacteria 142193
191 Ga0209025_1000733 3300025294 Bacteria 55578
192 Ga0209025_1001228 3300025294 Bacteria 35766
193 Ga0209025_1008203 3300025294 Bacteria 7556
194 Ga0209025_1015876 3300025294 Bacteria 4496
195 Ga0209025_1017783 3300025294 Bacteria 4079
196 Ga0209564_1000176 3300025295 Bacteria 152363
197 Ga0209564_1000753 3300025295 Bacteria 45895
198 Ga0209564_1000760 3300025295 Bacteria 45546
199 Ga0209758_1000129 3300025297 Bacteria 185022
200 Ga0209758_1000327 3300025297 Bacteria 89663
201 Ga0209758_1000833 3300025297 Bacteria 43061
202 Ga0209758_1002931 3300025297 Bacteria 16429
203 Ga0209050_1000012 3300025298 Bacteria 813717
204 Ga0209050_1000118 3300025298 Bacteria 202586
205 Ga0209050_1001006 3300025298 Bacteria 35335
206 Ga0209050_1003937 3300025298 Bacteria 10503
207 Ga0209256_1000095 3300025299 Bacteria 206120
208 Ga0209256_1000527 3300025299 Bacteria 55578
209 Ga0209256_1020091 3300025299 Bacteria 2098
210 Ga0207426_1000161 3300025302 Bacteria 172765
211 Ga0207426_1000955 3300025302 Bacteria 28485
212 Ga0209051_1000019 3300025303 Bacteria 511268
213 Ga0209051_1000099 3300025303 Bacteria 165161
214 Ga0209051_1000117 3300025303 Bacteria 150156
215 Ga0209051_1000579 3300025303 Bacteria 43794
216 Ga0209051_1017840 3300025303 Bacteria 3159
217 Ga0209257_1000024 3300025304 Bacteria 726068
218 Ga0209257_1000258 3300025304 Bacteria 122220
219 Ga0209257_1007294 3300025304 Bacteria 6731
220 Ga0207655_1002862 3300025728 Bacteria 13337
221 Ga0207643_10040836 3300025908 Bacteria 2613
222 Ga0207695_10329184 3300025913 Bacteria 1416
223 Ga0207657_10256154 3300025919 Bacteria 1393
224 Ga0207649_10012020 3300025920 Bacteria 4789
225 Ga0207681_10006812 3300025923 Bacteria 7007
226 Ga0207681_10019983 3300025923 Bacteria 4242
227 Ga0207650_10029526 3300025925 Bacteria 3942
228 Ga0207650_10159210 3300025925 Bacteria 1788
229 Ga0207659_10001102 3300025926 Bacteria 16008
230 Ga0207644_10000537 3300025931 Bacteria 24617
231 Ga0207644_10027325 3300025931 Bacteria 3941
232 Ga0207690_10020776 3300025932 Bacteria 4062
233 Ga0207706_10004061 3300025933 Bacteria 13836
234 Ga0207686_10001446 3300025934 Bacteria 13456
235 Ga0207709_10000193 3300025935 Bacteria 81025
236 Ga0207709_10004548 3300025935 Bacteria 7994
237 Ga0207709_10006545 3300025935 Bacteria 6544
238 Ga0207709_10010024 3300025935 Bacteria 5220
239 Ga0207669_10028040 3300025937 Bacteria 3092
240 Ga0207669_10043995 3300025937 Bacteria 2619
241 Ga0207691_10028304 3300025940 Bacteria 5248
242 Ga0207691_10061992 3300025940 Bacteria 3395
243 Ga0207691_10083356 3300025940 Bacteria 2870
244 Ga0207691_10150610 3300025940 Bacteria 2046
245 Ga0207711_10038801 3300025941 Bacteria 4050
246 Ga0207679_10000647 3300025945 Bacteria 23264
247 Ga0207679_10070334 3300025945 Bacteria 2637
248 Ga0207679_10077481 3300025945 Bacteria 2529
249 Ga0207679_10158237 3300025945 Bacteria 1852
250 Ga0207667_10068688 3300025949 Bacteria 3689
251 Ga0207651_10046201 3300025960 Bacteria 2926
252 Ga0207651_10086867 3300025960 Bacteria 2275
253 Ga0207658_10084436 3300025986 Bacteria 2443
254 Ga0207658_10086895 3300025986 Bacteria 2413
255 Ga0207677_10014089 3300026023 Bacteria 4657
256 Ga0207639_10010748 3300026041 Bacteria 6342
257 Ga0207648_10012759 3300026089 Bacteria 7852
258 Ga0207648_10013271 3300026089 Bacteria 7676
259 Ga0207648_10031382 3300026089 Bacteria 4698
260 Ga0207676_10063431 3300026095 Bacteria 2935
261 Ga0207676_10084736 3300026095 Bacteria 2584
262 Ga0207676_10162173 3300026095 Bacteria 1938
263 Ga0207674_10115693 3300026116 Bacteria 2653
264 Ga0207683_10118324 3300026121 Bacteria 2377
265 Ga0207683_10124076 3300026121 Bacteria 2320
266 Ga0207683_10189983 3300026121 Bacteria 1864
267 Ga0207698_10261943 3300026142 Bacteria 1589
268 Ga0209281_1000020 3300027111 Bacteria 575972
269 Ga0209968_1000086 3300027526 Bacteria 16448
270 Ga0209970_1000061 3300027614 Bacteria 14543
271 Ga0209282_1000587 3300027666 Bacteria 17828
272 Ga0209971_1000817 3300027682 Bacteria 8001
273 Ga0209966_1000084 3300027695 Bacteria 40899
274 Ga0209974_10009116 3300027876 Bacteria 3371
275 Ga0268266_10211221 3300028379 Bacteria 1780
276 Ga0268266_10289958 3300028379 Bacteria 1524
277 Ga0268265_10008387 3300028380 Bacteria 6977
278 Ga0268264_10138406 3300028381 Bacteria 2168
279 Ga0307517_10119368 3300028786 Bacteria 1958
280 Ga0307517_10125318 3300028786 Bacteria 1877
281 Ga0307515_10000040 3300028794 Bacteria 322704
282 Ga0307515_10005119 3300028794 Bacteria 26636
283 Ga0307515_10038558 3300028794 Bacteria 7637
284 Ga0307515_10053971 3300028794 Bacteria 5911
285 Ga0307512_10083347 3300030522 Bacteria 2281
286 Ga0316177_1091043 3300030731 Bacteria 2329
287 Ga0314311_1046356 3300030733 Bacteria 11028
288 Ga0316180_1167384 3300030736 Bacteria 2503
289 Ga0316181_1026435 3300030744 Bacteria 6759
290 Ga0316182_1157155 3300030745 Bacteria 6253
291 Ga0265330_10000110 3300031235 Bacteria 68461
292 Ga0265332_10000011 3300031238 Bacteria 284299
293 Ga0265332_10003699 3300031238 Bacteria 7320
294 Ga0265328_10008612 3300031239 Bacteria 4196
295 Ga0265325_10010431 3300031241 Bacteria 5381
296 Ga0265329_10010082 3300031242 Bacteria 3489
297 Ga0265327_10000042 3300031251 Bacteria 287487
298 Ga0265327_10027427 3300031251 Bacteria 3278
299 Ga0307509_10027173 3300031507 Bacteria 6369
300 Ga0307509_10077519 3300031507 Bacteria 3446
301 Ga0307509_10094110 3300031507 Bacteria 3055
302 Ga0307408_100000131 3300031548 Bacteria 83295
303 Ga0307408_100024419 3300031548 Bacteria 4128
304 Ga0307408_100078210 3300031548 Bacteria 2465
305 Ga0307408_100092135 3300031548 Bacteria 2290
306 Ga0307408_100103828 3300031548 Bacteria 2170
307 Ga0307508_10000271 3300031616 Bacteria 63576
308 Ga0307508_10204679 3300031616 Bacteria 1574
309 Ga0307514_10004100 3300031649 Bacteria 13518
310 Ga0307514_10004711 3300031649 Bacteria 12466
311 Ga0265314_10000026 3300031711 Bacteria 284299
312 Ga0265314_10004418 3300031711 Bacteria 13056
313 Ga0265342_10038052 3300031712 Bacteria 2932
314 Ga0307516_10055082 3300031730 Bacteria 3884
315 Ga0307405_10035197 3300031731 Bacteria 2988
316 Ga0307405_10069914 3300031731 Bacteria 2252
317 Ga0307406_10001995 3300031901 Bacteria 11143
318 Ga0307406_10007581 3300031901 Bacteria 6025
319 Ga0307407_10077228 3300031903 Bacteria 2002
320 Ga0307412_10006569 3300031911 Bacteria 6585
321 Ga0307412_10007679 3300031911 Bacteria 6127
322 Ga0307412_10017312 3300031911 Bacteria 4312
323 Ga0307416_100160853 3300032002 Bacteria 2075
324 Ga0307414_10098420 3300032004 Bacteria 2194
325 Ga0307414_10289814 3300032004 Bacteria 1379
326 Ga0307411_10007510 3300032005 Bacteria 5562
327 Ga0307411_10026788 3300032005 Bacteria 3476
328 Ga0307411_10053672 3300032005 Bacteria 2642
329 Ga0307507_10037515 3300033179 Bacteria 4932
330 Ga0307510_10138186 3300033180 Bacteria 2088
331 Ga0307510_10173148 3300033180 Bacteria 1734
332 Ga0395905_0001350 3300037471 Bacteria 29884
333 Ga0395905_0042000 3300037471 Bacteria 4290
334 Ga0395905_0051105 3300037471 Bacteria 3871
335 Ga0395905_0088082 3300037471 Bacteria 2910
336 Ga0395901_0433601 3300038443 Bacteria 1346
337 Ga0436361_0334210 3300039447 Bacteria 17596
338 Ga0436361_0793297 3300039447 Bacteria 22989
339 Ga0436361_1206467 3300039447 Bacteria 80244
340 Ga0439436_0000228 3300041404 Bacteria 13481
341 Ga0439436_0025658 3300041404 Bacteria 1730
342 Ga0439439_0002942 3300041406 Bacteria 3698
343 Ga0439447_018069 3300041407 Bacteria 1909
344 Ga0439447_018309 3300041407 Bacteria 1891
345 Ga0439466_0004686 3300041411 Bacteria 5255
346 Ga0439466_0015768 3300041411 Bacteria 2743
347 Ga0439465_0000179 3300041413 Bacteria 16210
348 Ga0439465_0016548 3300041413 Bacteria 2300
349 Ga0451793_1732671 3300041452 Bacteria 1713
350 Ga0451795_0411808 3300041456 Bacteria 1771
351 Ga0439433_0000297 3300041999 Bacteria 8590
352 Ga0439442_004377 3300042002 Bacteria 2804
353 Ga0439445_0001665 3300042004 Bacteria 4860
354 Ga0439432_000674 3300042006 Bacteria 12782
355 Ga0439432_022154 3300042006 Bacteria 2100
356 Ga0439449_0001485 3300042007 Bacteria 9187
357 Ga0439449_0004068 3300042007 Bacteria 5660
358 Ga0439449_0057197 3300042007 Bacteria 1440
359 Ga0439452_001146 3300042010 Bacteria 11542
360 Ga0439452_006020 3300042010 Bacteria 3841
361 Ga0439457_011620 3300042014 Bacteria 1998
362 Ga0450919_000087 3300042121 Bacteria 9017
363 Ga0450919_004032 3300042121 Bacteria 1805
364 Ga0450921_000353 3300042123 Bacteria 2087
365 Ga0450896_003760 3300042133 Bacteria 2036
366 Ga0450896_010552 3300042133 Bacteria 1296
367 Ga0450906_001450 3300042145 Bacteria 5164
368 Ga0450908_001370 3300042184 Bacteria 4725
369 Ga0439434_0002846 3300042435 Bacteria 5050
370 Ga0439434_0041772 3300042435 Bacteria 1409
371 Ga0450918_000012 3300042531 Bacteria 36451
372 Ga0450918_000471 3300042531 Bacteria 8579
373 Ga0451577_0000166 3300042876 Bacteria 145166
374 Ga0451577_0008704 3300042876 Bacteria 9843
375 Ga0466969_0019802 3300044656 Bacteria 3490
376 Ga0466972_0000828 3300044658 Bacteria 14809
377 Ga0453683_0037359 3300044673 Bacteria 3056
378 Ga0466966_0044460 3300044684 Bacteria 2843
379 Ga0466961_0011529 3300044693 Bacteria 5653
380 Ga0453684_0000187 3300044712 Bacteria 272378
381 Ga0453684_0006584 3300044712 Bacteria 21971
382 Ga0453684_0034876 3300044712 Bacteria 6970
383 Ga0453684_0118034 3300044712 Bacteria 3209
384 Ga0466971_0005612 3300044719 Bacteria 5456
385 Ga0466968_0005703 3300044735 Bacteria 4666
386 Ga0466960_0022549 3300044901 Bacteria 2816
387 Ga0466959_0012248 3300045049 Bacteria 6189
388 Ga0451576_0001582 3300045051 Bacteria 38269
389 Ga0451576_0062057 3300045051 Bacteria 3897
390 Ga0451576_0116214 3300045051 Bacteria 2785
391 Ga0466958_0003695 3300045836 Bacteria 7992
392 Ga0466967_0104295 3300045976 Bacteria 2595
393 Ga0495627_004449 3300046453 Bacteria 5864
394 Ga0495627_010127 3300046453 Bacteria 3441
395 Ga0495638_0027987 3300046460 Bacteria 3644
396 Ga0495610_0038118 3300046512 Bacteria 2441
397 Ga0495610_0043493 3300046512 Bacteria 2237
398 Ga0495616_0021755 3300046513 Bacteria 3468
399 Ga0495620_0056375 3300046515 Bacteria 1653
400 Ga0495631_0000264 3300046518 Bacteria 36684
401 Ga0495632_0008136 3300046519 Bacteria 6484
402 Ga0495632_0008733 3300046519 Bacteria 6178
403 Ga0495632_0009624 3300046519 Bacteria 5804
404 Ga0495637_0005370 3300046520 Bacteria 6543
405 Ga0495637_0060651 3300046520 Bacteria 1552
406 Ga0495643_0095056 3300046522 Bacteria 1533
407 Ga0495663_0008628 3300046525 Bacteria 2826
408 Ga0495642_0074121 3300046528 Bacteria 1427
409 Ga0495654_0006360 3300046530 Bacteria 6717
410 Ga0495621_0003485 3300046539 Bacteria 4344
411 Ga0495621_0020363 3300046539 Bacteria 2176
412 Ga0495597_0001605 3300046542 Bacteria 15862
413 Ga0495597_0019840 3300046542 Bacteria 3140
414 Ga0495633_0005168 3300046558 Bacteria 8074
415 Ga0495656_0001656 3300046615 Bacteria 7283
416 Ga0495625_0000045 3300046660 Bacteria 202475
417 Ga0495625_0002511 3300046660 Bacteria 19764
418 Ga0495624_0082953 3300046690 Bacteria 1983
419 Ga0495676_0044826 3300047321 Bacteria 3605
420 Ga0495686_0001940 3300047472 Bacteria 20588
421 Ga0495593_0049930 3300047673 Bacteria 2218
422 Ga0495615_0007914 3300048090 Bacteria 2035
423 Ga0496101_0001836 3300048904 Bacteria 12806
424 Ga0496101_0009378 3300048904 Bacteria 6432
425 Ga0496102_0006927 3300048905 Bacteria 9670
426 Ga0496102_0007775 3300048905 Bacteria 9163
427 Ga0496104_0003316 3300048907 Bacteria 13888
428 Ga0496105_0013022 3300048908 Bacteria 6590
429 Ga0496106_0053158 3300048909 Bacteria 3058
430 Ga0496110_0150898 3300048913 Bacteria 2104
431 Ga0496110_0338216 3300048913 Bacteria 1371
432 Ga0496112_0033498 3300048915 Bacteria 4994
433 Ga0496114_0131563 3300048917 Bacteria 2161
434 Ga0496116_0021806 3300048919 Bacteria 4820
435 Ga0496117_0015535 3300048920 Bacteria 6481
436 Ga0496117_0054586 3300048920 Bacteria 2798
437 Ga0496118_0007738 3300048921 Bacteria 11286
438 Ga0496118_0044930 3300048921 Bacteria 3453
439 Ga0496121_0115217 3300048924 Bacteria 2041
440 Ga0496121_0194600 3300048924 Bacteria 1450
441 Ga0496122_0000331 3300048925 Bacteria 102617
442 Ga0496122_0020488 3300048925 Bacteria 5971
443 Ga0496122_0051284 3300048925 Bacteria 3137
444 Ga0496123_0001132 3300048926 Bacteria 39831
445 Ga0496123_0026744 3300048926 Bacteria 4314
446 Ga0496123_0045949 3300048926 Bacteria 2967
447 Ga0496123_0054066 3300048926 Bacteria 2647
448 Ga0496123_0078131 3300048926 Bacteria 2029
449 Ga0496123_0082929 3300048926 Bacteria 1941
450 Ga0496124_0002378 3300048927 Bacteria 24780
451 Ga0496124_0028895 3300048927 Bacteria 4950
452 Ga0496124_0041676 3300048927 Bacteria 3959
453 Ga0496124_0139715 3300048927 Bacteria 1913
454 Ga0496125_0002906 3300048928 Bacteria 21555
455 Ga0496125_0019166 3300048928 Bacteria 6466
456 Ga0496125_0034938 3300048928 Bacteria 4421
457 Ga0496125_0047725 3300048928 Bacteria 3577
458 Ga0496125_0049373 3300048928 Bacteria 3497
459 Ga0496125_0085368 3300048928 Bacteria 2392
460 Ga0496126_0019119 3300048929 Bacteria 6757
461 Ga0496126_0197277 3300048929 Bacteria 1702
462 Ga0501031_0006541 3300049568 Bacteria 7598
463 Ga0501037_0089198 3300049573 Bacteria 2232
464 Ga0501198_000001 3300049649 Bacteria 234552
465 Ga0501222_000004 3300049662 Bacteria 136139
466 Ga0501223_014343 3300049663 Bacteria 1572
467 Ga0501249_002599 3300049679 Bacteria 3639
468 Ga0501249_019504 3300049679 Bacteria 1473
469 Ga0501225_0019731 3300049705 Bacteria 1864
470 Ga0501262_000173 3300049759 Bacteria 8098
471 Ga0501266_000273 3300049763 Bacteria 6788
472 Ga0501035_0035264 3300049822 Bacteria 4541
473 Ga0501044_0262584 3300049823 Bacteria 1665
474 nmdc:mga03683_25993_c1 3300050489 Bacteria 2305
475 nmdc:mga03683_3239_c1 3300050489 Bacteria 5213
476 nmdc:mga03683_4340_c2 3300050489 Bacteria 3660
477 nmdc:mga03683_6167_c1 3300050489 Bacteria 4093
478 nmdc:mga03n38_14709_c1 3300050490 Bacteria 3007
479 nmdc:mga0k408_103740_c1 3300050493 Bacteria 1678
480 nmdc:mga0k408_11856_c1 3300050493 Bacteria 4756
481 nmdc:mga0k408_17615_c1 3300050493 Bacteria 3981
482 nmdc:mga0k408_22217_c1 3300050493 Bacteria 3571
483 nmdc:mga0k408_5217_c1 3300050493 Bacteria 6599
484 nmdc:mga0k408_565_c1 3300050493 Bacteria 20434
485 nmdc:mga0k408_69368_c1 3300050493 Bacteria 2057
486 nmdc:mga0k408_8337_c1 3300050493 Bacteria 5561
487 nmdc:mga06z11_44386_c1 3300050494 Bacteria 2241
488 nmdc:mga07m45_1630_c1 3300050496 Bacteria 10333
489 nmdc:mga07m45_33031_c1 3300050496 Bacteria 2873
490 nmdc:mga07m45_36403_c1 3300050496 Bacteria 2741
491 nmdc:mga07m45_3790_c2 3300050496 Bacteria 6857
492 nmdc:mga07m45_6665_c1 3300050496 Bacteria 5856
493 nmdc:mga07m45_92277_c1 3300050496 Bacteria 1736
494 nmdc:mga05p37_23603_c1 3300050507 Bacteria 4839
495 nmdc:mga0sz30_70487_c1 3300050516 Bacteria 1504
496 Ga0500610_0002892 3300053079 Bacteria 6459
497 Ga0500578_0000079 3300053086 Bacteria 107137
498 Ga0500644_0017455 3300053088 Bacteria 2084
499 Ga0500651_0000328 3300053093 Bacteria 26797
500 Ga0500651_0033984 3300053093 Bacteria 3214
501 Ga0500571_000829 3300053110 Bacteria 13303
502 Ga0500593_000088 3300053117 Bacteria 33611
503 Ga0500593_004453 3300053117 Bacteria 5424
504 Ga0500607_009403 3300053121 Bacteria 5881
505 Ga0500607_044754 3300053121 Bacteria 2380
506 Ga0500623_064712 3300053127 Bacteria 1793
507 Ga0500628_000971 3300053129 Bacteria 5048
508 Ga0500652_000857 3300053131 Bacteria 10055
509 Ga0500658_0003555 3300053134 Bacteria 5887
510 Ga0500658_0003582 3300053134 Bacteria 5860
511 Ga0500658_0016730 3300053134 Bacteria 2734
512 Ga0500559_0011544 3300053136 Bacteria 3772
513 Ga0500559_0013307 3300053136 Bacteria 3486
514 Ga0500559_0024130 3300053136 Bacteria 2585
515 Ga0500564_014651 3300053138 Bacteria 3530
516 Ga0500568_0009013 3300053139 Bacteria 4760
517 Ga0500590_006940 3300053148 Bacteria 5553
518 Ga0500604_0045840 3300053151 Bacteria 1335
519 Ga0500616_0012817 3300053153 Bacteria 4893
520 Ga0500616_0020800 3300053153 Bacteria 3684
521 Ga0500622_0000053 3300053156 Bacteria 145070
522 Ga0500634_0009472 3300053161 Bacteria 4932
523 Ga0500638_014612 3300053162 Bacteria 3585
524 Ga0500636_0020063 3300053177 Bacteria 3954
525 Ga0500645_001766 3300053730 Bacteria 10469
526 Ga0500645_002396 3300053730 Bacteria 8416
527 Ga0500587_003425 3300053739 Bacteria 2219
528 Ga0466962_0100233 3300061719 Bacteria 1391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031239 Ga0265328_10008612 Ga0265328_100086124 326
2 3300031251 Ga0265327_10000042 Ga0265327_10000042270 326
3 3300041452 Ga0451793_1732671 Ga0451793_1732671_709_1698 328
4 3300049663 Ga0501223_014343 Ga0501223_014343_452_1513 329
5 3300049822 Ga0501035_0035264 Ga0501035_0035264_1118_2329 333
6 3300042876 Ga0451577_0008704 Ga0451577_0008704_4876_6069 334
7 3300044712 Ga0453684_0034876 Ga0453684_0034876_1380_2573 334
8 3300053730 Ga0500645_002396 Ga0500645_002396_433_1575 334
9 3300042007 Ga0439449_0001485 Ga0439449_0001485_467_1615 336
10 3300005618 Ga0068864_100143804 Ga0068864_1001438042 337
11 3300005841 Ga0068863_100307281 Ga0068863_1003072811 337
12 3300014325 Ga0163163_10208710 Ga0163163_102087102 337
13 3300041404 Ga0439436_0000228 Ga0439436_0000228_11601_12788 337
14 3300041407 Ga0439447_018069 Ga0439447_018069_439_1626 337
15 3300041411 Ga0439466_0004686 Ga0439466_0004686_1829_3016 337
16 3300041413 Ga0439465_0000179 Ga0439465_0000179_3057_4244 337
17 3300041999 Ga0439433_0000297 Ga0439433_0000297_3071_4258 337
18 3300042004 Ga0439445_0001665 Ga0439445_0001665_418_1605 337
19 3300042006 Ga0439432_000674 Ga0439432_000674_4810_5997 337
20 3300042007 Ga0439449_0004068 Ga0439449_0004068_75_1262 337
21 3300042010 Ga0439452_001146 Ga0439452_001146_2058_3245 337
22 3300048929 Ga0496126_0197277 Ga0496126_0197277_529_1686 339
23 3300049763 Ga0501266_000273 Ga0501266_000273_4102_5349 344
24 3300003784 Ga0055534_1000049 Ga0055534_10000499 345
25 3300006048 Ga0075363_100020905 Ga0075363_1000209055 345
26 3300006353 Ga0075370_10006807 Ga0075370_100068079 345
27 3300006948 Ga0099826_10003969 Ga0099826_100039697 345
28 3300025263 Ga0209565_1000020 Ga0209565_1000020315 345
29 3300025273 Ga0209673_1000295 Ga0209673_10002959 345
30 3300025291 Ga0209675_1000014 Ga0209675_1000014304 345
31 3300025294 Ga0209025_1008203 Ga0209025_10082039 345
32 3300027666 Ga0209282_1000587 Ga0209282_10005876 345
33 3300050489 nmdc:mga03683_3239_c1 nmdc:mga03683_3239_c1_2419_3606 345
34 3300050496 nmdc:mga07m45_3790_c2 nmdc:mga07m45_3790_c2_4691_5911 345
35 3300006058 Ga0075432_10012075 Ga0075432_100120752 346
36 3300005355 Ga0070671_100006635 Ga0070671_1000066352 347
37 3300006237 Ga0097621_100145552 Ga0097621_1001455522 347
38 3300025931 Ga0207644_10027325 Ga0207644_100273253 347
39 3300025941 Ga0207711_10038801 Ga0207711_100388012 347
40 3300025960 Ga0207651_10086867 Ga0207651_100868672 347
41 3300030745 Ga0316182_1157155 Ga0316182_11571555 347
42 3300032004 Ga0307414_10289814 Ga0307414_102898142 347
43 3300032005 Ga0307411_10053672 Ga0307411_100536723 347
44 3300006195 Ga0075366_10076515 Ga0075366_100765152 348
45 3300027682 Ga0209971_1000817 Ga0209971_10008175 348
46 3300050489 nmdc:mga03683_4340_c2 nmdc:mga03683_4340_c2_1237_2454 348
47 3300050490 nmdc:mga03n38_14709_c1 nmdc:mga03n38_14709_c1_1699_2916 348
48 3300050493 nmdc:mga0k408_103740_c1 nmdc:mga0k408_103740_c1_618_1667 348
49 3300031238 Ga0265332_10003699 Ga0265332_100036999 349
50 3300031242 Ga0265329_10010082 Ga0265329_100100823 349
51 3300031711 Ga0265314_10004418 Ga0265314_1000441810 349
52 3300042006 Ga0439432_022154 Ga0439432_022154_807_1988 349
53 3300044673 Ga0453683_0037359 Ga0453683_0037359_326_1519 350
54 3300045051 Ga0451576_0116214 Ga0451576_0116214_1073_2266 350
55 3300021361 Ga0213872_10000132 Ga0213872_1000013234 351
56 3300027614 Ga0209970_1000061 Ga0209970_10000618 351
57 3300039447 Ga0436361_1206467 Ga0436361_1206467_32429_33496 351
58 3300042121 Ga0450919_000087 Ga0450919_000087_5306_6427 351
59 3300042531 Ga0450918_000012 Ga0450918_000012_24194_25315 351
60 3300003781 Ga0055536_1006585 Ga0055536_10065853 352
61 3300003792 Ga0055540_1004393 Ga0055540_10043935 352
62 3300005327 Ga0070658_10115877 Ga0070658_101158772 352
63 3300005353 Ga0070669_100032936 Ga0070669_1000329362 352
64 3300009148 Ga0105243_10000616 Ga0105243_1000061631 352
65 3300025292 Ga0209676_1000604 Ga0209676_100060425 352
66 3300025303 Ga0209051_1000117 Ga0209051_100011725 352
67 3300025923 Ga0207681_10019983 Ga0207681_100199833 352
68 3300025935 Ga0207709_10004548 Ga0207709_100045484 352
69 3300032005 Ga0307411_10026788 Ga0307411_100267882 352
70 3300033180 Ga0307510_10173148 Ga0307510_101731482 352
71 3300044901 Ga0466960_0022549 Ga0466960_0022549_471_1625 352
72 3300048925 Ga0496122_0000331 Ga0496122_0000331_97646_98848 352
73 3300048926 Ga0496123_0001132 Ga0496123_0001132_4671_5873 352
74 3300048927 Ga0496124_0028895 Ga0496124_0028895_792_1994 352
75 3300049823 Ga0501044_0262584 Ga0501044_0262584_249_1430 352
76 3300006195 Ga0075366_10000238 Ga0075366_100002383 353
77 3300025294 Ga0209025_1015876 Ga0209025_10158763 353
78 3300025298 Ga0209050_1003937 Ga0209050_100393710 353
79 3300048920 Ga0496117_0054586 Ga0496117_0054586_844_2070 353
80 3300048924 Ga0496121_0115217 Ga0496121_0115217_414_1640 353
81 3300048926 Ga0496123_0045949 Ga0496123_0045949_1101_2327 353
82 3300050493 nmdc:mga0k408_565_c1 nmdc:mga0k408_565_c1_11268_12440 353
83 3300005543 Ga0070672_100154402 Ga0070672_1001544022 354
84 3300025940 Ga0207691_10061992 Ga0207691_100619923 354
85 3300033180 Ga0307510_10138186 Ga0307510_101381861 354
86 3300037471 Ga0395905_0088082 Ga0395905_0088082_974_2128 354
87 3300038443 Ga0395901_0433601 Ga0395901_0433601_100_1254 354
88 3300048913 Ga0496110_0338216 Ga0496110_0338216_183_1349 354
89 3300049649 Ga0501198_000001 Ga0501198_000001_80739_81887 354
90 3300049662 Ga0501222_000004 Ga0501222_000004_69715_70863 354
91 3300003761 Ga0055535_1001208 Ga0055535_10012087 355
92 3300003762 Ga0055542_1000074 Ga0055542_1000074109 355
93 3300003773 Ga0055537_1002155 Ga0055537_10021559 355
94 3300003790 Ga0055528_1000357 Ga0055528_10003579 355
95 3300005563 Ga0068855_100064188 Ga0068855_1000641882 355
96 3300005834 Ga0068851_10003699 Ga0068851_100036996 355
97 3300009147 Ga0114129_10067958 Ga0114129_100679583 355
98 3300009545 Ga0105237_10140345 Ga0105237_101403452 355
99 3300013100 Ga0157373_10029652 Ga0157373_100296523 355
100 3300013102 Ga0157371_10053112 Ga0157371_100531122 355
101 3300013105 Ga0157369_10022851 Ga0157369_100228518 355
102 3300025228 Ga0209672_101404 Ga0209672_1014045 355
103 3300025229 Ga0209147_100958 Ga0209147_1009585 355
104 3300025242 Ga0209258_100176 Ga0209258_10017631 355
105 3300025254 Ga0209148_1000033 Ga0209148_1000033162 355
106 3300025949 Ga0207667_10068688 Ga0207667_100686882 355
107 3300031507 Ga0307509_10094110 Ga0307509_100941103 355
108 3300050507 nmdc:mga05p37_23603_c1 nmdc:mga05p37_23603_c1_2147_3298 355
109 3300053730 Ga0500645_001766 Ga0500645_001766_4710_5852 355
110 3300061719 Ga0466962_0100233 Ga0466962_0100233_52_1209 355
111 3300005366 Ga0070659_100080483 Ga0070659_1000804831 356
112 3300031548 Ga0307408_100000131 Ga0307408_10000013119 356
113 3300031901 Ga0307406_10007581 Ga0307406_100075812 356
114 3300045836 Ga0466958_0003695 Ga0466958_0003695_1285_2487 356
115 3300046528 Ga0495642_0074121 Ga0495642_0074121_120_1280 356
116 3300006048 Ga0075363_100046475 Ga0075363_1000464752 357
117 3300011119 Ga0105246_10052786 Ga0105246_100527862 357
118 3300014968 Ga0157379_10049102 Ga0157379_100491022 357
119 3300031903 Ga0307407_10077228 Ga0307407_100772282 357
120 3300031911 Ga0307412_10017312 Ga0307412_100173126 357
121 3300032004 Ga0307414_10098420 Ga0307414_100984202 357
122 3300041404 Ga0439436_0025658 Ga0439436_0025658_202_1419 357
123 3300041413 Ga0439465_0016548 Ga0439465_0016548_55_1272 357
124 3300042121 Ga0450919_004032 Ga0450919_004032_371_1588 357
125 3300042123 Ga0450921_000353 Ga0450921_000353_188_1405 357
126 3300042145 Ga0450906_001450 Ga0450906_001450_3524_4741 357
127 3300042184 Ga0450908_001370 Ga0450908_001370_2022_3239 357
128 3300042435 Ga0439434_0002846 Ga0439434_0002846_2043_3260 357
129 3300042531 Ga0450918_000471 Ga0450918_000471_1412_2629 357
130 3300046660 Ga0495625_0000045 Ga0495625_0000045_87346_88560 357
131 3300048925 Ga0496122_0051284 Ga0496122_0051284_1730_2956 357
132 3300048926 Ga0496123_0054066 Ga0496123_0054066_1015_2241 357
133 3300048928 Ga0496125_0047725 Ga0496125_0047725_1829_3055 357
134 3300003759 Ga0055525_1000004 Ga0055525_1000004402 358
135 3300003781 Ga0055536_1007725 Ga0055536_10077255 358
136 3300003792 Ga0055540_1004492 Ga0055540_10044925 358
137 3300003794 Ga0055531_10006998 Ga0055531_100069985 358
138 3300005457 Ga0070662_100011245 Ga0070662_1000112452 358
139 3300005564 Ga0070664_100035272 Ga0070664_1000352724 358
140 3300005577 Ga0068857_100054327 Ga0068857_1000543273 358
141 3300005616 Ga0068852_100167363 Ga0068852_1001673631 358
142 3300006353 Ga0075370_10059270 Ga0075370_100592703 358
143 3300009036 Ga0105244_10002225 Ga0105244_1000222510 358
144 3300009148 Ga0105243_10023521 Ga0105243_100235217 358
145 3300014497 Ga0182008_10001459 Ga0182008_1000145911 358
146 3300015261 Ga0182006_1001630 Ga0182006_100163012 358
147 3300015262 Ga0182007_10000319 Ga0182007_100003195 358
148 3300017792 Ga0163161_10034947 Ga0163161_100349472 358
149 3300025230 Ga0209563_100013 Ga0209563_100013402 358
150 3300025292 Ga0209676_1000124 Ga0209676_1000124176 358
151 3300025298 Ga0209050_1001006 Ga0209050_10010067 358
152 3300025303 Ga0209051_1000579 Ga0209051_100057939 358
153 3300025304 Ga0209257_1000258 Ga0209257_100025855 358
154 3300025940 Ga0207691_10083356 Ga0207691_100833562 358
155 3300026121 Ga0207683_10189983 Ga0207683_101899832 358
156 3300046460 Ga0495638_0027987 Ga0495638_0027987_2207_3439 358
157 3300046512 Ga0495610_0043493 Ga0495610_0043493_909_2141 358
158 3300046513 Ga0495616_0021755 Ga0495616_0021755_278_1510 358
159 3300046518 Ga0495631_0000264 Ga0495631_0000264_3314_4546 358
160 3300046520 Ga0495637_0060651 Ga0495637_0060651_136_1368 358
161 3300046539 Ga0495621_0003485 Ga0495621_0003485_1104_2336 358
162 3300046539 Ga0495621_0020363 Ga0495621_0020363_131_1318 358
163 3300046615 Ga0495656_0001656 Ga0495656_0001656_1967_3154 358
164 3300048090 Ga0495615_0007914 Ga0495615_0007914_483_1670 358
165 3300048924 Ga0496121_0194600 Ga0496121_0194600_153_1385 358
166 3300053134 Ga0500658_0003555 Ga0500658_0003555_3770_5002 358
167 3300053136 Ga0500559_0013307 Ga0500559_0013307_1903_3135 358
168 3300053139 Ga0500568_0009013 Ga0500568_0009013_494_1726 358
169 3300053153 Ga0500616_0020800 Ga0500616_0020800_2422_3654 358
170 3300006048 Ga0075363_100008797 Ga0075363_1000087972 359
171 3300006195 Ga0075366_10002896 Ga0075366_100028965 359
172 3300014497 Ga0182008_10052585 Ga0182008_100525852 359
173 3300017792 Ga0163161_10118687 Ga0163161_101186872 359
174 3300031712 Ga0265342_10038052 Ga0265342_100380523 359
175 3300049573 Ga0501037_0089198 Ga0501037_0089198_390_1541 359
176 3300049679 Ga0501249_019504 Ga0501249_019504_240_1418 359
177 3300050493 nmdc:mga0k408_8337_c1 nmdc:mga0k408_8337_c1_1145_2389 359
178 3300050496 nmdc:mga07m45_33031_c1 nmdc:mga07m45_33031_c1_912_2156 359
179 3300053088 Ga0500644_0017455 Ga0500644_0017455_461_1630 359
180 3300053136 Ga0500559_0011544 Ga0500559_0011544_316_1521 359
181 3300003347 JGI26128J50194_1000314 JGI26128J50194_10003143 360
182 3300017792 Ga0163161_10008385 Ga0163161_100083856 360
183 3300025728 Ga0207655_1002862 Ga0207655_10028626 360
184 3300025935 Ga0207709_10006545 Ga0207709_100065459 360
185 3300025945 Ga0207679_10077481 Ga0207679_100774812 360
186 3300026116 Ga0207674_10115693 Ga0207674_101156932 360
187 3300027526 Ga0209968_1000086 Ga0209968_10000868 360
188 3300027695 Ga0209966_1000084 Ga0209966_100008415 360
189 3300030522 Ga0307512_10083347 Ga0307512_100833473 360
190 3300031507 Ga0307509_10077519 Ga0307509_100775195 360
191 3300031616 Ga0307508_10204679 Ga0307508_102046792 360
192 3300033179 Ga0307507_10037515 Ga0307507_100375157 360
193 3300037471 Ga0395905_0001350 Ga0395905_0001350_15965_17137 360
194 3300048917 Ga0496114_0131563 Ga0496114_0131563_742_1905 360
195 3300048919 Ga0496116_0021806 Ga0496116_0021806_3319_4539 360
196 3300048920 Ga0496117_0015535 Ga0496117_0015535_3086_4306 360
197 3300048921 Ga0496118_0007738 Ga0496118_0007738_5757_6977 360
198 3300048928 Ga0496125_0049373 Ga0496125_0049373_88_1308 360
199 3300050496 nmdc:mga07m45_36403_c1 nmdc:mga07m45_36403_c1_895_2115 360
200 iso_pu_bacteria 2881101125 2881102618 360
201 3300031731 Ga0307405_10069914 Ga0307405_100699142 361
202 3300041406 Ga0439439_0002942 Ga0439439_0002942_1977_3161 361
203 3300041407 Ga0439447_018309 Ga0439447_018309_182_1387 361
204 3300041411 Ga0439466_0015768 Ga0439466_0015768_1488_2672 361
205 3300042002 Ga0439442_004377 Ga0439442_004377_25_1209 361
206 3300042010 Ga0439452_006020 Ga0439452_006020_2375_3559 361
207 3300042014 Ga0439457_011620 Ga0439457_011620_360_1544 361
208 3300042133 Ga0450896_003760 Ga0450896_003760_839_2023 361
209 3300042435 Ga0439434_0041772 Ga0439434_0041772_38_1222 361
210 3300046453 Ga0495627_010127 Ga0495627_010127_304_1548 361
211 3300053151 Ga0500604_0045840 Ga0500604_0045840_201_1322 361
212 iso_pu_bacteria 2721755523 2722883381 361
213 iso_pu_bacteria 2839138175 2839139156 361
214 iso_pu_bacteria 2932422444 2932424892 361
215 3300002987 JGI25159J45721_1005503 JGI25159J45721_10055032 362
216 3300003215 JGI25153J46596_10008693 JGI25153J46596_100086935 362
217 3300003374 JGI25161J50226_1002812 JGI25161J50226_10028123 362
218 3300003771 Ga0055526_1006930 Ga0055526_10069305 362
219 3300003775 Ga0055524_1004968 Ga0055524_10049684 362
220 3300003781 Ga0055536_1006002 Ga0055536_10060024 362
221 3300003784 Ga0055534_1002437 Ga0055534_10024378 362
222 3300003790 Ga0055528_1007771 Ga0055528_10077715 362
223 3300003791 Ga0055530_10005199 Ga0055530_100051995 362
224 3300003792 Ga0055540_1009536 Ga0055540_10095362 362
225 3300003794 Ga0055531_10015568 Ga0055531_100155682 362
226 3300004625 Ga0055543_1005006 Ga0055543_10050063 362
227 3300005262 Ga0065165_1024940 Ga0065165_10249401 362
228 3300006048 Ga0075363_100032110 Ga0075363_1000321102 362
229 3300009148 Ga0105243_10000435 Ga0105243_1000043513 362
230 3300013306 Ga0163162_10144941 Ga0163162_101449412 362
231 3300025245 Ga0207425_1004328 Ga0207425_10043284 362
232 3300025263 Ga0209565_1002017 Ga0209565_10020175 362
233 3300025273 Ga0209673_1000209 Ga0209673_1000209115 362
234 3300025273 Ga0209673_1004212 Ga0209673_10042125 362
235 3300025284 Ga0209130_1001877 Ga0209130_100187711 362
236 3300025291 Ga0209675_1009891 Ga0209675_10098915 362
237 3300025292 Ga0209676_1000048 Ga0209676_1000048167 362
238 3300025294 Ga0209025_1017783 Ga0209025_10177833 362
239 3300025295 Ga0209564_1000760 Ga0209564_100076018 362
240 3300025298 Ga0209050_1000012 Ga0209050_1000012167 362
241 3300025299 Ga0209256_1000095 Ga0209256_1000095120 362
242 3300025302 Ga0207426_1000161 Ga0207426_10001615 362
243 3300025303 Ga0209051_1000019 Ga0209051_100001986 362
244 3300025304 Ga0209257_1000024 Ga0209257_1000024113 362
245 3300025304 Ga0209257_1007294 Ga0209257_10072942 362
246 3300025935 Ga0207709_10000193 Ga0207709_1000019375 362
247 3300046525 Ga0495663_0008628 Ga0495663_0008628_521_1651 362
248 3300046558 Ga0495633_0005168 Ga0495633_0005168_4608_5738 362
249 3300048926 Ga0496123_0078131 Ga0496123_0078131_365_1495 362
250 3300048928 Ga0496125_0085368 Ga0496125_0085368_551_1681 362
251 3300003187 JGI25151J46595_10003608 JGI25151J46595_100036088 363
252 3300005457 Ga0070662_100003686 Ga0070662_1000036868 363
253 3300005616 Ga0068852_100160790 Ga0068852_1001607902 363
254 3300006186 Ga0075369_10011708 Ga0075369_100117082 363
255 3300006353 Ga0075370_10027185 Ga0075370_100271854 363
256 3300006946 Ga0079104_1000007 Ga0079104_1000007285 363
257 3300009148 Ga0105243_10047353 Ga0105243_100473532 363
258 3300010375 Ga0105239_10007927 Ga0105239_1000792714 363
259 3300025258 Ga0209129_1003482 Ga0209129_10034829 363
260 3300025294 Ga0209025_1000204 Ga0209025_1000204135 363
261 3300025303 Ga0209051_1000099 Ga0209051_1000099131 363
262 3300025933 Ga0207706_10004061 Ga0207706_1000406111 363
263 3300025935 Ga0207709_10010024 Ga0207709_100100244 363
264 3300026142 Ga0207698_10261943 Ga0207698_102619432 363
265 3300027111 Ga0209281_1000020 Ga0209281_1000020213 363
266 3300028794 Ga0307515_10038558 Ga0307515_100385589 363
267 3300031507 Ga0307509_10027173 Ga0307509_100271734 363
268 3300045976 Ga0466967_0104295 Ga0466967_0104295_1383_2585 363
269 3300048913 Ga0496110_0150898 Ga0496110_0150898_227_1414 363
270 3300050489 nmdc:mga03683_6167_c1 nmdc:mga03683_6167_c1_2662_3882 363
271 3300050494 nmdc:mga06z11_44386_c1 nmdc:mga06z11_44386_c1_69_1283 363
272 3300050496 nmdc:mga07m45_1630_c1 nmdc:mga07m45_1630_c1_4442_5656 363
273 3300050516 nmdc:mga0sz30_70487_c1 nmdc:mga0sz30_70487_c1_256_1476 363
274 iso_pu_bacteria 2904541872 2904545287 363
275 iso_pu_bacteria 2929160207 2929165479 363
276 3300006195 Ga0075366_10006604 Ga0075366_100066042 364
277 3300006195 Ga0075366_10017161 Ga0075366_100171613 364
278 3300042007 Ga0439449_0057197 Ga0439449_0057197_56_1201 364
279 3300044656 Ga0466969_0019802 Ga0466969_0019802_903_2063 364
280 3300044658 Ga0466972_0000828 Ga0466972_0000828_8302_9459 364
281 3300044684 Ga0466966_0044460 Ga0466966_0044460_1359_2519 364
282 3300044693 Ga0466961_0011529 Ga0466961_0011529_2841_4001 364
283 3300044719 Ga0466971_0005612 Ga0466971_0005612_4014_5174 364
284 3300045051 Ga0451576_0062057 Ga0451576_0062057_1771_2919 364
285 3300050493 nmdc:mga0k408_11856_c1 nmdc:mga0k408_11856_c1_3440_4594 364
286 3300050493 nmdc:mga0k408_17615_c1 nmdc:mga0k408_17615_c1_1564_2736 364
287 iso_pu_bacteria 2547132374 2548497050 364
288 iso_pu_bacteria 2585428062 2587754153 364
289 iso_pu_bacteria 2643221717 2644645074 364
290 iso_pu_bacteria 2738543013 2739249557 364
291 iso_pu_bacteria 2919462493 2919463797 364
292 3300005289 Ga0065704_10084587 Ga0065704_100845872 365
293 3300005543 Ga0070672_100234882 Ga0070672_1002348822 365
294 3300005564 Ga0070664_100301511 Ga0070664_1003015111 365
295 3300006038 Ga0075365_10032838 Ga0075365_100328382 365
296 3300025294 Ga0209025_1001228 Ga0209025_100122832 365
297 3300025940 Ga0207691_10150610 Ga0207691_101506102 365
298 3300025945 Ga0207679_10158237 Ga0207679_101582372 365
299 3300026095 Ga0207676_10162173 Ga0207676_101621732 365
300 3300042876 Ga0451577_0000166 Ga0451577_0000166_32448_33593 365
301 3300044712 Ga0453684_0000187 Ga0453684_0000187_235276_236421 365
302 3300045051 Ga0451576_0001582 Ga0451576_0001582_4401_5546 365
303 3300048925 Ga0496122_0020488 Ga0496122_0020488_832_1998 365
304 3300048926 Ga0496123_0026744 Ga0496123_0026744_2327_3493 365
305 3300048927 Ga0496124_0002378 Ga0496124_0002378_4514_5641 365
306 3300048927 Ga0496124_0139715 Ga0496124_0139715_302_1468 365
307 3300048928 Ga0496125_0002906 Ga0496125_0002906_15705_16871 365
308 3300048928 Ga0496125_0019166 Ga0496125_0019166_3721_4848 365
309 3300048929 Ga0496126_0019119 Ga0496126_0019119_2990_4156 365
310 3300053153 Ga0500616_0012817 Ga0500616_0012817_1029_2198 365
311 iso_pu_bacteria 2643221570 2643867118 365
312 iso_pu_bacteria 2643221596 2643990058 365
313 iso_pu_bacteria 2643221609 2644059425 365
314 iso_pu_bacteria 2643221611 2644074194 365
315 iso_pu_bacteria 2643221652 2644295539 365
316 iso_pu_bacteria 2738543012 2739240946 365
317 iso_pu_bacteria 2816332133 2816471976 365
318 iso_pu_bacteria 2842718218 2842718580 365
319 iso_pu_bacteria 2842733646 2842733972 365
320 iso_pu_bacteria 2842747753 2842752579 365
321 iso_pu_bacteria 2885192300 2885193007 365
322 iso_pu_bacteria 2894023352 2894027226 365
323 iso_pu_bacteria 2990710928 2990711287 365
324 3300005355 Ga0070671_100009262 Ga0070671_1000092623 366
325 3300005618 Ga0068864_100077585 Ga0068864_1000775853 366
326 3300006178 Ga0075367_10145549 Ga0075367_101455492 366
327 3300009148 Ga0105243_10082264 Ga0105243_100822642 366
328 3300009176 Ga0105242_10041963 Ga0105242_100419631 366
329 3300015683 Ga0183362_10005 Ga0183362_10005281 366
330 3300025934 Ga0207686_10001446 Ga0207686_100014465 366
331 3300026095 Ga0207676_10063431 Ga0207676_100634313 366
332 3300027876 Ga0209974_10009116 Ga0209974_100091162 366
333 3300028794 Ga0307515_10053971 Ga0307515_100539712 366
334 3300031235 Ga0265330_10000110 Ga0265330_1000011019 366
335 3300031238 Ga0265332_10000011 Ga0265332_1000001118 366
336 3300031241 Ga0265325_10010431 Ga0265325_100104317 366
337 3300031548 Ga0307408_100092135 Ga0307408_1000921351 366
338 3300031711 Ga0265314_10000026 Ga0265314_10000026250 366
339 3300031730 Ga0307516_10055082 Ga0307516_100550825 366
340 3300041456 Ga0451795_0411808 Ga0451795_0411808_200_1309 366
341 3300046512 Ga0495610_0038118 Ga0495610_0038118_881_1990 366
342 3300046515 Ga0495620_0056375 Ga0495620_0056375_264_1373 366
343 3300046519 Ga0495632_0008733 Ga0495632_0008733_849_1958 366
344 3300046522 Ga0495643_0095056 Ga0495643_0095056_197_1306 366
345 3300046530 Ga0495654_0006360 Ga0495654_0006360_2198_3367 366
346 3300046660 Ga0495625_0002511 Ga0495625_0002511_14241_15350 366
347 3300048904 Ga0496101_0009378 Ga0496101_0009378_3091_4320 366
348 3300048915 Ga0496112_0033498 Ga0496112_0033498_3595_4776 366
349 3300049568 Ga0501031_0006541 Ga0501031_0006541_6131_7318 366
350 3300050493 nmdc:mga0k408_69368_c1 nmdc:mga0k408_69368_c1_517_1626 366
351 3300050496 nmdc:mga07m45_92277_c1 nmdc:mga07m45_92277_c1_186_1295 366
352 3300053134 Ga0500658_0016730 Ga0500658_0016730_1022_2131 366
353 3300053739 Ga0500587_003425 Ga0500587_003425_779_1888 366
354 iso_pu_bacteria 2643221658 2644328492 366
355 iso_pu_bacteria 2643221683 2644466904 366
356 iso_pu_bacteria 2738541307 2738880636 366
357 iso_pu_bacteria 2842677519 2842679698 366
358 iso_pu_bacteria 2928084124 2928088550 366
359 iso_pu_bacteria 2945972063 2945975541 366
360 iso_pu_bacteria 2954767861 2954769015 366
361 iso_pu_bacteria 2974320154 2974320546 366
362 3300003784 Ga0055534_1003010 Ga0055534_10030103 367
363 3300005339 Ga0070660_100206458 Ga0070660_1002064582 367
364 3300005344 Ga0070661_100007719 Ga0070661_1000077194 367
365 3300005366 Ga0070659_100001726 Ga0070659_1000017263 367
366 3300005548 Ga0070665_100366565 Ga0070665_1003665651 367
367 3300005564 Ga0070664_100016250 Ga0070664_1000162507 367
368 3300014497 Ga0182008_10003510 Ga0182008_100035109 367
369 3300021361 Ga0213872_10005641 Ga0213872_100056412 367
370 3300025284 Ga0209130_1003855 Ga0209130_10038559 367
371 3300025291 Ga0209675_1006340 Ga0209675_10063403 367
372 3300025919 Ga0207657_10256154 Ga0207657_102561542 367
373 3300025920 Ga0207649_10012020 Ga0207649_100120203 367
374 3300025932 Ga0207690_10020776 Ga0207690_100207762 367
375 3300025945 Ga0207679_10000647 Ga0207679_100006473 367
376 3300026121 Ga0207683_10124076 Ga0207683_101240762 367
377 3300028379 Ga0268266_10289958 Ga0268266_102899582 367
378 3300028794 Ga0307515_10000040 Ga0307515_1000004085 367
379 3300037471 Ga0395905_0042000 Ga0395905_0042000_1265_2416 367
380 3300039447 Ga0436361_0334210 Ga0436361_0334210_6315_7478 367
381 3300050489 nmdc:mga03683_25993_c1 nmdc:mga03683_25993_c1_753_1937 367
382 3300050493 nmdc:mga0k408_5217_c1 nmdc:mga0k408_5217_c1_2971_4155 367
383 3300053136 Ga0500559_0024130 Ga0500559_0024130_775_1980 367
384 3300053148 Ga0500590_006940 Ga0500590_006940_1853_3007 367
385 iso_pu_bacteria 2513020051 2513230638 367
386 iso_pu_bacteria 2643221628 2644161728 367
387 iso_pu_bacteria 2643221672 2644399728 367
388 iso_pu_bacteria 2738541277 2738721292 367
389 iso_pu_bacteria 2738543019 2739280961 367
390 iso_pu_bacteria 2818991446 2819601599 367
391 iso_pu_bacteria 2831265667 2831269213 367
392 iso_pu_bacteria 2838054893 2838059187 367
393 iso_pu_bacteria 2899924645 2899930662 367
394 iso_pu_bacteria 2904449895 2904452572 367
395 iso_pu_bacteria 2904456579 2904460829 367
396 iso_pu_bacteria 2928037797 2928041016 367
397 iso_pu_bacteria 2928044640 2928047858 367
398 iso_pu_bacteria 2928051484 2928055750 367
399 iso_pu_bacteria 2928064002 2928069849 367
400 iso_pu_bacteria 2929520902 2929522524 367
401 iso_pu_bacteria 2945909444 2945909848 367
402 iso_pu_bacteria 2945945610 2945945925 367
403 iso_pu_bacteria 2945984333 2945988159 367
404 3300002773 JGI25152J39213_1004689 JGI25152J39213_10046893 368
405 3300002773 JGI25152J39213_1004789 JGI25152J39213_10047893 368
406 3300002987 JGI25159J45721_1006777 JGI25159J45721_10067772 368
407 3300003187 JGI25151J46595_10006860 JGI25151J46595_100068605 368
408 3300003215 JGI25153J46596_10006922 JGI25153J46596_100069225 368
409 3300003354 JGI25160J50197_1010375 JGI25160J50197_10103752 368
410 3300003374 JGI25161J50226_1005361 JGI25161J50226_10053613 368
411 3300003578 Ga0006562J51391_1098951 Ga0006562J51391_10989514 368
412 3300003578 Ga0006562J51391_1098954 Ga0006562J51391_10989542 368
413 3300003771 Ga0055526_1006915 Ga0055526_10069155 368
414 3300003773 Ga0055537_1002771 Ga0055537_10027714 368
415 3300003775 Ga0055524_1004952 Ga0055524_10049525 368
416 3300003784 Ga0055534_1005545 Ga0055534_10055452 368
417 3300003790 Ga0055528_1005328 Ga0055528_10053284 368
418 3300003794 Ga0055531_10009815 Ga0055531_100098157 368
419 3300004625 Ga0055543_1001765 Ga0055543_10017656 368
420 3300005262 Ga0065165_1005078 Ga0065165_10050785 368
421 3300005347 Ga0070668_100204226 Ga0070668_1002042262 368
422 3300005354 Ga0070675_100235334 Ga0070675_1002353341 368
423 3300005367 Ga0070667_100010858 Ga0070667_1000108589 368
424 3300005844 Ga0068862_100008979 Ga0068862_1000089797 368
425 3300006048 Ga0075363_100105768 Ga0075363_1001057681 368
426 3300006195 Ga0075366_10026477 Ga0075366_100264773 368
427 3300013104 Ga0157370_10002648 Ga0157370_100026489 368
428 3300013104 Ga0157370_10131926 Ga0157370_101319263 368
429 3300013306 Ga0163162_10088242 Ga0163162_100882422 368
430 3300014497 Ga0182008_10005914 Ga0182008_100059143 368
431 3300014969 Ga0157376_10121191 Ga0157376_101211912 368
432 3300015262 Ga0182007_10001800 Ga0182007_1000180011 368
433 3300017792 Ga0163161_10005248 Ga0163161_100052489 368
434 3300017792 Ga0163161_10017609 Ga0163161_100176095 368
435 3300025245 Ga0207425_1000274 Ga0207425_10002749 368
436 3300025258 Ga0209129_1000270 Ga0209129_100027034 368
437 3300025284 Ga0209130_1000558 Ga0209130_10005587 368
438 3300025291 Ga0209675_1005255 Ga0209675_10052557 368
439 3300025292 Ga0209676_1016955 Ga0209676_10169552 368
440 3300025294 Ga0209025_1000733 Ga0209025_100073326 368
441 3300025295 Ga0209564_1000753 Ga0209564_100075319 368
442 3300025297 Ga0209758_1000833 Ga0209758_100083323 368
443 3300025297 Ga0209758_1002931 Ga0209758_100293115 368
444 3300025299 Ga0209256_1000527 Ga0209256_100052734 368
445 3300025302 Ga0207426_1000955 Ga0207426_100095526 368
446 3300025303 Ga0209051_1017840 Ga0209051_10178402 368
447 3300025913 Ga0207695_10329184 Ga0207695_103291841 368
448 3300025986 Ga0207658_10084436 Ga0207658_100844363 368
449 3300026041 Ga0207639_10010748 Ga0207639_100107482 368
450 3300028380 Ga0268265_10008387 Ga0268265_100083875 368
451 3300030731 Ga0316177_1091043 Ga0316177_10910432 368
452 3300030733 Ga0314311_1046356 Ga0314311_104635610 368
453 3300030736 Ga0316180_1167384 Ga0316180_11673842 368
454 3300030744 Ga0316181_1026435 Ga0316181_10264359 368
455 3300031251 Ga0265327_10027427 Ga0265327_100274273 368
456 3300031548 Ga0307408_100103828 Ga0307408_1001038283 368
457 3300031616 Ga0307508_10000271 Ga0307508_1000027143 368
458 3300031649 Ga0307514_10004711 Ga0307514_1000471112 368
459 3300031901 Ga0307406_10001995 Ga0307406_100019955 368
460 3300031911 Ga0307412_10006569 Ga0307412_100065695 368
461 3300042133 Ga0450896_010552 Ga0450896_010552_24_1241 368
462 3300046453 Ga0495627_004449 Ga0495627_004449_337_1554 368
463 3300046520 Ga0495637_0005370 Ga0495637_0005370_3227_4444 368
464 3300047321 Ga0495676_0044826 Ga0495676_0044826_185_1417 368
465 3300048904 Ga0496101_0001836 Ga0496101_0001836_3233_4420 368
466 3300048905 Ga0496102_0006927 Ga0496102_0006927_4279_5466 368
467 3300048907 Ga0496104_0003316 Ga0496104_0003316_9071_10258 368
468 3300048908 Ga0496105_0013022 Ga0496105_0013022_451_1638 368
469 3300048909 Ga0496106_0053158 Ga0496106_0053158_1403_2590 368
470 3300048921 Ga0496118_0044930 Ga0496118_0044930_125_1345 368
471 3300048926 Ga0496123_0082929 Ga0496123_0082929_237_1439 368
472 3300048927 Ga0496124_0041676 Ga0496124_0041676_1489_2709 368
473 3300048928 Ga0496125_0034938 Ga0496125_0034938_364_1584 368
474 3300049679 Ga0501249_002599 Ga0501249_002599_2038_3252 368
475 3300049705 Ga0501225_0019731 Ga0501225_0019731_589_1803 368
476 3300049759 Ga0501262_000173 Ga0501262_000173_1733_2947 368
477 3300050493 nmdc:mga0k408_22217_c1 nmdc:mga0k408_22217_c1_593_1780 368
478 3300050496 nmdc:mga07m45_6665_c1 nmdc:mga07m45_6665_c1_4214_5401 368
479 3300053079 Ga0500610_0002892 Ga0500610_0002892_4447_5664 368
480 3300053093 Ga0500651_0000328 Ga0500651_0000328_2891_4123 368
481 3300053110 Ga0500571_000829 Ga0500571_000829_3756_4988 368
482 3300053117 Ga0500593_000088 Ga0500593_000088_2270_3487 368
483 3300053121 Ga0500607_009403 Ga0500607_009403_567_1784 368
484 3300053121 Ga0500607_044754 Ga0500607_044754_265_1482 368
485 3300053134 Ga0500658_0003582 Ga0500658_0003582_886_2118 368
486 3300053138 Ga0500564_014651 Ga0500564_014651_1996_3228 368
487 3300053161 Ga0500634_0009472 Ga0500634_0009472_492_1724 368
488 3300053162 Ga0500638_014612 Ga0500638_014612_1789_3021 368
489 3300053177 Ga0500636_0020063 Ga0500636_0020063_2348_3580 368
490 iso_pu_bacteria 2643221644 2644246923 368
491 iso_pu_bacteria 2885198086 2885203075 368
492 iso_pu_bacteria 2885211737 2885216528 368
493 3300044735 Ga0466968_0005703 Ga0466968_0005703_2807_3970 369
494 3300046542 Ga0495597_0019840 Ga0495597_0019840_1215_2390 369
495 3300046690 Ga0495624_0082953 Ga0495624_0082953_616_1785 369
496 3300047673 Ga0495593_0049930 Ga0495593_0049930_315_1484 369
497 3300028794 Ga0307515_10005119 Ga0307515_1000511927 370
498 3300031548 Ga0307408_100078210 Ga0307408_1000782102 370
499 3300031649 Ga0307514_10004100 Ga0307514_100041009 370
500 3300006177 Ga0075362_10045642 Ga0075362_100456422 371
501 3300006353 Ga0075370_10001826 Ga0075370_100018265 371
502 3300046519 Ga0495632_0009624 Ga0495632_0009624_623_1795 371
503 3300053093 Ga0500651_0033984 Ga0500651_0033984_488_1660 371
504 3300053127 Ga0500623_064712 Ga0500623_064712_201_1373 371
505 3300053129 Ga0500628_000971 Ga0500628_000971_3621_4793 371
506 3300053131 Ga0500652_000857 Ga0500652_000857_4596_5768 371
507 3300053156 Ga0500622_0000053 Ga0500622_0000053_8441_9613 371
508 3300046542 Ga0495597_0001605 Ga0495597_0001605_10666_11847 372
509 3300005331 Ga0070670_100007394 Ga0070670_1000073948 374
510 3300005333 Ga0070677_10008030 Ga0070677_100080303 374
511 3300005335 Ga0070666_10098326 Ga0070666_100983262 374
512 3300005353 Ga0070669_100086762 Ga0070669_1000867622 374
513 3300005354 Ga0070675_100009273 Ga0070675_1000092735 374
514 3300005355 Ga0070671_100007158 Ga0070671_1000071588 374
515 3300005355 Ga0070671_100038584 Ga0070671_1000385842 374
516 3300005356 Ga0070674_100001710 Ga0070674_1000017102 374
517 3300005356 Ga0070674_100002407 Ga0070674_1000024075 374
518 3300005364 Ga0070673_100010080 Ga0070673_1000100805 374
519 3300005367 Ga0070667_100139274 Ga0070667_1001392742 374
520 3300005456 Ga0070678_100004379 Ga0070678_1000043798 374
521 3300005459 Ga0068867_100011197 Ga0068867_1000111975 374
522 3300005459 Ga0068867_100035060 Ga0068867_1000350602 374
523 3300005543 Ga0070672_100014240 Ga0070672_1000142405 374
524 3300005548 Ga0070665_100255353 Ga0070665_1002553532 374
525 3300005564 Ga0070664_100111858 Ga0070664_1001118582 374
526 3300005578 Ga0068854_100067480 Ga0068854_1000674802 374
527 3300005618 Ga0068864_100017128 Ga0068864_1000171285 374
528 3300005840 Ga0068870_10008654 Ga0068870_100086543 374
529 3300006358 Ga0068871_100098749 Ga0068871_1000987492 374
530 3300017792 Ga0163161_10135195 Ga0163161_101351952 374
531 3300021361 Ga0213872_10000068 Ga0213872_1000006832 374
532 3300025908 Ga0207643_10040836 Ga0207643_100408363 374
533 3300025923 Ga0207681_10006812 Ga0207681_100068123 374
534 3300025925 Ga0207650_10029526 Ga0207650_100295264 374
535 3300025925 Ga0207650_10159210 Ga0207650_101592101 374
536 3300025926 Ga0207659_10001102 Ga0207659_100011029 374
537 3300025931 Ga0207644_10000537 Ga0207644_1000053718 374
538 3300025937 Ga0207669_10028040 Ga0207669_100280402 374
539 3300025937 Ga0207669_10043995 Ga0207669_100439953 374
540 3300025940 Ga0207691_10028304 Ga0207691_100283045 374
541 3300025945 Ga0207679_10070334 Ga0207679_100703343 374
542 3300025960 Ga0207651_10046201 Ga0207651_100462014 374
543 3300025986 Ga0207658_10086895 Ga0207658_100868952 374
544 3300026023 Ga0207677_10014089 Ga0207677_100140892 374
545 3300026089 Ga0207648_10012759 Ga0207648_100127595 374
546 3300026089 Ga0207648_10013271 Ga0207648_100132714 374
547 3300026089 Ga0207648_10031382 Ga0207648_100313824 374
548 3300026095 Ga0207676_10084736 Ga0207676_100847363 374
549 3300026121 Ga0207683_10118324 Ga0207683_101183243 374
550 3300028379 Ga0268266_10211221 Ga0268266_102112212 374
551 3300028381 Ga0268264_10138406 Ga0268264_101384062 374
552 3300028786 Ga0307517_10119368 Ga0307517_101193682 374
553 3300031548 Ga0307408_100024419 Ga0307408_1000244192 374
554 3300031731 Ga0307405_10035197 Ga0307405_100351973 374
555 3300031911 Ga0307412_10007679 Ga0307412_100076793 374
556 3300032002 Ga0307416_100160853 Ga0307416_1001608532 374
557 3300032005 Ga0307411_10007510 Ga0307411_100075102 374
558 3300039447 Ga0436361_0793297 Ga0436361_0793297_17442_18599 374
559 3300044712 Ga0453684_0118034 Ga0453684_0118034_309_1466 374
560 3300045049 Ga0466959_0012248 Ga0466959_0012248_3993_5153 375
561 3300003791 Ga0055530_10018184 Ga0055530_100181842 376
562 3300025298 Ga0209050_1000118 Ga0209050_100011833 376
563 3300047472 Ga0495686_0001940 Ga0495686_0001940_15035_16207 377
564 3300006042 Ga0075368_10073101 Ga0075368_100731012 378
565 3300028786 Ga0307517_10125318 Ga0307517_101253181 378
566 3300037471 Ga0395905_0051105 Ga0395905_0051105_2588_3796 378
567 3300046519 Ga0495632_0008136 Ga0495632_0008136_3037_4209 378
568 3300006353 Ga0075370_10102504 Ga0075370_101025042 379
569 iso_pu_bacteria 2585428057 2587728042 379
570 3300048905 Ga0496102_0007775 Ga0496102_0007775_3672_4820 380
571 3300053117 Ga0500593_004453 Ga0500593_004453_401_1549 380
572 iso_pu_bacteria 2585428058 2587731105 380
573 iso_pu_bacteria 2588253510 2588289858 380
574 iso_pu_bacteria 2643221592 2643972343 380
575 iso_pu_bacteria 2643221625 2644141546 380
576 iso_pu_bacteria 2643221648 2644275683 380
577 3300002773 JGI25152J39213_1000752 JGI25152J39213_10007526 382
578 3300003215 JGI25153J46596_10008440 JGI25153J46596_100084404 382
579 3300003215 JGI25153J46596_10011325 JGI25153J46596_100113254 382
580 3300005262 Ga0065165_1001501 Ga0065165_100150110 382
581 3300025258 Ga0209129_1000062 Ga0209129_1000062160 382
582 3300025273 Ga0209673_1017691 Ga0209673_10176912 382
583 3300025295 Ga0209564_1000176 Ga0209564_100017680 382
584 3300025297 Ga0209758_1000129 Ga0209758_10001299 382
585 3300025297 Ga0209758_1000327 Ga0209758_10003278 382
586 3300025299 Ga0209256_1020091 Ga0209256_10200912 382
587 3300044712 Ga0453684_0006584 Ga0453684_0006584_16089_17267 382
588 3300053086 Ga0500578_0000079 Ga0500578_0000079_101746_102894 382

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02628

COX15-CtaA

Cytochrome oxidase assembly protein

46

370

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ied-assembly1.cif.gz_A crystal structure of heme a synthase from bacillus subtilis 0.7793 34 363
6ied-assembly1.cif.gz_A crystal structure of heme a synthase from bacillus subtilis 0.7582 34 363
8aw5-assembly1.cif.gz_A cryo-em structure of heme a synthase trimer from aquifex aeolicus 0.6762 41 370
8aw5-assembly1.cif.gz_A cryo-em structure of heme a synthase trimer from aquifex aeolicus 0.6697 41 370
7jh6-assembly4.cif.gz_D de novo designed two-domain di-zn(ii) and porphyrin-binding protein 0.4866 36 193
ID Description Score Start End Superfamily
af_A4QP81_336_538_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5481 48 193 1.20.120.1770
af_Q9VIT5_59_258_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5405 13 193 1.20.120.1770
af_Q8MSU3_391_577_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5181 47 193 1.20.120.1770
af_O80854_5_217_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5095 45 193 1.20.120.1770
af_Q2G1R0_3_202_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4923 3 188 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A519IA09-F1-model_v4 Heme A synthase 0.9711 7 361 GO:0006784
GO:0016020
GO:0016653
AF-A0A254ND56-F1-model_v4 Heme A synthase 0.9673 7 360 GO:0006784
GO:0016020
GO:0016653
AF-A0A5C7UWE1-F1-model_v4 Heme A synthase 0.9563 20 360 GO:0006784
GO:0016020
GO:0016653
AF-A0A2N2SM84-F1-model_v4 Heme A synthase 0.9521 41 331 GO:0006784
GO:0016020
GO:0016653
AF-A0A0M0FY34-F1-model_v4 deleted 0.9514 41 360

Feature Viewer

pLDDT pTM Quality
88.1 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map