F466476

General Info

Members Datasets Scaffolds Average Seq Length
585 282 554 114

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0961218|Ga0453684_0961218_182_481
Length 99
Sequence MKLRIQSINFDATTTLESYINKKLLKLEKNFDEIQNVDVYLKVVKPESATNKEAEIKVSIPNVDFFASKTCDSFEEATDLTIEAIDKQIRKHKEKSTKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
17 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
18 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
19 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
20 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
21 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
22 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
23 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
24 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
25 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
26 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
27 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
28 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
29 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
30 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
31 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
32 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
37 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
38 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
39 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
178 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
179 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
180 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
181 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
182 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
207 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
223 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
279 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
281 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.43
Metatranscriptomes 4.27
Isolates 5.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.4
Nodule 0
Rhizoplane 1.03
Rhizosphere 82.56
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2336375 2162886007 Bacteria 1432
2 JGI24736J21556_1015162 3300001904 Bacteria 1236
3 JGI24737J22298_10000765 3300001990 Bacteria 11362
4 JGI24743J22301_10006041 3300001991 Bacteria 2046
5 JGI24735J21928_10000009 3300002067 Bacteria 247425
6 JGI24738J21930_10124490 3300002075 Bacteria 561
7 JGI24744J21845_10005025 3300002077 Bacteria 2738
8 JGI25162J39368_1000120 3300002737 Bacteria 86031
9 JGI25162J39368_1001524 3300002737 Bacteria 11972
10 JGI25157J39369_1006802 3300002741 Bacteria 1705
11 JGI25164J39214_1000824 3300002772 Bacteria 10827
12 JGI25152J39213_1000022 3300002773 Bacteria 105664
13 JGI25152J39213_1025565 3300002773 Bacteria 976
14 JGI25150J39212_1000001 3300002774 Bacteria 1318726
15 JGI25151J46595_10000001 3300003187 Bacteria 887211
16 JGI25165J46597_1000923 3300003214 Bacteria 20349
17 JGI25153J46596_10000001 3300003215 Bacteria 748985
18 rootH2_10073704 3300003320 Bacteria 1729
19 rootL2_10027602 3300003322 Bacteria 7785
20 rootH1_10055270 3300003323 Bacteria 10429
21 rootH1_10178994 3300003323 Bacteria 1752
22 Ga0055525_1021696 3300003759 Bacteria 546
23 Ga0055536_1000001 3300003781 Bacteria 630663
24 Ga0055530_10005254 3300003791 Bacteria 6242
25 Ga0065714_10009247 3300005288 Bacteria 2606
26 Ga0065714_10009591 3300005288 Bacteria 4012
27 Ga0065714_10048636 3300005288 Bacteria 764
28 Ga0065714_10068784 3300005288 Bacteria 4539
29 Ga0065714_10079950 3300005288 Bacteria 2476
30 Ga0065714_10081513 3300005288 Bacteria 2368
31 Ga0065714_10105688 3300005288 Bacteria 1562
32 Ga0065714_10163574 3300005288 Bacteria 997
33 Ga0065714_10194457 3300005288 Bacteria 916
34 Ga0065714_10403218 3300005288 Bacteria 588
35 Ga0065704_10191174 3300005289 Bacteria 1182
36 Ga0070658_10000014 3300005327 Bacteria 244978
37 Ga0070658_10125069 3300005327 Bacteria 2140
38 Ga0070658_10392973 3300005327 Bacteria 1191
39 Ga0070658_10865239 3300005327 Bacteria 786
40 Ga0070676_10004106 3300005328 Bacteria 7650
41 Ga0070683_100076604 3300005329 Bacteria 3127
42 Ga0068869_100201652 3300005334 Bacteria 1569
43 Ga0068869_101476697 3300005334 Bacteria 603
44 Ga0070680_100354051 3300005336 Bacteria 1249
45 Ga0068868_100069307 3300005338 Bacteria 2810
46 Ga0068868_100526543 3300005338 Bacteria 1038
47 Ga0070660_100281189 3300005339 Bacteria 1362
48 Ga0070660_100399152 3300005339 Bacteria 1137
49 Ga0070660_100559721 3300005339 Bacteria 954
50 Ga0070661_100477045 3300005344 Bacteria 996
51 Ga0070671_100045108 3300005355 Bacteria 3664
52 Ga0070674_101827563 3300005356 Bacteria 551
53 Ga0070673_100275689 3300005364 Bacteria 1473
54 Ga0070659_100000402 3300005366 Bacteria 32771
55 Ga0070659_100051269 3300005366 Bacteria 3245
56 Ga0070659_100053857 3300005366 Bacteria 3168
57 Ga0070659_100212416 3300005366 Bacteria 1595
58 Ga0070663_100714032 3300005455 Bacteria 853
59 Ga0070678_100001822 3300005456 Bacteria 11482
60 Ga0070662_100028795 3300005457 Bacteria 3869
61 Ga0070681_10008372 3300005458 Bacteria 10130
62 Ga0068867_100001197 3300005459 Bacteria 17799
63 Ga0070679_100075612 3300005530 Bacteria 3357
64 Ga0070679_100190446 3300005530 Bacteria 2020
65 Ga0070679_101388163 3300005530 Bacteria 649
66 Ga0070684_100615661 3300005535 Bacteria 1010
67 Ga0068853_100136213 3300005539 Bacteria 2201
68 Ga0068853_100258391 3300005539 Bacteria 1600
69 Ga0068853_100495081 3300005539 Bacteria 1153
70 Ga0070665_100000032 3300005548 Bacteria 333352
71 Ga0068855_100000026 3300005563 Bacteria 175140
72 Ga0068855_100000248 3300005563 Bacteria 67971
73 Ga0068855_100091999 3300005563 Bacteria 3498
74 Ga0068855_100158892 3300005563 Bacteria 2567
75 Ga0068855_100323950 3300005563 Bacteria 1703
76 Ga0068855_100479837 3300005563 Bacteria 1354
77 Ga0068855_100536715 3300005563 Bacteria 1268
78 Ga0068855_100581028 3300005563 Bacteria 1210
79 Ga0068855_100859037 3300005563 Bacteria 961
80 Ga0068857_100361490 3300005577 Bacteria 1346
81 Ga0068857_100432210 3300005577 Bacteria 1229
82 Ga0068854_100201019 3300005578 Bacteria 1567
83 Ga0068854_100443461 3300005578 Bacteria 1083
84 Ga0068854_100590861 3300005578 Bacteria 947
85 Ga0068856_100000014 3300005614 Bacteria 163480
86 Ga0068856_100003360 3300005614 Bacteria 16215
87 Ga0068856_100166735 3300005614 Bacteria 2213
88 Ga0068856_100401913 3300005614 Bacteria 1390
89 Ga0068856_100439140 3300005614 Bacteria 1325
90 Ga0068856_101104002 3300005614 Bacteria 810
91 Ga0068856_101264970 3300005614 Bacteria 754
92 Ga0068856_101274110 3300005614 Bacteria 751
93 Ga0068856_102401301 3300005614 Bacteria 535
94 Ga0068852_100004662 3300005616 Bacteria 9721
95 Ga0068866_10188181 3300005718 Bacteria 1225
96 Ga0068851_10498792 3300005834 Bacteria 730
97 Ga0068863_100323149 3300005841 Bacteria 1499
98 Ga0068858_100191651 3300005842 Bacteria 1932
99 Ga0075366_10000812 3300006195 Bacteria 14982
100 Ga0075366_10020556 3300006195 Bacteria 3832
101 Ga0075366_10132436 3300006195 Bacteria 1505
102 Ga0075366_10134629 3300006195 Bacteria 1492
103 Ga0097621_100000057 3300006237 Bacteria 58430
104 Ga0068871_100000094 3300006358 Bacteria 52461
105 Ga0068871_100675472 3300006358 Bacteria 945
106 Ga0068865_100000200 3300006881 Bacteria 33423
107 Ga0105251_10222038 3300009011 Bacteria 851
108 Ga0105240_10026059 3300009093 Bacteria 7676
109 Ga0105240_10054975 3300009093 Bacteria 4986
110 Ga0105240_10094952 3300009093 Bacteria 3637
111 Ga0105240_10184187 3300009093 Bacteria 2461
112 Ga0105240_10290440 3300009093 Bacteria 1875
113 Ga0105240_10368662 3300009093 Bacteria 1624
114 Ga0105240_10411293 3300009093 Bacteria 1521
115 Ga0105240_11099934 3300009093 Bacteria 846
116 Ga0105240_11127679 3300009093 Bacteria 833
117 Ga0105240_11504042 3300009093 Bacteria 706
118 Ga0105240_12648945 3300009093 Bacteria 518
119 Ga0105245_10053242 3300009098 Bacteria 3632
120 Ga0105243_10234425 3300009148 Bacteria 1630
121 Ga0105241_10095212 3300009174 Bacteria 2357
122 Ga0105241_10471573 3300009174 Bacteria 1114
123 Ga0105241_10983314 3300009174 Bacteria 788
124 Ga0105241_11060459 3300009174 Bacteria 761
125 Ga0105242_10050379 3300009176 Bacteria 3390
126 Ga0105237_10001287 3300009545 Bacteria 33378
127 Ga0105237_10001321 3300009545 Bacteria 32889
128 Ga0105237_10005754 3300009545 Bacteria 13929
129 Ga0105237_10009919 3300009545 Bacteria 10162
130 Ga0105237_10012788 3300009545 Bacteria 8828
131 Ga0105237_10085054 3300009545 Bacteria 3152
132 Ga0105237_10417275 3300009545 Bacteria 1347
133 Ga0105237_10559743 3300009545 Bacteria 1150
134 Ga0105237_12300600 3300009545 Bacteria 549
135 Ga0105238_10003742 3300009551 Bacteria 15125
136 Ga0105238_10318704 3300009551 Bacteria 1540
137 Ga0105238_10523618 3300009551 Bacteria 1188
138 Ga0105238_11302770 3300009551 Bacteria 752
139 Ga0105239_10000001 3300010375 Bacteria 617353
140 Ga0105239_10001363 3300010375 Bacteria 32814
141 Ga0105239_10005053 3300010375 Bacteria 15586
142 Ga0105239_10128692 3300010375 Bacteria 2815
143 Ga0105239_10254445 3300010375 Bacteria 1973
144 Ga0105239_10259255 3300010375 Bacteria 1954
145 Ga0105239_10848564 3300010375 Bacteria 1047
146 Ga0105239_11336734 3300010375 Bacteria 827
147 Ga0105239_11631516 3300010375 Bacteria 746
148 Ga0157373_10000175 3300013100 Bacteria 52539
149 Ga0157373_10001983 3300013100 Bacteria 15522
150 Ga0157373_10002244 3300013100 Bacteria 14631
151 Ga0157373_10024499 3300013100 Bacteria 4370
152 Ga0157373_10095040 3300013100 Bacteria 2098
153 Ga0157373_10162221 3300013100 Bacteria 1573
154 Ga0157371_10000276 3300013102 Bacteria 69547
155 Ga0157371_10074928 3300013102 Bacteria 2397
156 Ga0157371_10939929 3300013102 Bacteria 657
157 Ga0157370_10000304 3300013104 Bacteria 61764
158 Ga0157370_10066375 3300013104 Bacteria 3412
159 Ga0157370_10105905 3300013104 Bacteria 2632
160 Ga0157370_10135449 3300013104 Bacteria 2296
161 Ga0157370_10238451 3300013104 Bacteria 1683
162 Ga0157370_10529511 3300013104 Bacteria 1081
163 Ga0157370_10532559 3300013104 Bacteria 1077
164 Ga0157370_11297375 3300013104 Bacteria 656
165 Ga0157369_10000040 3300013105 Bacteria 183469
166 Ga0157369_10063032 3300013105 Bacteria 3994
167 Ga0157369_10459556 3300013105 Bacteria 1318
168 Ga0157374_10142191 3300013296 Bacteria 2330
169 Ga0157374_10297971 3300013296 Bacteria 1595
170 Ga0157374_10625250 3300013296 Bacteria 1088
171 Ga0157378_10072796 3300013297 Bacteria 3088
172 Ga0157378_10117838 3300013297 Bacteria 2443
173 Ga0157378_10529425 3300013297 Bacteria 1181
174 Ga0157378_10604465 3300013297 Bacteria 1108
175 Ga0163162_10000052 3300013306 Bacteria 112651
176 Ga0163162_10004554 3300013306 Bacteria 13359
177 Ga0163162_10021730 3300013306 Bacteria 6319
178 Ga0163162_10157628 3300013306 Bacteria 2391
179 Ga0163162_10213814 3300013306 Bacteria 2058
180 Ga0163162_10880030 3300013306 Bacteria 1010
181 Ga0157372_10004038 3300013307 Bacteria 15739
182 Ga0157372_10015618 3300013307 Bacteria 8142
183 Ga0157372_10042429 3300013307 Bacteria 5032
184 Ga0157372_10087965 3300013307 Bacteria 3526
185 Ga0157372_10540873 3300013307 Bacteria 1358
186 Ga0157372_10691273 3300013307 Bacteria 1187
187 Ga0157372_10743257 3300013307 Bacteria 1141
188 Ga0157372_10917045 3300013307 Bacteria 1016
189 Ga0157372_11712258 3300013307 Bacteria 723
190 Ga0157375_10052289 3300013308 Bacteria 4015
191 Ga0157375_10130777 3300013308 Bacteria 2629
192 Ga0157375_10516808 3300013308 Bacteria 1358
193 Ga0157375_11060989 3300013308 Bacteria 947
194 Ga0157375_11978684 3300013308 Bacteria 692
195 Ga0163163_10781318 3300014325 Bacteria 1018
196 Ga0163163_10837569 3300014325 Bacteria 983
197 Ga0182008_10000030 3300014497 Bacteria 169168
198 Ga0182008_10006118 3300014497 Bacteria 6763
199 Ga0182008_10100478 3300014497 Bacteria 1429
200 Ga0182008_10250036 3300014497 Bacteria 914
201 Ga0182008_10332023 3300014497 Bacteria 802
202 Ga0182008_10447756 3300014497 Bacteria 701
203 Ga0157377_10142532 3300014745 Bacteria 1474
204 Ga0157376_10095846 3300014969 Bacteria 2581
205 Ga0157376_11382274 3300014969 Bacteria 735
206 Ga0182006_1000872 3300015261 Bacteria 20250
207 Ga0182006_1002415 3300015261 Bacteria 10209
208 Ga0182006_1012527 3300015261 Bacteria 3707
209 Ga0182006_1020484 3300015261 Bacteria 2771
210 Ga0182006_1033008 3300015261 Bacteria 2077
211 Ga0182006_1111881 3300015261 Bacteria 958
212 Ga0182007_10000003 3300015262 Bacteria 548244
213 Ga0182007_10058721 3300015262 Bacteria 1262
214 Ga0182007_10122369 3300015262 Bacteria 871
215 Ga0183373_1001 3300015682 Bacteria 1410374
216 Ga0163161_10006390 3300017792 Bacteria 8159
217 Ga0163161_10031402 3300017792 Bacteria 3784
218 Ga0163161_10060117 3300017792 Bacteria 2765
219 Ga0163161_10341896 3300017792 Bacteria 1187
220 Ga0163161_10461595 3300017792 Bacteria 1028
221 Ga0163161_10488963 3300017792 Bacteria 1000
222 Ga0163161_10512550 3300017792 Bacteria 978
223 Ga0163161_10564503 3300017792 Bacteria 934
224 Ga0163161_11045943 3300017792 Bacteria 699
225 Ga0163161_11235625 3300017792 Bacteria 647
226 Ga0197907_10460860 3300020069 Bacteria 551
227 Ga0206356_11665215 3300020070 Bacteria 671
228 Ga0206349_1885028 3300020075 Bacteria 717
229 Ga0206351_10089304 3300020077 Bacteria 542
230 Ga0206351_10092710 3300020077 Bacteria 1312
231 Ga0206351_10266683 3300020077 Bacteria 1028
232 Ga0206352_10142629 3300020078 Bacteria 638
233 Ga0206352_10302237 3300020078 Bacteria 515
234 Ga0206352_10549549 3300020078 Bacteria 618
235 Ga0206352_10821137 3300020078 Bacteria 799
236 Ga0206352_10983977 3300020078 Bacteria 623
237 Ga0206352_11278938 3300020078 Bacteria 635
238 Ga0206350_10940241 3300020080 Bacteria 612
239 Ga0206350_11373609 3300020080 Bacteria 1281
240 Ga0206354_10096798 3300020081 Bacteria 748
241 Ga0206354_10195354 3300020081 Bacteria 617
242 Ga0206353_11414568 3300020082 Bacteria 560
243 Ga0206353_11487520 3300020082 Bacteria 502
244 Ga0154015_1145674 3300020610 Bacteria 1261
245 Ga0154015_1323334 3300020610 Bacteria 941
246 Ga0224712_10434447 3300022467 Bacteria 629
247 Ga0224712_10456144 3300022467 Bacteria 614
248 Ga0224712_10473535 3300022467 Bacteria 603
249 Ga0209563_116042 3300025230 Bacteria 929
250 Ga0207427_100236 3300025231 Bacteria 45297
251 Ga0209437_100034 3300025233 Bacteria 494007
252 Ga0209437_100143 3300025233 Bacteria 164970
253 Ga0207425_1000002 3300025245 Bacteria 1362590
254 Ga0209026_1000663 3300025250 Bacteria 21055
255 Ga0209026_1009640 3300025250 Bacteria 1875
256 Ga0209026_1024642 3300025250 Bacteria 911
257 Ga0209026_1033005 3300025250 Bacteria 764
258 Ga0209148_1034014 3300025254 Bacteria 741
259 Ga0209129_1000002 3300025258 Bacteria 1359086
260 Ga0209129_1005110 3300025258 Bacteria 4805
261 Ga0209233_1000038 3300025261 Bacteria 548972
262 Ga0209233_1011941 3300025261 Bacteria 2539
263 Ga0209233_1053621 3300025261 Bacteria 808
264 Ga0209676_1000008 3300025292 Bacteria 991778
265 Ga0209025_1000004 3300025294 Bacteria 1361782
266 Ga0209758_1000006 3300025297 Bacteria 1359562
267 Ga0209050_1000045 3300025298 Bacteria 388022
268 Ga0207655_1111463 3300025728 Bacteria 923
269 Ga0207642_10130757 3300025899 Bacteria 1310
270 Ga0207647_10008662 3300025904 Bacteria 7268
271 Ga0207647_10043409 3300025904 Bacteria 2814
272 Ga0207647_10063624 3300025904 Bacteria 2244
273 Ga0207645_10002281 3300025907 Bacteria 15210
274 Ga0207705_10000043 3300025909 Bacteria 181491
275 Ga0207705_10182796 3300025909 Bacteria 1583
276 Ga0207705_10333291 3300025909 Bacteria 1167
277 Ga0207705_10526257 3300025909 Bacteria 919
278 Ga0207654_10137114 3300025911 Bacteria 1556
279 Ga0207654_10440269 3300025911 Bacteria 912
280 Ga0207707_10051151 3300025912 Bacteria 3598
281 Ga0207695_10000053 3300025913 Bacteria 396740
282 Ga0207695_10020448 3300025913 Bacteria 7580
283 Ga0207695_10029659 3300025913 Bacteria 6038
284 Ga0207695_10237410 3300025913 Bacteria 1725
285 Ga0207695_10414277 3300025913 Bacteria 1232
286 Ga0207695_10883081 3300025913 Bacteria 774
287 Ga0207695_11085969 3300025913 Bacteria 680
288 Ga0207695_11508429 3300025913 Bacteria 553
289 Ga0207671_10002398 3300025914 Bacteria 20096
290 Ga0207671_10002869 3300025914 Bacteria 17871
291 Ga0207671_10003823 3300025914 Bacteria 14729
292 Ga0207671_10005821 3300025914 Bacteria 11203
293 Ga0207671_10022025 3300025914 Bacteria 4825
294 Ga0207671_10228993 3300025914 Bacteria 1458
295 Ga0207671_10375027 3300025914 Bacteria 1130
296 Ga0207671_10764258 3300025914 Bacteria 767
297 Ga0207671_11534813 3300025914 Bacteria 513
298 Ga0207660_10025593 3300025917 Bacteria 4008
299 Ga0207660_11071074 3300025917 Bacteria 657
300 Ga0207657_10242923 3300025919 Bacteria 1437
301 Ga0207657_10344371 3300025919 Bacteria 1176
302 Ga0207657_10353850 3300025919 Bacteria 1158
303 Ga0207657_10512752 3300025919 Bacteria 939
304 Ga0207652_10026145 3300025921 Bacteria 4858
305 Ga0207652_10158506 3300025921 Bacteria 2028
306 Ga0207652_11140492 3300025921 Bacteria 681
307 Ga0207694_10348023 3300025924 Bacteria 1226
308 Ga0207694_10430858 3300025924 Bacteria 1099
309 Ga0207694_10725714 3300025924 Bacteria 838
310 Ga0207644_10010204 3300025931 Bacteria 6189
311 Ga0207690_10000365 3300025932 Bacteria 30004
312 Ga0207690_10003759 3300025932 Bacteria 9000
313 Ga0207690_10526296 3300025932 Bacteria 959
314 Ga0207706_10000057 3300025933 Bacteria 112805
315 Ga0207686_10192197 3300025934 Bacteria 1456
316 Ga0207709_10502264 3300025935 Bacteria 946
317 Ga0207669_11592111 3300025937 Bacteria 557
318 Ga0207704_10000052 3300025938 Bacteria 80866
319 Ga0207691_10964729 3300025940 Bacteria 712
320 Ga0207689_10171808 3300025942 Bacteria 1787
321 Ga0207661_10057095 3300025944 Bacteria 3137
322 Ga0207667_10000022 3300025949 Bacteria 369570
323 Ga0207667_10001325 3300025949 Bacteria 31070
324 Ga0207667_10037152 3300025949 Bacteria 5209
325 Ga0207667_10087032 3300025949 Bacteria 3232
326 Ga0207667_10113392 3300025949 Bacteria 2795
327 Ga0207667_10492506 3300025949 Bacteria 1244
328 Ga0207651_10033272 3300025960 Bacteria 3323
329 Ga0207640_10176046 3300025981 Bacteria 1599
330 Ga0207640_10264718 3300025981 Bacteria 1342
331 Ga0207677_10091875 3300026023 Bacteria 2209
332 Ga0207677_10908778 3300026023 Bacteria 794
333 Ga0207703_10477102 3300026035 Bacteria 1168
334 Ga0207703_11232452 3300026035 Bacteria 719
335 Ga0207639_10050764 3300026041 Bacteria 3151
336 Ga0207639_10123676 3300026041 Bacteria 2130
337 Ga0207639_10159488 3300026041 Bacteria 1899
338 Ga0207639_11057669 3300026041 Bacteria 761
339 Ga0207678_10224897 3300026067 Bacteria 1606
340 Ga0207702_10000036 3300026078 Bacteria 154106
341 Ga0207702_10251539 3300026078 Bacteria 1660
342 Ga0207702_10292030 3300026078 Bacteria 1545
343 Ga0207702_10919390 3300026078 Bacteria 867
344 Ga0207702_11075908 3300026078 Bacteria 798
345 Ga0207702_12456107 3300026078 Bacteria 508
346 Ga0207641_11714374 3300026088 Bacteria 630
347 Ga0207648_10002788 3300026089 Bacteria 18537
348 Ga0207674_10154666 3300026116 Bacteria 2249
349 Ga0207674_11408945 3300026116 Bacteria 666
350 Ga0207674_12076698 3300026116 Bacteria 532
351 Ga0207683_10010796 3300026121 Bacteria 7788
352 Ga0207698_10016030 3300026142 Bacteria 5040
353 Ga0207698_11275593 3300026142 Bacteria 749
354 Ga0268266_10000030 3300028379 Bacteria 417120
355 Ga0268264_10514910 3300028381 Bacteria 1169
356 Ga0307517_10006168 3300028786 Bacteria 17856
357 Ga0307515_10008566 3300028794 Bacteria 19914
358 Ga0307515_10082620 3300028794 Bacteria 4151
359 Ga0307515_10225522 3300028794 Bacteria 1680
360 Ga0265338_10020274 3300028800 Bacteria 7005
361 Ga0265338_10447517 3300028800 Bacteria 915
362 Ga0316177_1003967 3300030731 Bacteria 16835
363 Ga0316177_1067224 3300030731 Bacteria 504
364 Ga0316176_1180404 3300030732 Bacteria 8687
365 Ga0314311_1167977 3300030733 Bacteria 1087
366 Ga0316183_1095896 3300030742 Bacteria 133299
367 Ga0316181_1084669 3300030744 Bacteria 1364
368 Ga0316181_1158926 3300030744 Bacteria 6116
369 Ga0316182_1114895 3300030745 Bacteria 2540
370 Ga0265331_10391384 3300031250 Bacteria 623
371 Ga0265327_10093580 3300031251 Bacteria 1462
372 Ga0265327_10283837 3300031251 Bacteria 731
373 Ga0265327_10346580 3300031251 Bacteria 649
374 Ga0307513_10601182 3300031456 Bacteria 809
375 Ga0307408_100011421 3300031548 Bacteria 5868
376 Ga0307408_100091936 3300031548 Bacteria 2292
377 Ga0307408_100092560 3300031548 Bacteria 2285
378 Ga0307408_100699407 3300031548 Bacteria 911
379 Ga0307516_10594031 3300031730 Bacteria 761
380 Ga0307405_10000003 3300031731 Bacteria 569064
381 Ga0307405_11577215 3300031731 Bacteria 579
382 Ga0307413_11140610 3300031824 Bacteria 675
383 Ga0307407_10000030 3300031903 Bacteria 97416
384 Ga0307407_10952751 3300031903 Bacteria 661
385 Ga0307412_10000065 3300031911 Bacteria 122279
386 Ga0307412_10000925 3300031911 Bacteria 16779
387 Ga0307412_10007236 3300031911 Bacteria 6294
388 Ga0307412_10294865 3300031911 Bacteria 1279
389 Ga0307412_10301438 3300031911 Bacteria 1267
390 Ga0307412_10444528 3300031911 Bacteria 1066
391 Ga0307412_10650225 3300031911 Bacteria 899
392 Ga0307412_11079457 3300031911 Bacteria 713
393 Ga0307412_11148350 3300031911 Bacteria 693
394 Ga0307409_100120979 3300031995 Bacteria 2217
395 Ga0307409_102809568 3300031995 Bacteria 514
396 Ga0307416_100000014 3300032002 Bacteria 249053
397 Ga0307416_100244859 3300032002 Bacteria 1740
398 Ga0307414_10005403 3300032004 Bacteria 7034
399 Ga0307414_10026048 3300032004 Bacteria 3758
400 Ga0307414_10299547 3300032004 Bacteria 1359
401 Ga0307414_10305330 3300032004 Bacteria 1348
402 Ga0307414_10321906 3300032004 Bacteria 1316
403 Ga0307414_10406717 3300032004 Bacteria 1183
404 Ga0307414_10722447 3300032004 Bacteria 903
405 Ga0307414_10884995 3300032004 Bacteria 818
406 Ga0307414_11204325 3300032004 Bacteria 701
407 Ga0307411_10520625 3300032005 Bacteria 1009
408 Ga0307411_11046861 3300032005 Bacteria 733
409 Ga0307507_10000032 3300033179 Bacteria 194155
410 Ga0307510_10005905 3300033180 Bacteria 14606
411 Ga0373941_0107642 3300035115 Bacteria 978
412 Ga0373925_1636913 3300037068 Bacteria 526
413 Ga0395899_0000002 3300037312 Bacteria 1324310
414 Ga0395899_0012421 3300037312 Bacteria 6524
415 Ga0395899_0047989 3300037312 Bacteria 3178
416 Ga0395900_0000143 3300037418 Bacteria 120234
417 Ga0395900_0000285 3300037418 Bacteria 75772
418 Ga0395900_0513616 3300037418 Bacteria 1147
419 Ga0395898_0008044 3300037466 Bacteria 11177
420 Ga0395898_0245430 3300037466 Bacteria 1708
421 Ga0395905_0000045 3300037471 Bacteria 241370
422 Ga0395905_0000765 3300037471 Bacteria 42351
423 Ga0395901_0002501 3300038443 Bacteria 18608
424 Ga0395901_0035978 3300038443 Bacteria 5116
425 Ga0436361_0542797 3300039447 Bacteria 4744
426 Ga0439439_0186357 3300041406 Bacteria 599
427 Ga0451797_0777216 3300041453 Bacteria 725
428 Ga0451807_1592925 3300041486 Bacteria 607
429 Ga0451807_1852552 3300041486 Bacteria 830
430 Ga0451807_1966145 3300041486 Bacteria 540
431 Ga0451841_0449127 3300041498 Bacteria 780
432 Ga0451843_0191440 3300041509 Bacteria 618
433 Ga0451843_1497749 3300041509 Bacteria 792
434 Ga0439448_0000810 3300042005 Bacteria 7615
435 Ga0439455_0043498 3300042012 Bacteria 1156
436 Ga0453684_0961218 3300044712 Bacteria 911
437 Ga0466968_0074554 3300044735 Bacteria 1482
438 Ga0495627_045542 3300046453 Bacteria 1336
439 Ga0495627_122578 3300046453 Bacteria 733
440 Ga0495629_0085265 3300046459 Bacteria 2204
441 Ga0495638_0110069 3300046460 Bacteria 1637
442 Ga0495651_0078117 3300046462 Bacteria 2504
443 Ga0495650_0000594 3300046471 Bacteria 49931
444 Ga0495650_0057227 3300046471 Bacteria 1579
445 Ga0495650_0214981 3300046471 Bacteria 664
446 Ga0495605_0122970 3300046474 Bacteria 1175
447 Ga0495585_0000014 3300046492 Bacteria 187513
448 Ga0495585_0000212 3300046492 Bacteria 60869
449 Ga0495596_0093232 3300046500 Bacteria 1169
450 Ga0495607_0479038 3300046501 Bacteria 555
451 Ga0495583_0028031 3300046506 Bacteria 2774
452 Ga0495583_0045313 3300046506 Bacteria 2035
453 Ga0495606_0000192 3300046507 Bacteria 107123
454 Ga0495606_0009373 3300046507 Bacteria 8289
455 Ga0495606_0025513 3300046507 Bacteria 4231
456 Ga0495606_0067255 3300046507 Bacteria 2269
457 Ga0495606_0130392 3300046507 Bacteria 1495
458 Ga0495608_0536423 3300046511 Bacteria 706
459 Ga0495610_0001861 3300046512 Bacteria 18285
460 Ga0495610_0002826 3300046512 Bacteria 14145
461 Ga0495616_0003380 3300046513 Bacteria 10230
462 Ga0495616_0004140 3300046513 Bacteria 9192
463 Ga0495616_0293989 3300046513 Bacteria 687
464 Ga0495618_0835435 3300046514 Bacteria 535
465 Ga0495631_0179052 3300046518 Bacteria 908
466 Ga0495632_0170117 3300046519 Bacteria 1001
467 Ga0495637_0062797 3300046520 Bacteria 1519
468 Ga0495644_0015940 3300046523 Bacteria 2879
469 Ga0495648_0004657 3300046524 Bacteria 11632
470 Ga0495663_0102969 3300046525 Bacteria 942
471 Ga0495663_0231890 3300046525 Bacteria 651
472 Ga0495642_0454157 3300046528 Bacteria 566
473 Ga0495652_0242121 3300046529 Bacteria 1341
474 Ga0495654_0011017 3300046530 Bacteria 4910
475 Ga0495609_0004058 3300046538 Bacteria 8162
476 Ga0495609_0203117 3300046538 Bacteria 827
477 Ga0495609_0221602 3300046538 Bacteria 785
478 Ga0495609_0460239 3300046538 Bacteria 505
479 Ga0495622_0042890 3300046557 Bacteria 2103
480 Ga0495622_0152113 3300046557 Bacteria 1047
481 Ga0495633_0000021 3300046558 Bacteria 227171
482 Ga0495633_0024943 3300046558 Bacteria 2949
483 Ga0495633_0040843 3300046558 Bacteria 2208
484 Ga0495633_0103128 3300046558 Bacteria 1324
485 Ga0495668_0000673 3300046616 Bacteria 41193
486 Ga0495668_0059027 3300046616 Bacteria 2117
487 Ga0495668_0105953 3300046616 Bacteria 1538
488 Ga0495634_0112380 3300046642 Bacteria 1751
489 Ga0495625_0000021 3300046660 Bacteria 282133
490 Ga0495625_0032464 3300046660 Bacteria 3869
491 Ga0495625_0062112 3300046660 Bacteria 2641
492 Ga0495625_0074156 3300046660 Bacteria 2384
493 Ga0495625_0118929 3300046660 Bacteria 1800
494 Ga0495661_0000739 3300046665 Bacteria 31861
495 Ga0495661_0008232 3300046665 Bacteria 7223
496 Ga0495661_0214345 3300046665 Bacteria 1001
497 Ga0495661_0223843 3300046665 Bacteria 973
498 Ga0495588_0426941 3300046674 Bacteria 696
499 Ga0495658_0168178 3300046683 Bacteria 1355
500 Ga0495670_0149544 3300046691 Bacteria 1224
501 Ga0495671_0019020 3300046692 Bacteria 3637
502 Ga0495671_0203926 3300046692 Bacteria 959
503 Ga0495649_0000009 3300046694 Bacteria 451725
504 Ga0495649_0057462 3300046694 Bacteria 2098
505 Ga0495600_0235957 3300046809 Bacteria 1166
506 Ga0495660_0022461 3300046810 Bacteria 3603
507 Ga0495660_0110671 3300046810 Bacteria 1402
508 Ga0495660_0256527 3300046810 Bacteria 809
509 Ga0495687_001340 3300047443 Bacteria 22938
510 Ga0495687_012772 3300047443 Bacteria 4421
511 Ga0495673_0102668 3300047469 Bacteria 1153
512 Ga0495681_0152370 3300047470 Bacteria 969
513 Ga0495681_0369971 3300047470 Bacteria 541
514 Ga0495686_0020738 3300047472 Bacteria 4380
515 Ga0495686_0021467 3300047472 Bacteria 4287
516 Ga0495686_0107785 3300047472 Bacteria 1674
517 Ga0495686_0191203 3300047472 Bacteria 1180
518 Ga0495686_0213790 3300047472 Bacteria 1100
519 Ga0495614_0008785 3300048089 Bacteria 4487
520 Ga0496115_0273242 3300048918 Bacteria 1388
521 Ga0496122_0000625 3300048925 Bacteria 72309
522 Ga0496123_0014082 3300048926 Bacteria 6655
523 Ga0496125_0066235 3300048928 Bacteria 2856
524 Ga0496125_0757648 3300048928 Bacteria 508
525 Ga0496126_0140316 3300048929 Bacteria 2081
526 Ga0495682_0004927 3300049460 Bacteria 5621
527 Ga0501312_023765 3300049528 Bacteria 925
528 Ga0501033_0596205 3300049570 Bacteria 758
529 Ga0501223_016850 3300049663 Bacteria 1443
530 nmdc:mga0k408_350_c1 3300050493 Bacteria 25267
531 nmdc:mga0k408_4120_c1 3300050493 Bacteria 7721
532 nmdc:mga0k408_783_c1 3300050493 Bacteria 17509
533 nmdc:mga0k408_803925_c1 3300050493 Bacteria 548
534 nmdc:mga0k408_84967_c1 3300050493 Bacteria 1857
535 nmdc:mga07m45_425651_c1 3300050496 Bacteria 770
536 Ga0500651_0000124 3300053093 Bacteria 47212
537 Ga0500608_057147 3300053122 Bacteria 1869
538 Ga0500608_091902 3300053122 Bacteria 1417
539 Ga0500614_008259 3300053123 Bacteria 2207
540 Ga0500618_000080 3300053125 Bacteria 78455
541 Ga0500618_016552 3300053125 Bacteria 1845
542 Ga0500642_0138252 3300053130 Bacteria 1142
543 Ga0500564_022907 3300053138 Bacteria 2860
544 Ga0500568_0016771 3300053139 Bacteria 3246
545 Ga0500568_0178361 3300053139 Bacteria 781
546 Ga0500573_0238212 3300053140 Bacteria 945
547 Ga0500573_0451304 3300053140 Unclassified 594
548 Ga0500622_0001219 3300053156 Bacteria 21136
549 Ga0500622_0083582 3300053156 Bacteria 1594
550 Ga0500624_000925 3300053157 Bacteria 6183
551 Ga0500634_0149325 3300053161 Bacteria 1095
552 Ga0500634_0182485 3300053161 Bacteria 943
553 Ga0500645_081042 3300053730 Bacteria 926
554 Ga0587073_0184661 3300059492 Bacteria 614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100439140 Ga0068856_1004391403 95
2 3300013297 Ga0157378_10117838 Ga0157378_101178386 96
3 3300013308 Ga0157375_10052289 Ga0157375_100522896 96
4 3300001904 JGI24736J21556_1015162 JGI24736J21556_10151622 97
5 3300005327 Ga0070658_10392973 Ga0070658_103929732 97
6 3300005339 Ga0070660_100559721 Ga0070660_1005597211 97
7 3300005366 Ga0070659_100051269 Ga0070659_1000512694 97
8 3300005577 Ga0068857_100361490 Ga0068857_1003614902 97
9 3300009093 Ga0105240_11127679 Ga0105240_111276791 97
10 3300010375 Ga0105239_11631516 Ga0105239_116315162 97
11 3300020078 Ga0206352_10549549 Ga0206352_105495491 97
12 3300020080 Ga0206350_10940241 Ga0206350_109402411 97
13 3300022467 Ga0224712_10434447 Ga0224712_104344471 97
14 3300025904 Ga0207647_10008662 Ga0207647_100086628 97
15 3300025913 Ga0207695_11085969 Ga0207695_110859692 97
16 3300025919 Ga0207657_10512752 Ga0207657_105127522 97
17 3300025932 Ga0207690_10003759 Ga0207690_1000375911 97
18 3300025942 Ga0207689_10171808 Ga0207689_101718083 97
19 3300026035 Ga0207703_11232452 Ga0207703_112324522 97
20 3300026116 Ga0207674_10154666 Ga0207674_101546666 97
21 3300031911 Ga0307412_10650225 Ga0307412_106502251 97
22 3300005614 Ga0068856_100166735 Ga0068856_1001667353 98
23 3300020069 Ga0197907_10460860 Ga0197907_104608601 98
24 3300026078 Ga0207702_10251539 Ga0207702_102515394 98
25 3300028800 Ga0265338_10020274 Ga0265338_1002027411 98
26 3300003320 rootH2_10073704 rootH2_100737043 99
27 3300005614 Ga0068856_100000014 Ga0068856_10000001415 99
28 3300026078 Ga0207702_10000036 Ga0207702_10000036119 99
29 3300031251 Ga0265327_10283837 Ga0265327_102838371 99
30 3300044712 Ga0453684_0961218 Ga0453684_0961218_182_481 99
31 3300005563 Ga0068855_100859037 Ga0068855_1008590371 100
32 3300005614 Ga0068856_102401301 Ga0068856_1024013011 100
33 3300047470 Ga0495681_0369971 Ga0495681_0369971_11_313 100
34 3300005366 Ga0070659_100212416 Ga0070659_1002124163 101
35 3300005563 Ga0068855_100000248 Ga0068855_1000002489 101
36 3300005563 Ga0068855_100536715 Ga0068855_1005367152 101
37 3300009545 Ga0105237_10417275 Ga0105237_104172753 101
38 3300010375 Ga0105239_10259255 Ga0105239_102592553 101
39 3300025949 Ga0207667_10001325 Ga0207667_1000132530 101
40 3300013104 Ga0157370_10532559 Ga0157370_105325592 102
41 3300025914 Ga0207671_10764258 Ga0207671_107642582 102
42 3300025949 Ga0207667_10492506 Ga0207667_104925062 102
43 3300026041 Ga0207639_11057669 Ga0207639_110576691 102
44 3300026116 Ga0207674_12076698 Ga0207674_120766982 102
45 3300047472 Ga0495686_0213790 Ga0495686_0213790_364_711 102
46 3300050496 nmdc:mga07m45_425651_c1 nmdc:mga07m45_425651_c1_411_758 102
47 3300050493 nmdc:mga0k408_803925_c1 nmdc:mga0k408_803925_c1_182_529 103
48 3300020080 Ga0206350_11373609 Ga0206350_113736091 104
49 3300002737 JGI25162J39368_1001524 JGI25162J39368_100152415 106
50 3300002772 JGI25164J39214_1000824 JGI25164J39214_10008244 106
51 3300003214 JGI25165J46597_1000923 JGI25165J46597_10009234 106
52 3300003759 Ga0055525_1021696 Ga0055525_10216961 106
53 3300025230 Ga0209563_116042 Ga0209563_1160423 106
54 3300025231 Ga0207427_100236 Ga0207427_1002365 106
55 3300025233 Ga0209437_100034 Ga0209437_1000344 106
56 3300025250 Ga0209026_1033005 Ga0209026_10330052 106
57 3300025261 Ga0209233_1000038 Ga0209233_10000384 106
58 iso_pu_bacteria 8055588893 8055589530 109
59 3300028800 Ga0265338_10447517 Ga0265338_104475171 110
60 iso_pu_bacteria 2585427687 2586209101 111
61 iso_pu_bacteria 2599185184 2599479172 111
62 iso_pu_bacteria 2738541283 2738755473 111
63 iso_pu_bacteria 2738541284 2738763465 111
64 iso_pu_bacteria 2738541302 2738851944 111
65 iso_pu_bacteria 2738543023 2739303590 111
66 iso_pu_bacteria 2739367651 2739590832 111
67 iso_pu_bacteria 2739367656 2739617007 111
68 iso_pu_bacteria 2739367663 2739647314 111
69 iso_pu_bacteria 2775506987 2776615097 111
70 iso_pu_bacteria 2818991437 2819546486 111
71 iso_pu_bacteria 2842722452 2842725188 111
72 iso_pu_bacteria 2842903701 2842905886 111
73 iso_pu_bacteria 2842909656 2842912462 111
74 iso_pu_bacteria 2849281842 2849286028 111
75 iso_pu_bacteria 2852623160 2852625302 111
76 iso_pu_bacteria 2852627209 2852629329 111
77 iso_pu_bacteria 2857627736 2857629745 111
78 iso_pu_bacteria 2884933994 2884934315 111
79 iso_pu_bacteria 2902048731 2902052518 111
80 iso_pu_bacteria 2904445276 2904446646 111
81 iso_pu_bacteria 2919186247 2919190332 111
82 iso_pu_bacteria 2919437846 2919438203 111
83 iso_pu_bacteria 2928078545 2928082513 111
84 iso_pu_bacteria 2928147474 2928148899 111
85 iso_pu_bacteria 2932082852 2932086303 111
86 iso_pu_bacteria 2939664404 2939668613 111
87 iso_pu_bacteria 2945997725 2946002109 111
88 iso_pu_bacteria 2954016120 2954019009 111
89 iso_pu_bacteria 2977232053 2977233785 111
90 3300053140 Ga0500573_0451304 Ga0500573_0451304_208_549 113
91 3300005327 Ga0070658_10865239 Ga0070658_108652392 114
92 3300005339 Ga0070660_100281189 Ga0070660_1002811895 114
93 3300005366 Ga0070659_100000402 Ga0070659_10000040226 114
94 3300005563 Ga0068855_100000026 Ga0068855_10000002616 114
95 3300005614 Ga0068856_100401913 Ga0068856_1004019132 114
96 3300006195 Ga0075366_10134629 Ga0075366_101346293 114
97 3300013296 Ga0157374_10142191 Ga0157374_101421912 114
98 3300013297 Ga0157378_10604465 Ga0157378_106044651 114
99 3300013307 Ga0157372_10042429 Ga0157372_1004242912 114
100 3300013307 Ga0157372_11712258 Ga0157372_117122582 114
101 3300020075 Ga0206349_1885028 Ga0206349_18850281 114
102 3300020077 Ga0206351_10092710 Ga0206351_100927101 114
103 3300020078 Ga0206352_10142629 Ga0206352_101426291 114
104 3300020078 Ga0206352_10821137 Ga0206352_108211371 114
105 3300020078 Ga0206352_11278938 Ga0206352_112789381 114
106 3300020081 Ga0206354_10195354 Ga0206354_101953541 114
107 3300020082 Ga0206353_11487520 Ga0206353_114875201 114
108 3300020610 Ga0154015_1145674 Ga0154015_11456741 114
109 3300022467 Ga0224712_10473535 Ga0224712_104735352 114
110 3300025250 Ga0209026_1024642 Ga0209026_10246422 114
111 3300025909 Ga0207705_10526257 Ga0207705_105262571 114
112 3300025919 Ga0207657_10242923 Ga0207657_102429235 114
113 3300025932 Ga0207690_10000365 Ga0207690_1000036524 114
114 3300025949 Ga0207667_10000022 Ga0207667_10000022157 114
115 3300026078 Ga0207702_10919390 Ga0207702_109193902 114
116 3300030731 Ga0316177_1067224 Ga0316177_10672242 114
117 3300031548 Ga0307408_100011421 Ga0307408_1000114219 114
118 3300031548 Ga0307408_100091936 Ga0307408_1000919363 114
119 3300031548 Ga0307408_100092560 Ga0307408_1000925603 114
120 3300031731 Ga0307405_11577215 Ga0307405_115772151 114
121 3300031911 Ga0307412_10000925 Ga0307412_1000092511 114
122 3300031911 Ga0307412_10007236 Ga0307412_100072365 114
123 3300031995 Ga0307409_100120979 Ga0307409_1001209796 114
124 3300032002 Ga0307416_100244859 Ga0307416_1002448593 114
125 3300032004 Ga0307414_10884995 Ga0307414_108849952 114
126 3300041406 Ga0439439_0186357 Ga0439439_0186357_99_443 114
127 3300049528 Ga0501312_023765 Ga0501312_023765_154_498 114
128 3300049663 Ga0501223_016850 Ga0501223_016850_763_1107 114
129 3300050493 nmdc:mga0k408_84967_c1 nmdc:mga0k408_84967_c1_386_730 114
130 3300053730 Ga0500645_081042 Ga0500645_081042_408_752 114
131 2162886007 SwRhRL2b_contig_2336375 SwRhRL2b_0445.00002760 115
132 3300001990 JGI24737J22298_10000765 JGI24737J22298_100007659 115
133 3300001991 JGI24743J22301_10006041 JGI24743J22301_100060412 115
134 3300002067 JGI24735J21928_10000009 JGI24735J21928_10000009198 115
135 3300002075 JGI24738J21930_10124490 JGI24738J21930_101244901 115
136 3300002077 JGI24744J21845_10005025 JGI24744J21845_100050256 115
137 3300002737 JGI25162J39368_1000120 JGI25162J39368_100012035 115
138 3300002741 JGI25157J39369_1006802 JGI25157J39369_10068022 115
139 3300002773 JGI25152J39213_1000022 JGI25152J39213_100002236 115
140 3300002773 JGI25152J39213_1025565 JGI25152J39213_10255651 115
141 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001332 115
142 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001469 115
143 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001358 115
144 3300003322 rootL2_10027602 rootL2_100276025 115
145 3300003323 rootH1_10055270 rootH1_100552701 115
146 3300003323 rootH1_10178994 rootH1_101789941 115
147 3300003781 Ga0055536_1000001 Ga0055536_1000001444 115
148 3300003791 Ga0055530_10005254 Ga0055530_100052548 115
149 3300005288 Ga0065714_10009247 Ga0065714_100092473 115
150 3300005288 Ga0065714_10009591 Ga0065714_100095919 115
151 3300005288 Ga0065714_10048636 Ga0065714_100486362 115
152 3300005288 Ga0065714_10068784 Ga0065714_100687845 115
153 3300005288 Ga0065714_10079950 Ga0065714_100799501 115
154 3300005288 Ga0065714_10081513 Ga0065714_100815133 115
155 3300005288 Ga0065714_10105688 Ga0065714_101056881 115
156 3300005288 Ga0065714_10163574 Ga0065714_101635742 115
157 3300005288 Ga0065714_10194457 Ga0065714_101944571 115
158 3300005288 Ga0065714_10403218 Ga0065714_104032181 115
159 3300005289 Ga0065704_10191174 Ga0065704_101911741 115
160 3300005327 Ga0070658_10000014 Ga0070658_1000001499 115
161 3300005327 Ga0070658_10125069 Ga0070658_101250692 115
162 3300005328 Ga0070676_10004106 Ga0070676_1000410613 115
163 3300005329 Ga0070683_100076604 Ga0070683_1000766042 115
164 3300005334 Ga0068869_100201652 Ga0068869_1002016521 115
165 3300005334 Ga0068869_101476697 Ga0068869_1014766971 115
166 3300005336 Ga0070680_100354051 Ga0070680_1003540512 115
167 3300005338 Ga0068868_100069307 Ga0068868_1000693071 115
168 3300005338 Ga0068868_100526543 Ga0068868_1005265432 115
169 3300005339 Ga0070660_100399152 Ga0070660_1003991522 115
170 3300005344 Ga0070661_100477045 Ga0070661_1004770451 115
171 3300005355 Ga0070671_100045108 Ga0070671_1000451086 115
172 3300005356 Ga0070674_101827563 Ga0070674_1018275631 115
173 3300005364 Ga0070673_100275689 Ga0070673_1002756892 115
174 3300005366 Ga0070659_100053857 Ga0070659_1000538573 115
175 3300005455 Ga0070663_100714032 Ga0070663_1007140322 115
176 3300005456 Ga0070678_100001822 Ga0070678_10000182214 115
177 3300005457 Ga0070662_100028795 Ga0070662_1000287956 115
178 3300005458 Ga0070681_10008372 Ga0070681_100083728 115
179 3300005459 Ga0068867_100001197 Ga0068867_10000119716 115
180 3300005530 Ga0070679_100075612 Ga0070679_1000756121 115
181 3300005530 Ga0070679_100190446 Ga0070679_1001904462 115
182 3300005530 Ga0070679_101388163 Ga0070679_1013881631 115
183 3300005535 Ga0070684_100615661 Ga0070684_1006156612 115
184 3300005539 Ga0068853_100136213 Ga0068853_1001362133 115
185 3300005539 Ga0068853_100258391 Ga0068853_1002583912 115
186 3300005539 Ga0068853_100495081 Ga0068853_1004950814 115
187 3300005548 Ga0070665_100000032 Ga0070665_100000032107 115
188 3300005563 Ga0068855_100091999 Ga0068855_1000919995 115
189 3300005563 Ga0068855_100158892 Ga0068855_1001588922 115
190 3300005563 Ga0068855_100323950 Ga0068855_1003239503 115
191 3300005563 Ga0068855_100479837 Ga0068855_1004798372 115
192 3300005563 Ga0068855_100581028 Ga0068855_1005810281 115
193 3300005577 Ga0068857_100432210 Ga0068857_1004322101 115
194 3300005578 Ga0068854_100201019 Ga0068854_1002010192 115
195 3300005578 Ga0068854_100443461 Ga0068854_1004434612 115
196 3300005578 Ga0068854_100590861 Ga0068854_1005908612 115
197 3300005614 Ga0068856_100003360 Ga0068856_10000336020 115
198 3300005614 Ga0068856_101104002 Ga0068856_1011040021 115
199 3300005614 Ga0068856_101264970 Ga0068856_1012649702 115
200 3300005614 Ga0068856_101274110 Ga0068856_1012741102 115
201 3300005616 Ga0068852_100004662 Ga0068852_1000046626 115
202 3300005718 Ga0068866_10188181 Ga0068866_101881812 115
203 3300005834 Ga0068851_10498792 Ga0068851_104987921 115
204 3300005841 Ga0068863_100323149 Ga0068863_1003231491 115
205 3300005842 Ga0068858_100191651 Ga0068858_1001916512 115
206 3300006195 Ga0075366_10000812 Ga0075366_1000081211 115
207 3300006195 Ga0075366_10020556 Ga0075366_100205563 115
208 3300006195 Ga0075366_10132436 Ga0075366_101324362 115
209 3300006237 Ga0097621_100000057 Ga0097621_10000005749 115
210 3300006358 Ga0068871_100000094 Ga0068871_10000009450 115
211 3300006358 Ga0068871_100675472 Ga0068871_1006754723 115
212 3300006881 Ga0068865_100000200 Ga0068865_1000002006 115
213 3300009011 Ga0105251_10222038 Ga0105251_102220381 115
214 3300009093 Ga0105240_10026059 Ga0105240_100260592 115
215 3300009093 Ga0105240_10054975 Ga0105240_100549756 115
216 3300009093 Ga0105240_10094952 Ga0105240_100949525 115
217 3300009093 Ga0105240_10184187 Ga0105240_101841873 115
218 3300009093 Ga0105240_10290440 Ga0105240_102904402 115
219 3300009093 Ga0105240_10368662 Ga0105240_103686625 115
220 3300009093 Ga0105240_10411293 Ga0105240_104112936 115
221 3300009093 Ga0105240_11099934 Ga0105240_110999342 115
222 3300009093 Ga0105240_11504042 Ga0105240_115040422 115
223 3300009093 Ga0105240_12648945 Ga0105240_126489451 115
224 3300009098 Ga0105245_10053242 Ga0105245_100532424 115
225 3300009148 Ga0105243_10234425 Ga0105243_102344252 115
226 3300009174 Ga0105241_10095212 Ga0105241_100952126 115
227 3300009174 Ga0105241_10471573 Ga0105241_104715732 115
228 3300009174 Ga0105241_10983314 Ga0105241_109833142 115
229 3300009174 Ga0105241_11060459 Ga0105241_110604591 115
230 3300009176 Ga0105242_10050379 Ga0105242_100503795 115
231 3300009545 Ga0105237_10001287 Ga0105237_1000128721 115
232 3300009545 Ga0105237_10001321 Ga0105237_1000132129 115
233 3300009545 Ga0105237_10005754 Ga0105237_1000575416 115
234 3300009545 Ga0105237_10009919 Ga0105237_1000991911 115
235 3300009545 Ga0105237_10012788 Ga0105237_1001278813 115
236 3300009545 Ga0105237_10085054 Ga0105237_100850542 115
237 3300009545 Ga0105237_10559743 Ga0105237_105597432 115
238 3300009545 Ga0105237_12300600 Ga0105237_123006002 115
239 3300009551 Ga0105238_10003742 Ga0105238_1000374215 115
240 3300009551 Ga0105238_10318704 Ga0105238_103187046 115
241 3300009551 Ga0105238_10523618 Ga0105238_105236182 115
242 3300009551 Ga0105238_11302770 Ga0105238_113027702 115
243 3300010375 Ga0105239_10000001 Ga0105239_10000001389 115
244 3300010375 Ga0105239_10001363 Ga0105239_1000136335 115
245 3300010375 Ga0105239_10005053 Ga0105239_1000505312 115
246 3300010375 Ga0105239_10128692 Ga0105239_101286926 115
247 3300010375 Ga0105239_10254445 Ga0105239_102544452 115
248 3300010375 Ga0105239_10848564 Ga0105239_108485642 115
249 3300010375 Ga0105239_11336734 Ga0105239_113367342 115
250 3300013100 Ga0157373_10000175 Ga0157373_1000017555 115
251 3300013100 Ga0157373_10001983 Ga0157373_100019836 115
252 3300013100 Ga0157373_10002244 Ga0157373_100022443 115
253 3300013100 Ga0157373_10024499 Ga0157373_100244995 115
254 3300013100 Ga0157373_10095040 Ga0157373_100950402 115
255 3300013100 Ga0157373_10162221 Ga0157373_101622212 115
256 3300013102 Ga0157371_10000276 Ga0157371_1000027664 115
257 3300013102 Ga0157371_10074928 Ga0157371_100749286 115
258 3300013102 Ga0157371_10939929 Ga0157371_109399291 115
259 3300013104 Ga0157370_10000304 Ga0157370_1000030457 115
260 3300013104 Ga0157370_10066375 Ga0157370_100663753 115
261 3300013104 Ga0157370_10105905 Ga0157370_101059052 115
262 3300013104 Ga0157370_10135449 Ga0157370_101354495 115
263 3300013104 Ga0157370_10238451 Ga0157370_102384512 115
264 3300013104 Ga0157370_10529511 Ga0157370_105295112 115
265 3300013104 Ga0157370_11297375 Ga0157370_112973751 115
266 3300013105 Ga0157369_10000040 Ga0157369_10000040173 115
267 3300013105 Ga0157369_10063032 Ga0157369_100630327 115
268 3300013105 Ga0157369_10459556 Ga0157369_104595562 115
269 3300013296 Ga0157374_10297971 Ga0157374_102979715 115
270 3300013296 Ga0157374_10625250 Ga0157374_106252502 115
271 3300013297 Ga0157378_10072796 Ga0157378_100727962 115
272 3300013297 Ga0157378_10529425 Ga0157378_105294252 115
273 3300013306 Ga0163162_10000052 Ga0163162_1000005242 115
274 3300013306 Ga0163162_10004554 Ga0163162_1000455411 115
275 3300013306 Ga0163162_10021730 Ga0163162_100217307 115
276 3300013306 Ga0163162_10157628 Ga0163162_101576282 115
277 3300013306 Ga0163162_10213814 Ga0163162_102138143 115
278 3300013306 Ga0163162_10880030 Ga0163162_108800302 115
279 3300013307 Ga0157372_10004038 Ga0157372_1000403813 115
280 3300013307 Ga0157372_10015618 Ga0157372_100156183 115
281 3300013307 Ga0157372_10087965 Ga0157372_100879654 115
282 3300013307 Ga0157372_10540873 Ga0157372_105408735 115
283 3300013307 Ga0157372_10691273 Ga0157372_106912733 115
284 3300013307 Ga0157372_10743257 Ga0157372_107432572 115
285 3300013307 Ga0157372_10917045 Ga0157372_109170452 115
286 3300013308 Ga0157375_10130777 Ga0157375_101307776 115
287 3300013308 Ga0157375_10516808 Ga0157375_105168082 115
288 3300013308 Ga0157375_11060989 Ga0157375_110609892 115
289 3300013308 Ga0157375_11978684 Ga0157375_119786841 115
290 3300014325 Ga0163163_10781318 Ga0163163_107813182 115
291 3300014325 Ga0163163_10837569 Ga0163163_108375692 115
292 3300014497 Ga0182008_10000030 Ga0182008_1000003011 115
293 3300014497 Ga0182008_10006118 Ga0182008_100061186 115
294 3300014497 Ga0182008_10100478 Ga0182008_101004782 115
295 3300014497 Ga0182008_10250036 Ga0182008_102500362 115
296 3300014497 Ga0182008_10332023 Ga0182008_103320231 115
297 3300014497 Ga0182008_10447756 Ga0182008_104477562 115
298 3300014745 Ga0157377_10142532 Ga0157377_101425322 115
299 3300014969 Ga0157376_10095846 Ga0157376_100958465 115
300 3300014969 Ga0157376_11382274 Ga0157376_113822741 115
301 3300015261 Ga0182006_1000872 Ga0182006_10008725 115
302 3300015261 Ga0182006_1002415 Ga0182006_100241513 115
303 3300015261 Ga0182006_1012527 Ga0182006_10125276 115
304 3300015261 Ga0182006_1020484 Ga0182006_10204842 115
305 3300015261 Ga0182006_1033008 Ga0182006_10330083 115
306 3300015261 Ga0182006_1111881 Ga0182006_11118811 115
307 3300015262 Ga0182007_10000003 Ga0182007_10000003444 115
308 3300015262 Ga0182007_10058721 Ga0182007_100587216 115
309 3300015262 Ga0182007_10122369 Ga0182007_101223691 115
310 3300015682 Ga0183373_1001 Ga0183373_1001529 115
311 3300017792 Ga0163161_10006390 Ga0163161_100063903 115
312 3300017792 Ga0163161_10031402 Ga0163161_100314024 115
313 3300017792 Ga0163161_10060117 Ga0163161_100601176 115
314 3300017792 Ga0163161_10341896 Ga0163161_103418961 115
315 3300017792 Ga0163161_10461595 Ga0163161_104615951 115
316 3300017792 Ga0163161_10488963 Ga0163161_104889631 115
317 3300017792 Ga0163161_10512550 Ga0163161_105125501 115
318 3300017792 Ga0163161_10564503 Ga0163161_105645032 115
319 3300017792 Ga0163161_11045943 Ga0163161_110459432 115
320 3300017792 Ga0163161_11235625 Ga0163161_112356251 115
321 3300020070 Ga0206356_11665215 Ga0206356_116652152 115
322 3300020077 Ga0206351_10089304 Ga0206351_100893041 115
323 3300020077 Ga0206351_10266683 Ga0206351_102666832 115
324 3300020078 Ga0206352_10302237 Ga0206352_103022371 115
325 3300020078 Ga0206352_10983977 Ga0206352_109839771 115
326 3300020081 Ga0206354_10096798 Ga0206354_100967982 115
327 3300020082 Ga0206353_11414568 Ga0206353_114145682 115
328 3300020610 Ga0154015_1323334 Ga0154015_13233342 115
329 3300022467 Ga0224712_10456144 Ga0224712_104561442 115
330 3300025233 Ga0209437_100143 Ga0209437_10014344 115
331 3300025245 Ga0207425_1000002 Ga0207425_1000002836 115
332 3300025250 Ga0209026_1000663 Ga0209026_100066322 115
333 3300025250 Ga0209026_1009640 Ga0209026_10096402 115
334 3300025254 Ga0209148_1034014 Ga0209148_10340142 115
335 3300025258 Ga0209129_1000002 Ga0209129_1000002836 115
336 3300025258 Ga0209129_1005110 Ga0209129_10051109 115
337 3300025261 Ga0209233_1011941 Ga0209233_10119414 115
338 3300025261 Ga0209233_1053621 Ga0209233_10536211 115
339 3300025292 Ga0209676_1000008 Ga0209676_1000008417 115
340 3300025294 Ga0209025_1000004 Ga0209025_1000004354 115
341 3300025297 Ga0209758_1000006 Ga0209758_1000006354 115
342 3300025298 Ga0209050_1000045 Ga0209050_1000045368 115
343 3300025728 Ga0207655_1111463 Ga0207655_11114632 115
344 3300025899 Ga0207642_10130757 Ga0207642_101307572 115
345 3300025904 Ga0207647_10043409 Ga0207647_100434092 115
346 3300025904 Ga0207647_10063624 Ga0207647_100636244 115
347 3300025907 Ga0207645_10002281 Ga0207645_100022819 115
348 3300025909 Ga0207705_10000043 Ga0207705_10000043141 115
349 3300025909 Ga0207705_10182796 Ga0207705_101827963 115
350 3300025909 Ga0207705_10333291 Ga0207705_103332912 115
351 3300025911 Ga0207654_10137114 Ga0207654_101371142 115
352 3300025911 Ga0207654_10440269 Ga0207654_104402692 115
353 3300025912 Ga0207707_10051151 Ga0207707_100511516 115
354 3300025913 Ga0207695_10000053 Ga0207695_10000053168 115
355 3300025913 Ga0207695_10020448 Ga0207695_100204481 115
356 3300025913 Ga0207695_10029659 Ga0207695_100296593 115
357 3300025913 Ga0207695_10237410 Ga0207695_102374103 115
358 3300025913 Ga0207695_10414277 Ga0207695_104142772 115
359 3300025913 Ga0207695_10883081 Ga0207695_108830811 115
360 3300025913 Ga0207695_11508429 Ga0207695_115084292 115
361 3300025914 Ga0207671_10002398 Ga0207671_1000239818 115
362 3300025914 Ga0207671_10002869 Ga0207671_1000286917 115
363 3300025914 Ga0207671_10003823 Ga0207671_1000382313 115
364 3300025914 Ga0207671_10005821 Ga0207671_100058219 115
365 3300025914 Ga0207671_10022025 Ga0207671_100220253 115
366 3300025914 Ga0207671_10228993 Ga0207671_102289932 115
367 3300025914 Ga0207671_10375027 Ga0207671_103750272 115
368 3300025914 Ga0207671_11534813 Ga0207671_115348131 115
369 3300025917 Ga0207660_10025593 Ga0207660_100255939 115
370 3300025917 Ga0207660_11071074 Ga0207660_110710741 115
371 3300025919 Ga0207657_10344371 Ga0207657_103443713 115
372 3300025919 Ga0207657_10353850 Ga0207657_103538502 115
373 3300025921 Ga0207652_10026145 Ga0207652_100261452 115
374 3300025921 Ga0207652_10158506 Ga0207652_101585062 115
375 3300025921 Ga0207652_11140492 Ga0207652_111404922 115
376 3300025924 Ga0207694_10348023 Ga0207694_103480232 115
377 3300025924 Ga0207694_10430858 Ga0207694_104308582 115
378 3300025924 Ga0207694_10725714 Ga0207694_107257142 115
379 3300025931 Ga0207644_10010204 Ga0207644_100102044 115
380 3300025932 Ga0207690_10526296 Ga0207690_105262961 115
381 3300025933 Ga0207706_10000057 Ga0207706_100000572 115
382 3300025934 Ga0207686_10192197 Ga0207686_101921972 115
383 3300025935 Ga0207709_10502264 Ga0207709_105022642 115
384 3300025937 Ga0207669_11592111 Ga0207669_115921112 115
385 3300025938 Ga0207704_10000052 Ga0207704_1000005258 115
386 3300025940 Ga0207691_10964729 Ga0207691_109647292 115
387 3300025944 Ga0207661_10057095 Ga0207661_100570952 115
388 3300025949 Ga0207667_10037152 Ga0207667_100371528 115
389 3300025949 Ga0207667_10087032 Ga0207667_100870322 115
390 3300025949 Ga0207667_10113392 Ga0207667_101133923 115
391 3300025960 Ga0207651_10033272 Ga0207651_100332729 115
392 3300025981 Ga0207640_10176046 Ga0207640_101760465 115
393 3300025981 Ga0207640_10264718 Ga0207640_102647182 115
394 3300026023 Ga0207677_10091875 Ga0207677_100918753 115
395 3300026023 Ga0207677_10908778 Ga0207677_109087782 115
396 3300026035 Ga0207703_10477102 Ga0207703_104771022 115
397 3300026041 Ga0207639_10050764 Ga0207639_100507644 115
398 3300026041 Ga0207639_10123676 Ga0207639_101236763 115
399 3300026041 Ga0207639_10159488 Ga0207639_101594882 115
400 3300026067 Ga0207678_10224897 Ga0207678_102248972 115
401 3300026078 Ga0207702_10292030 Ga0207702_102920303 115
402 3300026078 Ga0207702_11075908 Ga0207702_110759082 115
403 3300026078 Ga0207702_12456107 Ga0207702_124561072 115
404 3300026088 Ga0207641_11714374 Ga0207641_117143741 115
405 3300026089 Ga0207648_10002788 Ga0207648_1000278816 115
406 3300026116 Ga0207674_11408945 Ga0207674_114089452 115
407 3300026121 Ga0207683_10010796 Ga0207683_1001079614 115
408 3300026142 Ga0207698_10016030 Ga0207698_100160306 115
409 3300026142 Ga0207698_11275593 Ga0207698_112755932 115
410 3300028379 Ga0268266_10000030 Ga0268266_10000030222 115
411 3300028381 Ga0268264_10514910 Ga0268264_105149101 115
412 3300028786 Ga0307517_10006168 Ga0307517_1000616816 115
413 3300028794 Ga0307515_10008566 Ga0307515_1000856616 115
414 3300028794 Ga0307515_10082620 Ga0307515_100826205 115
415 3300028794 Ga0307515_10225522 Ga0307515_102255222 115
416 3300030731 Ga0316177_1003967 Ga0316177_10039673 115
417 3300030732 Ga0316176_1180404 Ga0316176_11804046 115
418 3300030733 Ga0314311_1167977 Ga0314311_11679772 115
419 3300030742 Ga0316183_1095896 Ga0316183_109589686 115
420 3300030744 Ga0316181_1084669 Ga0316181_10846691 115
421 3300030744 Ga0316181_1158926 Ga0316181_11589263 115
422 3300030745 Ga0316182_1114895 Ga0316182_11148951 115
423 3300031250 Ga0265331_10391384 Ga0265331_103913842 115
424 3300031251 Ga0265327_10093580 Ga0265327_100935802 115
425 3300031251 Ga0265327_10346580 Ga0265327_103465802 115
426 3300031456 Ga0307513_10601182 Ga0307513_106011821 115
427 3300031548 Ga0307408_100699407 Ga0307408_1006994071 115
428 3300031730 Ga0307516_10594031 Ga0307516_105940311 115
429 3300031731 Ga0307405_10000003 Ga0307405_10000003227 115
430 3300031824 Ga0307413_11140610 Ga0307413_111406101 115
431 3300031903 Ga0307407_10000030 Ga0307407_1000003024 115
432 3300031903 Ga0307407_10952751 Ga0307407_109527512 115
433 3300031911 Ga0307412_10000065 Ga0307412_1000006538 115
434 3300031911 Ga0307412_10294865 Ga0307412_102948652 115
435 3300031911 Ga0307412_10301438 Ga0307412_103014382 115
436 3300031911 Ga0307412_10444528 Ga0307412_104445285 115
437 3300031911 Ga0307412_11079457 Ga0307412_110794571 115
438 3300031911 Ga0307412_11148350 Ga0307412_111483502 115
439 3300031995 Ga0307409_102809568 Ga0307409_1028095681 115
440 3300032002 Ga0307416_100000014 Ga0307416_10000001439 115
441 3300032004 Ga0307414_10005403 Ga0307414_100054036 115
442 3300032004 Ga0307414_10026048 Ga0307414_100260488 115
443 3300032004 Ga0307414_10299547 Ga0307414_102995471 115
444 3300032004 Ga0307414_10305330 Ga0307414_103053303 115
445 3300032004 Ga0307414_10321906 Ga0307414_103219061 115
446 3300032004 Ga0307414_10406717 Ga0307414_104067172 115
447 3300032004 Ga0307414_10722447 Ga0307414_107224472 115
448 3300032004 Ga0307414_11204325 Ga0307414_112043252 115
449 3300032005 Ga0307411_10520625 Ga0307411_105206251 115
450 3300032005 Ga0307411_11046861 Ga0307411_110468612 115
451 3300033179 Ga0307507_10000032 Ga0307507_1000003232 115
452 3300033180 Ga0307510_10005905 Ga0307510_1000590515 115
453 3300035115 Ga0373941_0107642 Ga0373941_0107642_312_659 115
454 3300037068 Ga0373925_1636913 Ga0373925_1636913_125_472 115
455 3300037312 Ga0395899_0000002 Ga0395899_0000002_8002_8349 115
456 3300037312 Ga0395899_0012421 Ga0395899_0012421_1044_1394 115
457 3300037312 Ga0395899_0047989 Ga0395899_0047989_2154_2501 115
458 3300037418 Ga0395900_0000143 Ga0395900_0000143_105440_105790 115
459 3300037418 Ga0395900_0000285 Ga0395900_0000285_74406_74753 115
460 3300037418 Ga0395900_0513616 Ga0395900_0513616_328_675 115
461 3300037466 Ga0395898_0008044 Ga0395898_0008044_9431_9781 115
462 3300037466 Ga0395898_0245430 Ga0395898_0245430_1349_1696 115
463 3300037471 Ga0395905_0000045 Ga0395905_0000045_165122_165472 115
464 3300037471 Ga0395905_0000765 Ga0395905_0000765_2254_2601 115
465 3300038443 Ga0395901_0002501 Ga0395901_0002501_564_914 115
466 3300038443 Ga0395901_0035978 Ga0395901_0035978_1687_2034 115
467 3300039447 Ga0436361_0542797 Ga0436361_0542797_3084_3434 115
468 3300041453 Ga0451797_0777216 Ga0451797_0777216_130_489 115
469 3300041486 Ga0451807_1592925 Ga0451807_1592925_165_512 115
470 3300041486 Ga0451807_1852552 Ga0451807_1852552_161_508 115
471 3300041486 Ga0451807_1966145 Ga0451807_1966145_153_500 115
472 3300041498 Ga0451841_0449127 Ga0451841_0449127_13_360 115
473 3300041509 Ga0451843_0191440 Ga0451843_0191440_225_572 115
474 3300041509 Ga0451843_1497749 Ga0451843_1497749_214_561 115
475 3300042005 Ga0439448_0000810 Ga0439448_0000810_1693_2043 115
476 3300042012 Ga0439455_0043498 Ga0439455_0043498_527_877 115
477 3300044735 Ga0466968_0074554 Ga0466968_0074554_595_948 115
478 3300046453 Ga0495627_045542 Ga0495627_045542_516_863 115
479 3300046453 Ga0495627_122578 Ga0495627_122578_221_568 115
480 3300046459 Ga0495629_0085265 Ga0495629_0085265_1650_1997 115
481 3300046460 Ga0495638_0110069 Ga0495638_0110069_790_1137 115
482 3300046462 Ga0495651_0078117 Ga0495651_0078117_817_1164 115
483 3300046471 Ga0495650_0000594 Ga0495650_0000594_44447_44794 115
484 3300046471 Ga0495650_0057227 Ga0495650_0057227_863_1210 115
485 3300046471 Ga0495650_0214981 Ga0495650_0214981_199_549 115
486 3300046474 Ga0495605_0122970 Ga0495605_0122970_750_1097 115
487 3300046492 Ga0495585_0000014 Ga0495585_0000014_185689_186036 115
488 3300046492 Ga0495585_0000212 Ga0495585_0000212_279_626 115
489 3300046500 Ga0495596_0093232 Ga0495596_0093232_267_617 115
490 3300046501 Ga0495607_0479038 Ga0495607_0479038_191_538 115
491 3300046506 Ga0495583_0028031 Ga0495583_0028031_363_710 115
492 3300046506 Ga0495583_0045313 Ga0495583_0045313_1103_1453 115
493 3300046507 Ga0495606_0000192 Ga0495606_0000192_103479_103826 115
494 3300046507 Ga0495606_0009373 Ga0495606_0009373_6349_6696 115
495 3300046507 Ga0495606_0025513 Ga0495606_0025513_3510_3857 115
496 3300046507 Ga0495606_0067255 Ga0495606_0067255_1519_1866 115
497 3300046507 Ga0495606_0130392 Ga0495606_0130392_740_1090 115
498 3300046511 Ga0495608_0536423 Ga0495608_0536423_115_462 115
499 3300046512 Ga0495610_0001861 Ga0495610_0001861_4923_5270 115
500 3300046512 Ga0495610_0002826 Ga0495610_0002826_2174_2521 115
501 3300046513 Ga0495616_0003380 Ga0495616_0003380_8165_8512 115
502 3300046513 Ga0495616_0004140 Ga0495616_0004140_281_628 115
503 3300046513 Ga0495616_0293989 Ga0495616_0293989_190_537 115
504 3300046514 Ga0495618_0835435 Ga0495618_0835435_26_373 115
505 3300046518 Ga0495631_0179052 Ga0495631_0179052_273_623 115
506 3300046519 Ga0495632_0170117 Ga0495632_0170117_378_728 115
507 3300046520 Ga0495637_0062797 Ga0495637_0062797_480_827 115
508 3300046523 Ga0495644_0015940 Ga0495644_0015940_982_1329 115
509 3300046524 Ga0495648_0004657 Ga0495648_0004657_11205_11552 115
510 3300046525 Ga0495663_0102969 Ga0495663_0102969_454_801 115
511 3300046525 Ga0495663_0231890 Ga0495663_0231890_19_366 115
512 3300046528 Ga0495642_0454157 Ga0495642_0454157_38_385 115
513 3300046529 Ga0495652_0242121 Ga0495652_0242121_497_844 115
514 3300046530 Ga0495654_0011017 Ga0495654_0011017_296_643 115
515 3300046538 Ga0495609_0004058 Ga0495609_0004058_2290_2637 115
516 3300046538 Ga0495609_0203117 Ga0495609_0203117_231_578 115
517 3300046538 Ga0495609_0221602 Ga0495609_0221602_58_405 115
518 3300046538 Ga0495609_0460239 Ga0495609_0460239_85_435 115
519 3300046557 Ga0495622_0042890 Ga0495622_0042890_712_1059 115
520 3300046557 Ga0495622_0152113 Ga0495622_0152113_78_425 115
521 3300046558 Ga0495633_0000021 Ga0495633_0000021_85153_85500 115
522 3300046558 Ga0495633_0024943 Ga0495633_0024943_1064_1411 115
523 3300046558 Ga0495633_0040843 Ga0495633_0040843_323_670 115
524 3300046558 Ga0495633_0103128 Ga0495633_0103128_341_688 115
525 3300046616 Ga0495668_0000673 Ga0495668_0000673_38851_39198 115
526 3300046616 Ga0495668_0059027 Ga0495668_0059027_1326_1673 115
527 3300046616 Ga0495668_0105953 Ga0495668_0105953_729_1079 115
528 3300046642 Ga0495634_0112380 Ga0495634_0112380_431_781 115
529 3300046660 Ga0495625_0000021 Ga0495625_0000021_271071_271418 115
530 3300046660 Ga0495625_0032464 Ga0495625_0032464_3198_3545 115
531 3300046660 Ga0495625_0062112 Ga0495625_0062112_1186_1533 115
532 3300046660 Ga0495625_0074156 Ga0495625_0074156_407_757 115
533 3300046660 Ga0495625_0118929 Ga0495625_0118929_643_990 115
534 3300046665 Ga0495661_0000739 Ga0495661_0000739_29285_29632 115
535 3300046665 Ga0495661_0008232 Ga0495661_0008232_6207_6554 115
536 3300046665 Ga0495661_0214345 Ga0495661_0214345_340_687 115
537 3300046665 Ga0495661_0223843 Ga0495661_0223843_332_679 115
538 3300046674 Ga0495588_0426941 Ga0495588_0426941_139_486 115
539 3300046683 Ga0495658_0168178 Ga0495658_0168178_115_462 115
540 3300046691 Ga0495670_0149544 Ga0495670_0149544_723_1070 115
541 3300046692 Ga0495671_0019020 Ga0495671_0019020_226_573 115
542 3300046692 Ga0495671_0203926 Ga0495671_0203926_138_485 115
543 3300046694 Ga0495649_0000009 Ga0495649_0000009_188108_188455 115
544 3300046694 Ga0495649_0057462 Ga0495649_0057462_1345_1695 115
545 3300046809 Ga0495600_0235957 Ga0495600_0235957_255_602 115
546 3300046810 Ga0495660_0022461 Ga0495660_0022461_1787_2134 115
547 3300046810 Ga0495660_0110671 Ga0495660_0110671_696_1043 115
548 3300046810 Ga0495660_0256527 Ga0495660_0256527_148_498 115
549 3300047443 Ga0495687_001340 Ga0495687_001340_4909_5256 115
550 3300047443 Ga0495687_012772 Ga0495687_012772_698_1048 115
551 3300047469 Ga0495673_0102668 Ga0495673_0102668_301_648 115
552 3300047470 Ga0495681_0152370 Ga0495681_0152370_597_947 115
553 3300047472 Ga0495686_0020738 Ga0495686_0020738_2842_3189 115
554 3300047472 Ga0495686_0021467 Ga0495686_0021467_3818_4165 115
555 3300047472 Ga0495686_0107785 Ga0495686_0107785_267_614 115
556 3300047472 Ga0495686_0191203 Ga0495686_0191203_811_1158 115
557 3300048089 Ga0495614_0008785 Ga0495614_0008785_1310_1657 115
558 3300048918 Ga0496115_0273242 Ga0496115_0273242_179_526 115
559 3300048925 Ga0496122_0000625 Ga0496122_0000625_27667_28014 115
560 3300048926 Ga0496123_0014082 Ga0496123_0014082_281_628 115
561 3300048928 Ga0496125_0066235 Ga0496125_0066235_1956_2303 115
562 3300048928 Ga0496125_0757648 Ga0496125_0757648_78_425 115
563 3300048929 Ga0496126_0140316 Ga0496126_0140316_274_621 115
564 3300049460 Ga0495682_0004927 Ga0495682_0004927_1728_2075 115
565 3300049570 Ga0501033_0596205 Ga0501033_0596205_24_374 115
566 3300050493 nmdc:mga0k408_350_c1 nmdc:mga0k408_350_c1_14379_14726 115
567 3300050493 nmdc:mga0k408_4120_c1 nmdc:mga0k408_4120_c1_1455_1802 115
568 3300050493 nmdc:mga0k408_783_c1 nmdc:mga0k408_783_c1_129_476 115
569 3300053093 Ga0500651_0000124 Ga0500651_0000124_20433_20780 115
570 3300053122 Ga0500608_057147 Ga0500608_057147_858_1208 115
571 3300053122 Ga0500608_091902 Ga0500608_091902_389_736 115
572 3300053123 Ga0500614_008259 Ga0500614_008259_1495_1842 115
573 3300053125 Ga0500618_000080 Ga0500618_000080_30805_31152 115
574 3300053125 Ga0500618_016552 Ga0500618_016552_187_534 115
575 3300053130 Ga0500642_0138252 Ga0500642_0138252_351_698 115
576 3300053138 Ga0500564_022907 Ga0500564_022907_1311_1658 115
577 3300053139 Ga0500568_0016771 Ga0500568_0016771_2210_2557 115
578 3300053139 Ga0500568_0178361 Ga0500568_0178361_242_589 115
579 3300053140 Ga0500573_0238212 Ga0500573_0238212_231_578 115
580 3300053156 Ga0500622_0001219 Ga0500622_0001219_18240_18587 115
581 3300053156 Ga0500622_0083582 Ga0500622_0083582_394_741 115
582 3300053157 Ga0500624_000925 Ga0500624_000925_4242_4589 115
583 3300053161 Ga0500634_0149325 Ga0500634_0149325_390_737 115
584 3300053161 Ga0500634_0182485 Ga0500634_0182485_164_511 115
585 3300059492 Ga0587073_0184661 Ga0587073_0184661_257_604 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

3

97

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.9159 1 95
6h4n-assembly1.cif.gz_x structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome 0.9156 1 97
4v8h-assembly2.cif.gz_CX crystal structure of hpf bound to the 70s ribosome. 0.9001 1 97
3tqm-assembly1.cif.gz_A structure of an ribosomal subunit interface protein from coxiella burnetii 0.899 1 94
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.8976 1 95
ID Description Score Start End Superfamily
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.8961 1 97 3.30.160.100
1n3gA01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.8867 1 91 3.30.160.100
af_O05886_21_120_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.872 3 98 3.30.160.100
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.8704 1 97 3.30.160.100
3tqmD00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.8584 4 95 3.30.160.100
ID Description Score Start End GO Terms
AF-R7J4M2-F1-model_v4 Ribosomal subunit interface protein 0.9481 1 96
AF-A0A522F1E0-F1-model_v4 Ribosome-associated translation inhibitor RaiA 0.9463 1 101
AF-X1LU55-F1-model_v4 Ribosomal subunit interface protein 0.9439 32 97
AF-A0A2U2PCI5-F1-model_v4 Ribosome-associated translation inhibitor RaiA 0.9434 1 97
AF-A0A1J1ECT7-F1-model_v4 Ribosome hibernation protein YhbH 0.9415 21 97

Feature Viewer

pLDDT pTM Quality
69.31 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map