F466248

General Info

Members Datasets Scaffolds Average Seq Length
583 319 566 392

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100052576|Ga0070714_1000525762
Length 413
Sequence MPINLETPKKFNQLISQAHQVAAEILRPNSRKYDTLEHEYPKELDMLAAAIDGLNEGGALGGAGAGAVGTNGSSPATKKKADEGANRNGSNMASLVGLIEMCWGDVGLLLAMPRQGLGQAAIAAVANEEQLQRFGGKWAAMAITEPEAGSDSAAIRTTATLDEATGDYILNGEKIFVTSGDRAELIVVWATLDRSQGRAAIKSFVVERDNPGLKLDRLEHKLGIRASDTANFVLQDCRVPKENLLGSPEIAPKGGFSGVMQTFDNTRPLVAGMAIGVARACLEDTRDHLQSAGIEIDYNLPPHLQSAAAAEFIAMEADWEAARLLTLQAAWMADNKKPNSLQASMAKAKAGRMGTEIALRCVALCGATGFGEGELMEKWARDAKILDLFEGTQQIQLLIIARQLLGKTSAELK

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
4 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
5 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
6 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
7 2739367898 Nocardioides sp. CF479 Isolate Unclassified
8 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
9 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
10 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
11 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
12 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
13 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
14 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
15 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
16 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
17 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
18 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
182 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
183 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
190 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
191 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
265 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
309 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
310 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
311 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
312 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
313 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0.17
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.83
Nodule 0
Rhizoplane 7.38
Rhizosphere 79.25
Stem 0
Stem Tuber 0.17
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000677 3300001977 Bacteria 5215
2 JGI24740J21852_10026424 3300001979 Bacteria 1945
3 JGI24739J22299_10022631 3300001989 Bacteria 2228
4 JGI24735J21928_10015421 3300002067 Bacteria 2384
5 JGI24748J21848_1000895 3300002074 Bacteria 3227
6 JGI24034J26672_10000136 3300002239 Bacteria 10868
7 JGI25406J46586_10001784 3300003203 Bacteria 10117
8 Ga0070658_10006849 3300005327 Bacteria 9212
9 Ga0070658_10038129 3300005327 Bacteria 3876
10 Ga0070658_10088812 3300005327 Bacteria 2545
11 Ga0070683_100000641 3300005329 Bacteria 25186
12 Ga0070683_100002592 3300005329 Bacteria 14452
13 Ga0070683_100019348 3300005329 Bacteria 6046
14 Ga0070683_100045129 3300005329 Bacteria 4068
15 Ga0070683_100240051 3300005329 Bacteria 1723
16 Ga0070666_10016832 3300005335 Bacteria 4681
17 Ga0070682_100000117 3300005337 Bacteria 69662
18 Ga0070682_100001006 3300005337 Bacteria 16317
19 Ga0070682_100047031 3300005337 Bacteria 2680
20 Ga0068868_100000878 3300005338 Bacteria 20396
21 Ga0070660_100002223 3300005339 Bacteria 13368
22 Ga0070660_100051008 3300005339 Bacteria 3185
23 Ga0070689_100114918 3300005340 Bacteria 2145
24 Ga0070661_100001375 3300005344 Bacteria 16996
25 Ga0070661_100013239 3300005344 Bacteria 5789
26 Ga0070692_10000576 3300005345 Bacteria 11521
27 Ga0070692_10001979 3300005345 Bacteria 7760
28 Ga0070668_100012580 3300005347 Bacteria 6302
29 Ga0070669_100013344 3300005353 Bacteria 5840
30 Ga0070675_100000111 3300005354 Bacteria 47699
31 Ga0070675_100041648 3300005354 Bacteria 3751
32 Ga0070671_100106756 3300005355 Bacteria 2351
33 Ga0070673_100001567 3300005364 Bacteria 13472
34 Ga0070673_100011909 3300005364 Bacteria 5957
35 Ga0070659_100000002 3300005366 Bacteria 369239
36 Ga0070659_100004130 3300005366 Bacteria 10350
37 Ga0070659_100038648 3300005366 Bacteria 3723
38 Ga0070667_100009407 3300005367 Bacteria 8107
39 Ga0070714_100000019 3300005435 Bacteria 169455
40 Ga0070714_100003420 3300005435 Bacteria 11825
41 Ga0070714_100023646 3300005435 Bacteria 5052
42 Ga0070714_100030746 3300005435 Bacteria 4473
43 Ga0070714_100052576 3300005435 Bacteria 3474
44 Ga0070714_100148679 3300005435 Bacteria 2109
45 Ga0070713_100000390 3300005436 Bacteria 28149
46 Ga0070713_100057834 3300005436 Bacteria 3230
47 Ga0070710_10000006 3300005437 Bacteria 217422
48 Ga0070700_100011326 3300005441 Bacteria 4936
49 Ga0070663_100036165 3300005455 Bacteria 3430
50 Ga0070678_100183974 3300005456 Bacteria 1713
51 Ga0070662_100001863 3300005457 Bacteria 12915
52 Ga0070681_10025949 3300005458 Bacteria 5891
53 Ga0068867_100145468 3300005459 Bacteria 1857
54 Ga0070698_100002059 3300005471 Bacteria 22349
55 Ga0070679_100000068 3300005530 Bacteria 77184
56 Ga0070679_100007291 3300005530 Bacteria 10328
57 Ga0070679_100009133 3300005530 Bacteria 9358
58 Ga0070684_100002845 3300005535 Bacteria 12858
59 Ga0070684_100006126 3300005535 Bacteria 9269
60 Ga0070684_100011369 3300005535 Bacteria 7089
61 Ga0068853_100037768 3300005539 Bacteria 4111
62 Ga0070672_100000015 3300005543 Bacteria 72591
63 Ga0070672_100010387 3300005543 Bacteria 6458
64 Ga0070686_100047303 3300005544 Bacteria 2720
65 Ga0070693_100001745 3300005547 Bacteria 9896
66 Ga0070665_100000106 3300005548 Bacteria 157315
67 Ga0070665_100001502 3300005548 Bacteria 27146
68 Ga0070665_100008940 3300005548 Bacteria 10150
69 Ga0070665_100217255 3300005548 Bacteria 1912
70 Ga0070664_100034103 3300005564 Bacteria 4269
71 Ga0070664_100306580 3300005564 Bacteria 1436
72 Ga0068857_100005857 3300005577 Bacteria 10494
73 Ga0068857_100027364 3300005577 Bacteria 5031
74 Ga0068857_100193749 3300005577 Bacteria 1851
75 Ga0068854_100000183 3300005578 Bacteria 42525
76 Ga0068856_100000757 3300005614 Bacteria 35080
77 Ga0068856_100033907 3300005614 Bacteria 4999
78 Ga0070702_100033692 3300005615 Bacteria 2819
79 Ga0070702_100055460 3300005615 Bacteria 2285
80 Ga0068852_100000093 3300005616 Bacteria 60834
81 Ga0068852_100057097 3300005616 Bacteria 3376
82 Ga0068864_100000053 3300005618 Bacteria 133049
83 Ga0068864_100003161 3300005618 Bacteria 13614
84 Ga0068851_10011784 3300005834 Bacteria 4107
85 Ga0068851_10027612 3300005834 Bacteria 2798
86 Ga0068863_100003824 3300005841 Bacteria 14883
87 Ga0068863_100023158 3300005841 Bacteria 5935
88 Ga0068858_100000009 3300005842 Bacteria 237748
89 Ga0068858_100000091 3300005842 Bacteria 93802
90 Ga0068860_100000400 3300005843 Bacteria 56882
91 Ga0068860_100055881 3300005843 Bacteria 3753
92 Ga0081455_10000112 3300005937 Bacteria 92158
93 Ga0081455_10028530 3300005937 Bacteria 5099
94 Ga0081455_10089101 3300005937 Bacteria 2505
95 Ga0081540_1000049 3300005983 Bacteria 127322
96 Ga0081539_10000086 3300005985 Bacteria 217801
97 Ga0081539_10002609 3300005985 Bacteria 24708
98 Ga0081539_10040313 3300005985 Bacteria 2742
99 Ga0070717_10000005 3300006028 Bacteria 357819
100 Ga0070717_10000352 3300006028 Bacteria 29608
101 Ga0070717_10038928 3300006028 Bacteria 3866
102 Ga0070717_10083720 3300006028 Bacteria 2683
103 Ga0075365_10003743 3300006038 Bacteria 7914
104 Ga0075365_10044988 3300006038 Bacteria 2895
105 Ga0075365_10059039 3300006038 Bacteria 2555
106 Ga0075365_10145185 3300006038 Bacteria 1648
107 Ga0075365_10150161 3300006038 Bacteria 1621
108 Ga0075368_10049932 3300006042 Bacteria 1660
109 Ga0075368_10067331 3300006042 Bacteria 1441
110 Ga0075363_100000378 3300006048 Bacteria 13459
111 Ga0075363_100021867 3300006048 Bacteria 3228
112 Ga0075364_10008289 3300006051 Bacteria 6207
113 Ga0075364_10008329 3300006051 Bacteria 6191
114 Ga0070712_100000007 3300006175 Bacteria 157653
115 Ga0070712_100002695 3300006175 Bacteria 10963
116 Ga0070712_100008485 3300006175 Bacteria 6466
117 Ga0075362_10003323 3300006177 Bacteria 5605
118 Ga0075367_10012558 3300006178 Bacteria 4523
119 Ga0075370_10000475 3300006353 Bacteria 15085
120 Ga0075370_10001223 3300006353 Bacteria 10870
121 Ga0075428_100121351 3300006844 Bacteria 2846
122 Ga0075430_100012368 3300006846 Bacteria 7259
123 Ga0075429_100003759 3300006880 Bacteria 12941
124 Ga0068865_100001277 3300006881 Bacteria 14651
125 Ga0068865_100039288 3300006881 Bacteria 3209
126 Ga0105240_10108860 3300009093 Bacteria 3356
127 Ga0111539_10099425 3300009094 Bacteria 3416
128 Ga0111539_10364164 3300009094 Bacteria 1683
129 Ga0105245_10001831 3300009098 Bacteria 19354
130 Ga0105245_10001895 3300009098 Bacteria 18997
131 Ga0105245_10024675 3300009098 Bacteria 5282
132 Ga0105245_10039587 3300009098 Bacteria 4196
133 Ga0105245_10050223 3300009098 Bacteria 3736
134 Ga0105245_10099935 3300009098 Bacteria 2683
135 Ga0105245_10205720 3300009098 Bacteria 1892
136 Ga0114129_10371161 3300009147 Bacteria 1891
137 Ga0105243_10002147 3300009148 Bacteria 16657
138 Ga0105243_10009602 3300009148 Bacteria 7367
139 Ga0105243_10154308 3300009148 Bacteria 1973
140 Ga0105242_10002368 3300009176 Bacteria 14878
141 Ga0105242_10038851 3300009176 Bacteria 3830
142 Ga0105242_10219474 3300009176 Bacteria 1698
143 Ga0105248_10000008 3300009177 Bacteria 403910
144 Ga0105248_10270004 3300009177 Bacteria 1915
145 Ga0105238_10000011 3300009551 Bacteria 261080
146 Ga0105249_10109885 3300009553 Bacteria 2604
147 Ga0105249_10113743 3300009553 Bacteria 2561
148 Ga0105249_10148463 3300009553 Bacteria 2254
149 Ga0105239_10050812 3300010375 Bacteria 4545
150 Ga0105239_10056910 3300010375 Bacteria 4289
151 Ga0105239_10073144 3300010375 Bacteria 3768
152 Ga0105239_10102334 3300010375 Bacteria 3170
153 Ga0105246_10001248 3300011119 Bacteria 14931
154 Ga0105246_10008649 3300011119 Bacteria 6260
155 Ga0105246_10132755 3300011119 Bacteria 1862
156 Ga0157371_10072030 3300013102 Bacteria 2447
157 Ga0157370_10073477 3300013104 Bacteria 3226
158 Ga0157369_10000110 3300013105 Bacteria 115514
159 Ga0157374_10165305 3300013296 Bacteria 2156
160 Ga0157374_10523449 3300013296 Bacteria 1192
161 Ga0157378_10031281 3300013297 Bacteria 4701
162 Ga0157378_10042428 3300013297 Bacteria 4038
163 Ga0163162_10032523 3300013306 Bacteria 5182
164 Ga0163162_10133134 3300013306 Bacteria 2596
165 Ga0163162_10482755 3300013306 Bacteria 1371
166 Ga0157372_10001384 3300013307 Bacteria 26176
167 Ga0157372_10003488 3300013307 Bacteria 16951
168 Ga0157375_10026372 3300013308 Bacteria 5413
169 Ga0157375_10039653 3300013308 Bacteria 4535
170 Ga0157380_10000843 3300014326 Bacteria 19177
171 Ga0157377_10024159 3300014745 Bacteria 3228
172 Ga0157379_10159632 3300014968 Bacteria 2035
173 Ga0157376_10064613 3300014969 Bacteria 3087
174 Ga0213873_10015371 3300021358 Bacteria 1713
175 Ga0213876_10060287 3300021384 Bacteria 2002
176 Ga0213876_10068727 3300021384 Bacteria 1871
177 Ga0213875_10041266 3300021388 Bacteria 2171
178 Ga0224712_10044474 3300022467 Bacteria 1694
179 Ga0207656_10002156 3300025321 Bacteria 6575
180 Ga0207656_10002232 3300025321 Bacteria 6488
181 Ga0207656_10022538 3300025321 Bacteria 2528
182 Ga0207692_10000001 3300025898 Bacteria 558345
183 Ga0207688_10010454 3300025901 Bacteria 5051
184 Ga0207688_10012057 3300025901 Bacteria 4702
185 Ga0207705_10039266 3300025909 Bacteria 3392
186 Ga0207705_10050406 3300025909 Bacteria 2997
187 Ga0207705_10076394 3300025909 Bacteria 2435
188 Ga0207705_10083163 3300025909 Bacteria 2335
189 Ga0207707_10011031 3300025912 Bacteria 7863
190 Ga0207695_10226847 3300025913 Bacteria 1774
191 Ga0207693_10000001 3300025915 Bacteria 469535
192 Ga0207693_10004920 3300025915 Bacteria 11224
193 Ga0207693_10006065 3300025915 Bacteria 10009
194 Ga0207663_10079161 3300025916 Bacteria 2145
195 Ga0207660_10013455 3300025917 Bacteria 5362
196 Ga0207662_10023772 3300025918 Bacteria 3523
197 Ga0207662_10088563 3300025918 Bacteria 1901
198 Ga0207657_10000475 3300025919 Bacteria 42310
199 Ga0207649_10004012 3300025920 Bacteria 8019
200 Ga0207649_10026695 3300025920 Bacteria 3380
201 Ga0207652_10000044 3300025921 Bacteria 127779
202 Ga0207652_10057318 3300025921 Bacteria 3355
203 Ga0207646_10287884 3300025922 Bacteria 1485
204 Ga0207681_10008037 3300025923 Bacteria 6456
205 Ga0207694_10000004 3300025924 Bacteria 967075
206 Ga0207650_10040316 3300025925 Bacteria 3417
207 Ga0207659_10000010 3300025926 Bacteria 286639
208 Ga0207659_10026112 3300025926 Bacteria 3937
209 Ga0207687_10000007 3300025927 Bacteria 604185
210 Ga0207687_10001023 3300025927 Bacteria 18981
211 Ga0207687_10002454 3300025927 Bacteria 12584
212 Ga0207687_10005746 3300025927 Bacteria 8211
213 Ga0207687_10030821 3300025927 Bacteria 3619
214 Ga0207700_10000027 3300025928 Bacteria 137708
215 Ga0207700_10152818 3300025928 Bacteria 1909
216 Ga0207664_10000008 3300025929 Bacteria 309301
217 Ga0207664_10000529 3300025929 Bacteria 27133
218 Ga0207664_10012473 3300025929 Bacteria 6078
219 Ga0207664_10032387 3300025929 Bacteria 4005
220 Ga0207664_10044110 3300025929 Bacteria 3490
221 Ga0207664_10125303 3300025929 Bacteria 2156
222 Ga0207690_10000088 3300025932 Bacteria 76762
223 Ga0207690_10005795 3300025932 Bacteria 7306
224 Ga0207706_10004835 3300025933 Bacteria 12615
225 Ga0207686_10000048 3300025934 Bacteria 115595
226 Ga0207670_10020188 3300025936 Bacteria 4089
227 Ga0207670_10023297 3300025936 Bacteria 3853
228 Ga0207704_10000093 3300025938 Bacteria 52224
229 Ga0207704_10009888 3300025938 Bacteria 4625
230 Ga0207691_10000044 3300025940 Bacteria 100027
231 Ga0207691_10022858 3300025940 Bacteria 5894
232 Ga0207711_10000006 3300025941 Bacteria 792692
233 Ga0207661_10001262 3300025944 Bacteria 16919
234 Ga0207661_10010771 3300025944 Bacteria 6592
235 Ga0207661_10018784 3300025944 Bacteria 5142
236 Ga0207661_10040792 3300025944 Bacteria 3651
237 Ga0207661_10087624 3300025944 Bacteria 2586
238 Ga0207679_10033917 3300025945 Bacteria 3596
239 Ga0207679_10252051 3300025945 Bacteria 1501
240 Ga0207651_10021082 3300025960 Bacteria 3950
241 Ga0207712_10016409 3300025961 Bacteria 4795
242 Ga0207668_10221809 3300025972 Bacteria 1519
243 Ga0207640_10000200 3300025981 Bacteria 42738
244 Ga0207658_10003525 3300025986 Bacteria 11041
245 Ga0207658_10052319 3300025986 Bacteria 3013
246 Ga0207677_10003263 3300026023 Bacteria 8568
247 Ga0207703_10000023 3300026035 Bacteria 222018
248 Ga0207703_10000152 3300026035 Bacteria 79658
249 Ga0207639_10027752 3300026041 Bacteria 4127
250 Ga0207639_10040770 3300026041 Bacteria 3468
251 Ga0207678_10014283 3300026067 Bacteria 6982
252 Ga0207678_10065920 3300026067 Bacteria 3109
253 Ga0207708_10000842 3300026075 Bacteria 23094
254 Ga0207702_10000060 3300026078 Bacteria 125473
255 Ga0207702_10003333 3300026078 Bacteria 14742
256 Ga0207702_10027029 3300026078 Bacteria 4765
257 Ga0207702_10061229 3300026078 Bacteria 3210
258 Ga0207648_10071310 3300026089 Bacteria 3028
259 Ga0207676_10000094 3300026095 Bacteria 80575
260 Ga0207674_10001502 3300026116 Bacteria 30105
261 Ga0207674_10040696 3300026116 Bacteria 4813
262 Ga0207675_100060076 3300026118 Bacteria 3548
263 Ga0207683_10170782 3300026121 Bacteria 1969
264 Ga0207683_10196375 3300026121 Bacteria 1833
265 Ga0207683_10202083 3300026121 Bacteria 1807
266 Ga0207698_10000440 3300026142 Bacteria 23916
267 Ga0207698_10052617 3300026142 Bacteria 3121
268 Ga0209813_10002809 3300027866 Bacteria 4025
269 Ga0209813_10030764 3300027866 Bacteria 1580
270 Ga0268266_10000047 3300028379 Bacteria 310996
271 Ga0268266_10000285 3300028379 Bacteria 83300
272 Ga0268266_10005034 3300028379 Bacteria 12475
273 Ga0268266_10379628 3300028379 Bacteria 1333
274 Ga0268264_10046651 3300028381 Bacteria 3599
275 Ga0265326_10000003 3300028558 Bacteria 479811
276 Ga0265319_1000664 3300028563 Bacteria 22595
277 Ga0265336_10004622 3300028666 Bacteria 5167
278 Ga0307515_10080725 3300028794 Bacteria 4236
279 Ga0307515_10149740 3300028794 Bacteria 2447
280 Ga0265338_10000844 3300028800 Bacteria 51666
281 Ga0265324_10001900 3300029957 Bacteria 11228
282 Ga0307513_10012431 3300031456 Bacteria 10506
283 Ga0307508_10239324 3300031616 Bacteria 1413
284 Ga0307413_10005794 3300031824 Bacteria 5562
285 Ga0307409_100033771 3300031995 Bacteria 3727
286 Ga0307416_100193848 3300032002 Bacteria 1920
287 Ga0307414_10061438 3300032004 Bacteria 2662
288 Ga0307415_100003742 3300032126 Bacteria 7793
289 Ga0307415_100041426 3300032126 Bacteria 3058
290 Ga0307507_10002484 3300033179 Bacteria 38535
291 Ga0373953_0052238 3300035117 Bacteria 1654
292 Ga0373937_0022173 3300036401 Bacteria 5706
293 Ga0373937_0177048 3300036401 Bacteria 2002
294 Ga0395900_0092948 3300037418 Bacteria 3099
295 Ga0395898_0004969 3300037466 Bacteria 14430
296 Ga0436364_0112430 3300037853 Bacteria 46821
297 Ga0400485_08597 3300038735 Bacteria 35424
298 Ga0400488_44500 3300038741 Bacteria 7837
299 Ga0400486_21500 3300038742 Bacteria 94371
300 Ga0436365_0018303 3300039437 Bacteria 2255
301 Ga0436365_0131291 3300039437 Bacteria 43697
302 Ga0436365_0457026 3300039437 Bacteria 17369
303 Ga0436365_1486515 3300039437 Bacteria 5350
304 Ga0436365_1691212 3300039437 Bacteria 5902
305 Ga0436360_0079068 3300039438 Bacteria 1601
306 Ga0436363_0334812 3300039450 Bacteria 1366
307 Ga0436363_0932759 3300039450 Bacteria 40920
308 Ga0436363_0970724 3300039450 Bacteria 6811
309 Ga0436362_0215426 3300039453 Bacteria 3173
310 Ga0439436_0007563 3300041404 Bacteria 3342
311 Ga0439438_028297 3300041405 Bacteria 1508
312 Ga0439447_000769 3300041407 Bacteria 11818
313 Ga0439466_0001145 3300041411 Bacteria 10310
314 Ga0451853_4057189 3300041512 Bacteria 2563
315 Ga0439432_002550 3300042006 Bacteria 6868
316 Ga0439452_001054 3300042010 Bacteria 12161
317 Ga0439446_0000840 3300042156 Bacteria 6571
318 Ga0439434_0000780 3300042435 Bacteria 9163
319 Ga0451577_0001435 3300042876 Bacteria 31732
320 Ga0466969_0001191 3300044656 Bacteria 14062
321 Ga0466969_0040728 3300044656 Bacteria 2327
322 Ga0466966_0016687 3300044684 Bacteria 4851
323 Ga0466966_0089662 3300044684 Bacteria 1910
324 Ga0466961_0002800 3300044693 Bacteria 10849
325 Ga0466961_0015150 3300044693 Bacteria 4950
326 Ga0466961_0016137 3300044693 Bacteria 4796
327 Ga0466963_0000510 3300044694 Bacteria 18138
328 Ga0466963_0005861 3300044694 Bacteria 7240
329 Ga0466963_0020021 3300044694 Bacteria 4205
330 Ga0466963_0084469 3300044694 Bacteria 2154
331 Ga0466963_0088228 3300044694 Bacteria 2110
332 Ga0466963_0112747 3300044694 Bacteria 1867
333 Ga0466964_0019908 3300044706 Bacteria 2582
334 Ga0466968_0041509 3300044735 Bacteria 1942
335 Ga0466970_0021172 3300044765 Bacteria 3386
336 Ga0466970_0071264 3300044765 Bacteria 1869
337 Ga0466970_0153435 3300044765 Bacteria 1272
338 Ga0466957_0019515 3300044842 Bacteria 3987
339 Ga0466957_0021361 3300044842 Bacteria 3813
340 Ga0466957_0050730 3300044842 Bacteria 2525
341 Ga0466957_0054239 3300044842 Bacteria 2446
342 Ga0466960_0000222 3300044901 Bacteria 19771
343 Ga0466960_0002576 3300044901 Bacteria 6814
344 Ga0466960_0015176 3300044901 Bacteria 3316
345 Ga0466960_0043509 3300044901 Bacteria 2136
346 Ga0466959_0002073 3300045049 Bacteria 12682
347 Ga0466959_0009424 3300045049 Bacteria 6946
348 Ga0466959_0016457 3300045049 Bacteria 5404
349 Ga0466959_0028418 3300045049 Bacteria 4147
350 Ga0466959_0050133 3300045049 Bacteria 3066
351 Ga0466959_0057183 3300045049 Bacteria 2844
352 Ga0466958_0005046 3300045836 Bacteria 7050
353 Ga0466958_0013922 3300045836 Bacteria 4587
354 Ga0466958_0050862 3300045836 Bacteria 2508
355 Ga0466967_0000478 3300045976 Bacteria 19384
356 Ga0466967_0028857 3300045976 Bacteria 4638
357 Ga0466967_0043094 3300045976 Bacteria 3906
358 Ga0466967_0050219 3300045976 Bacteria 3651
359 Ga0466967_0055985 3300045976 Bacteria 3475
360 Ga0466967_0082168 3300045976 Bacteria 2911
361 Ga0466967_0127720 3300045976 Bacteria 2357
362 Ga0495592_0101174 3300046454 Bacteria 2054
363 Ga0495592_0132251 3300046454 Bacteria 1744
364 Ga0495629_0005201 3300046459 Bacteria 9743
365 Ga0495638_0037115 3300046460 Bacteria 3101
366 Ga0495641_0000874 3300046461 Bacteria 25824
367 Ga0495641_0088801 3300046461 Bacteria 1382
368 Ga0495651_0119930 3300046462 Bacteria 1934
369 Ga0495653_0035665 3300046463 Bacteria 3923
370 Ga0495580_0016747 3300046472 Bacteria 5500
371 Ga0495639_0084345 3300046475 Bacteria 1484
372 Ga0495606_0000565 3300046507 Bacteria 58752
373 Ga0495608_0000068 3300046511 Bacteria 79694
374 Ga0495608_0020646 3300046511 Bacteria 4525
375 Ga0495628_0121590 3300046516 Bacteria 2002
376 Ga0495628_0123099 3300046516 Bacteria 1988
377 Ga0495630_0000056 3300046517 Bacteria 91477
378 Ga0495630_0034134 3300046517 Bacteria 3797
379 Ga0495630_0064261 3300046517 Bacteria 2757
380 Ga0495652_0004685 3300046529 Bacteria 13047
381 Ga0495652_0083622 3300046529 Bacteria 2627
382 Ga0495640_0106975 3300046533 Bacteria 1831
383 Ga0495645_0002246 3300046543 Bacteria 13145
384 Ga0495645_0018914 3300046543 Bacteria 4954
385 Ga0495645_0162027 3300046543 Bacteria 1546
386 Ga0495667_0189895 3300046559 Bacteria 1317
387 Ga0495634_0007615 3300046642 Bacteria 8114
388 Ga0495625_0000587 3300046660 Bacteria 52838
389 Ga0495635_0071064 3300046663 Bacteria 2386
390 Ga0495588_0000165 3300046674 Bacteria 85841
391 Ga0495657_0000004 3300046675 Bacteria 266465
392 Ga0495657_0047034 3300046675 Bacteria 2919
393 Ga0495599_0013295 3300046678 Bacteria 5087
394 Ga0495647_0000018 3300046681 Bacteria 81701
395 Ga0495613_0000179 3300046689 Bacteria 62109
396 Ga0495624_0000008 3300046690 Bacteria 145035
397 Ga0495624_0000073 3300046690 Bacteria 65582
398 Ga0495649_0000751 3300046694 Bacteria 26125
399 Ga0495600_0016433 3300046809 Bacteria 4696
400 Ga0495604_0000357 3300047317 Bacteria 40931
401 Ga0495604_0078304 3300047317 Bacteria 2481
402 Ga0495604_0167644 3300047317 Bacteria 1547
403 Ga0495674_0035657 3300047319 Bacteria 4486
404 Ga0495674_0152494 3300047319 Bacteria 1937
405 Ga0495672_0030883 3300047320 Bacteria 3352
406 Ga0495676_0004999 3300047321 Bacteria 12164
407 Ga0495676_0027971 3300047321 Bacteria 4826
408 Ga0495676_0038541 3300047321 Bacteria 3968
409 Ga0495680_0000496 3300047322 Bacteria 44440
410 Ga0495687_000406 3300047443 Bacteria 53268
411 Ga0495675_0000175 3300047444 Bacteria 46609
412 Ga0495684_0043493 3300047471 Bacteria 3439
413 Ga0495593_0061865 3300047673 Bacteria 1957
414 Ga0495602_0002588 3300048088 Bacteria 18471
415 Ga0495602_0031032 3300048088 Bacteria 5059
416 Ga0496100_0000018 3300048903 Bacteria 162451
417 Ga0496100_0003651 3300048903 Bacteria 8048
418 Ga0496101_0000062 3300048904 Bacteria 126595
419 Ga0496101_0004877 3300048904 Bacteria 8515
420 Ga0496101_0173669 3300048904 Bacteria 1657
421 Ga0496102_0000039 3300048905 Bacteria 198306
422 Ga0496102_0010620 3300048905 Bacteria 7933
423 Ga0496102_0183577 3300048905 Bacteria 1971
424 Ga0496103_0000008 3300048906 Bacteria 340474
425 Ga0496103_0029605 3300048906 Bacteria 3329
426 Ga0496104_0000650 3300048907 Bacteria 29817
427 Ga0496105_0000347 3300048908 Bacteria 30490
428 Ga0496105_0033730 3300048908 Bacteria 4206
429 Ga0496105_0082806 3300048908 Bacteria 2650
430 Ga0496106_0000122 3300048909 Bacteria 59816
431 Ga0496106_0000312 3300048909 Bacteria 34208
432 Ga0496106_0017353 3300048909 Bacteria 5327
433 Ga0496107_0000006 3300048910 Bacteria 258746
434 Ga0496107_0019934 3300048910 Bacteria 4736
435 Ga0496107_0028789 3300048910 Bacteria 3949
436 Ga0496107_0095337 3300048910 Bacteria 2177
437 Ga0496108_0000062 3300048911 Bacteria 122391
438 Ga0496108_0008150 3300048911 Bacteria 8497
439 Ga0496108_0009387 3300048911 Bacteria 7921
440 Ga0496108_0203029 3300048911 Bacteria 1720
441 Ga0496109_0000121 3300048912 Bacteria 81487
442 Ga0496109_0000129 3300048912 Bacteria 77469
443 Ga0496109_0003623 3300048912 Bacteria 12912
444 Ga0496109_0007583 3300048912 Bacteria 9200
445 Ga0496110_0000089 3300048913 Bacteria 48723
446 Ga0496110_0032801 3300048913 Bacteria 4489
447 Ga0496110_0056938 3300048913 Bacteria 3440
448 Ga0496110_0146152 3300048913 Bacteria 2139
449 Ga0496111_0076543 3300048914 Bacteria 2439
450 Ga0496111_0147610 3300048914 Bacteria 1744
451 Ga0496111_0182051 3300048914 Bacteria 1562
452 Ga0496112_0000223 3300048915 Bacteria 36875
453 Ga0496112_0001770 3300048915 Bacteria 16950
454 Ga0496113_0000628 3300048916 Bacteria 17756
455 Ga0496113_0010757 3300048916 Bacteria 6066
456 Ga0496113_0021542 3300048916 Bacteria 4548
457 Ga0496114_0045004 3300048917 Bacteria 3664
458 Ga0496114_0204212 3300048917 Bacteria 1732
459 Ga0496116_0001565 3300048919 Bacteria 25265
460 Ga0496118_0000818 3300048921 Bacteria 49518
461 Ga0496119_0052566 3300048922 Bacteria 2494
462 Ga0496120_0007169 3300048923 Bacteria 8354
463 Ga0496121_0006714 3300048924 Bacteria 14134
464 Ga0496121_0062775 3300048924 Bacteria 3040
465 Ga0496124_0045298 3300048927 Bacteria 3772
466 Ga0496125_0007232 3300048928 Bacteria 11827
467 Ga0501032_0002454 3300049569 Bacteria 14486
468 Ga0501032_0014608 3300049569 Bacteria 5562
469 Ga0501032_0051764 3300049569 Bacteria 2768
470 Ga0501034_0003032 3300049571 Bacteria 19417
471 Ga0501034_0006537 3300049571 Bacteria 12527
472 Ga0501034_0024940 3300049571 Bacteria 6083
473 Ga0501034_0066247 3300049571 Bacteria 3624
474 Ga0501036_0014209 3300049572 Bacteria 6624
475 Ga0501036_0024665 3300049572 Bacteria 5070
476 Ga0501036_0064936 3300049572 Bacteria 3089
477 Ga0501037_0006562 3300049573 Bacteria 8515
478 Ga0501037_0132425 3300049573 Bacteria 1787
479 Ga0501038_0012061 3300049574 Bacteria 7892
480 Ga0501038_0112865 3300049574 Bacteria 2250
481 Ga0501041_0006202 3300049577 Bacteria 6990
482 Ga0501042_0007948 3300049578 Bacteria 6977
483 Ga0501042_0119524 3300049578 Bacteria 1897
484 Ga0501046_0000799 3300049580 Bacteria 30520
485 Ga0501046_0001349 3300049580 Bacteria 23762
486 Ga0501046_0061264 3300049580 Bacteria 2943
487 Ga0501047_0053133 3300049581 Bacteria 3916
488 Ga0501047_0067942 3300049581 Bacteria 3433
489 Ga0501047_0080816 3300049581 Bacteria 3124
490 Ga0501047_0127282 3300049581 Bacteria 2427
491 Ga0501047_0246814 3300049581 Bacteria 1634
492 Ga0501047_0360799 3300049581 Bacteria 1289
493 Ga0501048_0003341 3300049582 Bacteria 12204
494 Ga0501048_0017290 3300049582 Bacteria 5313
495 Ga0501048_0196308 3300049582 Bacteria 1430
496 Ga0501067_0006652 3300049583 Bacteria 6414
497 Ga0501068_0166982 3300049584 Bacteria 1388
498 Ga0501069_0022967 3300049585 Bacteria 3396
499 Ga0501069_0076805 3300049585 Bacteria 1878
500 Ga0501070_0000651 3300049586 Bacteria 31939
501 Ga0501070_0004254 3300049586 Bacteria 12308
502 Ga0501070_0149318 3300049586 Bacteria 1928
503 Ga0501070_0152198 3300049586 Bacteria 1908
504 Ga0501070_0215519 3300049586 Bacteria 1575
505 Ga0501071_0022117 3300049587 Bacteria 4431
506 Ga0501072_0008263 3300049588 Bacteria 7908
507 Ga0501073_0003023 3300049589 Bacteria 12608
508 Ga0501073_0005104 3300049589 Bacteria 9845
509 Ga0501073_0031643 3300049589 Bacteria 3775
510 Ga0501074_0007354 3300049590 Bacteria 7963
511 Ga0501074_0022863 3300049590 Bacteria 4546
512 Ga0501074_0097880 3300049590 Bacteria 2100
513 Ga0501076_0042557 3300049592 Bacteria 3576
514 Ga0501076_0062993 3300049592 Bacteria 2954
515 Ga0501077_0017179 3300049593 Bacteria 4564
516 Ga0501077_0227206 3300049593 Bacteria 1186
517 Ga0501079_0009411 3300049741 Bacteria 7406
518 Ga0501080_0003998 3300049742 Bacteria 13053
519 Ga0501081_0055694 3300049743 Bacteria 2732
520 Ga0501035_0007867 3300049822 Bacteria 9963
521 Ga0501035_0033927 3300049822 Bacteria 4639
522 Ga0501035_0035100 3300049822 Bacteria 4553
523 Ga0501035_0051830 3300049822 Bacteria 3672
524 Ga0501035_0300316 3300049822 Bacteria 1353
525 Ga0501044_0025719 3300049823 Bacteria 6239
526 Ga0501044_0039969 3300049823 Bacteria 4890
527 Ga0501044_0097462 3300049823 Bacteria 2961
528 Ga0501044_0102835 3300049823 Bacteria 2872
529 Ga0501045_0098538 3300049824 Bacteria 2163
530 nmdc:mga03n38_10033_c1 3300050490 Bacteria 3468
531 nmdc:mga03n38_16770_c1 3300050490 Bacteria 2857
532 nmdc:mga00v17_41493_c1 3300050491 Bacteria 2764
533 nmdc:mga00v17_96767_c1 3300050491 Bacteria 1860
534 nmdc:mga0yw44_13510_c1 3300050492 Bacteria 4303
535 nmdc:mga0yw44_39718_c1 3300050492 Bacteria 2792
536 nmdc:mga0yw44_790_c1 3300050492 Bacteria 4685
537 nmdc:mga04h51_8902_c1 3300050495 Bacteria 2700
538 nmdc:mga07m45_14203_c1 3300050496 Bacteria 4237
539 nmdc:mga09592_12744_c1 3300050508 Bacteria 6854
540 nmdc:mga06r32_27104_c1 3300050510 Bacteria 3689
541 nmdc:mga0rr50_104887_c1 3300050513 Bacteria 2227
542 Ga0495601_0000013 3300053077 Bacteria 226476
543 Ga0495601_0000124 3300053077 Bacteria 43205
544 Ga0495612_0001051 3300053078 Bacteria 11297
545 Ga0495655_0000001 3300053083 Bacteria 419518
546 Ga0495595_0000003 3300053084 Bacteria 266465
547 Ga0495595_0031516 3300053084 Bacteria 2383
548 Ga0495619_0000031 3300053085 Bacteria 145508
549 Ga0495619_0000257 3300053085 Bacteria 38653
550 Ga0495619_0001230 3300053085 Bacteria 16755
551 Ga0495619_0007664 3300053085 Bacteria 6836
552 Ga0500644_0000541 3300053088 Bacteria 15557
553 Ga0500566_0098016 3300053094 Bacteria 1611
554 Ga0500641_0004769 3300053096 Bacteria 4801
555 Ga0500593_000263 3300053117 Bacteria 21458
556 Ga0500614_012010 3300053123 Bacteria 1883
557 Ga0500628_000010 3300053129 Bacteria 122210
558 Ga0500658_0000447 3300053134 Bacteria 17605
559 Ga0500573_0043434 3300053140 Bacteria 2593
560 Ga0501084_0013369 3300054114 Bacteria 6791
561 Ga0501082_0033473 3300060353 Bacteria 4435
562 Ga0501082_0101790 3300060353 Bacteria 2485
563 Ga0466962_0002335 3300061719 Bacteria 8997
564 Ga0466962_0009905 3300061719 Bacteria 4572
565 Ga0466962_0061612 3300061719 Bacteria 1791
566 Ga0530510_0073683 3300061734 Bacteria 2479

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0173669 Ga0496101_0173669_565_1644 319
2 3300005355 Ga0070671_100106756 Ga0070671_1001067561 323
3 3300005618 Ga0068864_100003161 Ga0068864_10000316110 323
4 3300009098 Ga0105245_10099935 Ga0105245_100999353 323
5 3300014968 Ga0157379_10159632 Ga0157379_101596321 323
6 3300025927 Ga0207687_10005746 Ga0207687_100057466 323
7 3300028379 Ga0268266_10379628 Ga0268266_103796281 323
8 3300053134 Ga0500658_0000447 Ga0500658_0000447_1799_3010 324
9 3300009094 Ga0111539_10364164 Ga0111539_103641641 325
10 3300005548 Ga0070665_100008940 Ga0070665_1000089406 326
11 3300009098 Ga0105245_10039587 Ga0105245_100395873 326
12 3300039450 Ga0436363_0932759 Ga0436363_0932759_39864_40901 326
13 3300047443 Ga0495687_000406 Ga0495687_000406_50050_51213 326
14 3300013296 Ga0157374_10523449 Ga0157374_105234491 329
15 3300028794 Ga0307515_10080725 Ga0307515_100807253 333
16 3300031456 Ga0307513_10012431 Ga0307513_100124313 333
17 3300046559 Ga0495667_0189895 Ga0495667_0189895_35_1192 335
18 3300028794 Ga0307515_10149740 Ga0307515_101497401 338
19 3300046472 Ga0495580_0016747 Ga0495580_0016747_2510_3661 342
20 3300046461 Ga0495641_0088801 Ga0495641_0088801_25_1098 346
21 3300046663 Ga0495635_0071064 Ga0495635_0071064_506_1714 348
22 3300053085 Ga0495619_0007664 Ga0495619_0007664_5315_6523 348
23 3300037853 Ga0436364_0112430 Ga0436364_0112430_37880_39106 349
24 3300039437 Ga0436365_0457026 Ga0436365_0457026_8546_9772 349
25 3300039450 Ga0436363_0970724 Ga0436363_0970724_912_2138 349
26 3300045976 Ga0466967_0127720 Ga0466967_0127720_522_1745 351
27 3300044656 Ga0466969_0001191 Ga0466969_0001191_7279_8493 356
28 3300045049 Ga0466959_0009424 Ga0466959_0009424_1640_2854 356
29 3300006846 Ga0075430_100012368 Ga0075430_1000123685 357
30 3300006038 Ga0075365_10150161 Ga0075365_101501612 358
31 3300045976 Ga0466967_0000478 Ga0466967_0000478_9624_10862 360
32 3300049824 Ga0501045_0098538 Ga0501045_0098538_89_1303 360
33 3300039437 Ga0436365_1691212 Ga0436365_1691212_1066_2301 361
34 3300044842 Ga0466957_0054239 Ga0466957_0054239_20_1150 361
35 3300049573 Ga0501037_0132425 Ga0501037_0132425_25_1173 361
36 3300042876 Ga0451577_0001435 Ga0451577_0001435_5875_7086 362
37 3300048909 Ga0496106_0000312 Ga0496106_0000312_60_1271 362
38 3300005327 Ga0070658_10038129 Ga0070658_100381292 363
39 3300005329 Ga0070683_100019348 Ga0070683_1000193485 363
40 3300005337 Ga0070682_100001006 Ga0070682_1000010063 363
41 3300005339 Ga0070660_100002223 Ga0070660_1000022236 363
42 3300005344 Ga0070661_100013239 Ga0070661_1000132395 363
43 3300005345 Ga0070692_10000576 Ga0070692_100005769 363
44 3300005354 Ga0070675_100041648 Ga0070675_1000416483 363
45 3300005364 Ga0070673_100011909 Ga0070673_1000119093 363
46 3300005366 Ga0070659_100004130 Ga0070659_1000041302 363
47 3300005441 Ga0070700_100011326 Ga0070700_1000113263 363
48 3300005455 Ga0070663_100036165 Ga0070663_1000361651 363
49 3300005457 Ga0070662_100001863 Ga0070662_1000018638 363
50 3300005459 Ga0068867_100145468 Ga0068867_1001454682 363
51 3300005535 Ga0070684_100006126 Ga0070684_1000061262 363
52 3300005539 Ga0068853_100037768 Ga0068853_1000377683 363
53 3300005543 Ga0070672_100010387 Ga0070672_1000103874 363
54 3300005544 Ga0070686_100047303 Ga0070686_1000473032 363
55 3300005564 Ga0070664_100034103 Ga0070664_1000341032 363
56 3300005577 Ga0068857_100193749 Ga0068857_1001937491 363
57 3300005615 Ga0070702_100033692 Ga0070702_1000336922 363
58 3300005616 Ga0068852_100057097 Ga0068852_1000570973 363
59 3300005834 Ga0068851_10027612 Ga0068851_100276122 363
60 3300006038 Ga0075365_10044988 Ga0075365_100449882 363
61 3300006048 Ga0075363_100000378 Ga0075363_10000037811 363
62 3300006881 Ga0068865_100039288 Ga0068865_1000392882 363
63 3300009098 Ga0105245_10205720 Ga0105245_102057202 363
64 3300009148 Ga0105243_10002147 Ga0105243_100021478 363
65 3300009553 Ga0105249_10113743 Ga0105249_101137431 363
66 3300010375 Ga0105239_10102334 Ga0105239_101023342 363
67 3300013306 Ga0163162_10133134 Ga0163162_101331342 363
68 3300014745 Ga0157377_10024159 Ga0157377_100241592 363
69 3300021358 Ga0213873_10015371 Ga0213873_100153712 363
70 3300021384 Ga0213876_10060287 Ga0213876_100602872 363
71 3300025321 Ga0207656_10022538 Ga0207656_100225382 363
72 3300025901 Ga0207688_10010454 Ga0207688_100104543 363
73 3300025909 Ga0207705_10039266 Ga0207705_100392662 363
74 3300025918 Ga0207662_10088563 Ga0207662_100885631 363
75 3300025919 Ga0207657_10000475 Ga0207657_1000047523 363
76 3300025920 Ga0207649_10026695 Ga0207649_100266951 363
77 3300025926 Ga0207659_10026112 Ga0207659_100261123 363
78 3300025927 Ga0207687_10030821 Ga0207687_100308212 363
79 3300025932 Ga0207690_10005795 Ga0207690_100057952 363
80 3300025933 Ga0207706_10004835 Ga0207706_100048354 363
81 3300025936 Ga0207670_10023297 Ga0207670_100232973 363
82 3300025938 Ga0207704_10009888 Ga0207704_100098883 363
83 3300025940 Ga0207691_10022858 Ga0207691_100228586 363
84 3300025944 Ga0207661_10018784 Ga0207661_100187843 363
85 3300025945 Ga0207679_10033917 Ga0207679_100339172 363
86 3300026041 Ga0207639_10040770 Ga0207639_100407702 363
87 3300026067 Ga0207678_10065920 Ga0207678_100659202 363
88 3300026075 Ga0207708_10000842 Ga0207708_100008423 363
89 3300026089 Ga0207648_10071310 Ga0207648_100713102 363
90 3300026118 Ga0207675_100060076 Ga0207675_1000600762 363
91 3300026142 Ga0207698_10052617 Ga0207698_100526173 363
92 3300039453 Ga0436362_0215426 Ga0436362_0215426_1500_2735 363
93 3300048909 Ga0496106_0017353 Ga0496106_0017353_1999_3213 363
94 3300048910 Ga0496107_0028789 Ga0496107_0028789_1476_2690 363
95 3300048911 Ga0496108_0008150 Ga0496108_0008150_873_2087 363
96 3300048912 Ga0496109_0003623 Ga0496109_0003623_9690_10904 363
97 3300048913 Ga0496110_0056938 Ga0496110_0056938_868_2082 363
98 3300050490 nmdc:mga03n38_10033_c1 nmdc:mga03n38_10033_c1_1018_2232 363
99 3300050492 nmdc:mga0yw44_790_c1 nmdc:mga0yw44_790_c1_2144_3358 363
100 3300044694 Ga0466963_0020021 Ga0466963_0020021_2097_3335 364
101 3300006844 Ga0075428_100121351 Ga0075428_1001213513 365
102 3300044694 Ga0466963_0088228 Ga0466963_0088228_642_1880 365
103 3300044842 Ga0466957_0050730 Ga0466957_0050730_217_1455 365
104 3300045836 Ga0466958_0013922 Ga0466958_0013922_169_1410 365
105 3300050510 nmdc:mga06r32_27104_c1 nmdc:mga06r32_27104_c1_1519_2703 366
106 3300002074 JGI24748J21848_1000895 JGI24748J21848_10008953 369
107 3300002239 JGI24034J26672_10000136 JGI24034J26672_1000013610 369
108 3300006028 Ga0070717_10000352 Ga0070717_100003522 369
109 3300044901 Ga0466960_0043509 Ga0466960_0043509_492_1715 369
110 3300048917 Ga0496114_0204212 Ga0496114_0204212_570_1718 369
111 3300049593 Ga0501077_0227206 Ga0501077_0227206_19_1173 369
112 3300021384 Ga0213876_10068727 Ga0213876_100687272 370
113 3300039437 Ga0436365_0131291 Ga0436365_0131291_40560_41786 370
114 3300005364 Ga0070673_100001567 Ga0070673_10000156710 371
115 3300009176 Ga0105242_10002368 Ga0105242_1000236810 371
116 3300025934 Ga0207686_10000048 Ga0207686_10000048100 371
117 3300025960 Ga0207651_10021082 Ga0207651_100210822 371
118 3300035117 Ga0373953_0052238 Ga0373953_0052238_49_1275 371
119 3300044693 Ga0466961_0015150 Ga0466961_0015150_3613_4863 371
120 3300044765 Ga0466970_0071264 Ga0466970_0071264_359_1567 371
121 3300045049 Ga0466959_0002073 Ga0466959_0002073_10103_11353 371
122 3300048905 Ga0496102_0000039 Ga0496102_0000039_82862_84070 371
123 3300048906 Ga0496103_0000008 Ga0496103_0000008_204117_205325 371
124 3300053083 Ga0495655_0000001 Ga0495655_0000001_195646_196854 371
125 3300053129 Ga0500628_000010 Ga0500628_000010_69847_71055 371
126 3300006175 Ga0070712_100000007 Ga0070712_100000007154 372
127 3300006175 Ga0070712_100002695 Ga0070712_1000026952 372
128 3300025915 Ga0207693_10000001 Ga0207693_10000001282 372
129 3300025915 Ga0207693_10004920 Ga0207693_100049202 372
130 3300025928 Ga0207700_10152818 Ga0207700_101528182 372
131 3300026121 Ga0207683_10196375 Ga0207683_101963751 372
132 3300036401 Ga0373937_0177048 Ga0373937_0177048_339_1589 372
133 3300039437 Ga0436365_1486515 Ga0436365_1486515_881_2110 372
134 3300046511 Ga0495608_0020646 Ga0495608_0020646_1773_3023 372
135 3300046516 Ga0495628_0121590 Ga0495628_0121590_542_1792 372
136 3300046533 Ga0495640_0106975 Ga0495640_0106975_479_1729 372
137 3300046660 Ga0495625_0000587 Ga0495625_0000587_25341_26546 372
138 3300046675 Ga0495657_0047034 Ga0495657_0047034_1333_2583 372
139 3300047317 Ga0495604_0078304 Ga0495604_0078304_115_1365 372
140 3300047319 Ga0495674_0035657 Ga0495674_0035657_759_1997 372
141 3300047471 Ga0495684_0043493 Ga0495684_0043493_1754_2998 372
142 3300048088 Ga0495602_0031032 Ga0495602_0031032_1252_2502 372
143 3300048913 Ga0496110_0146152 Ga0496110_0146152_559_1809 372
144 3300049592 Ga0501076_0042557 Ga0501076_0042557_2322_3533 372
145 3300001979 JGI24740J21852_10026424 JGI24740J21852_100264241 373
146 3300001989 JGI24739J22299_10022631 JGI24739J22299_100226311 373
147 3300005577 Ga0068857_100027364 Ga0068857_1000273642 373
148 3300011119 Ga0105246_10132755 Ga0105246_101327552 373
149 3300021388 Ga0213875_10041266 Ga0213875_100412662 373
150 3300025972 Ga0207668_10221809 Ga0207668_102218091 373
151 3300025986 Ga0207658_10052319 Ga0207658_100523192 373
152 3300026116 Ga0207674_10040696 Ga0207674_100406964 373
153 3300039438 Ga0436360_0079068 Ga0436360_0079068_113_1330 373
154 3300045049 Ga0466959_0028418 Ga0466959_0028418_189_1430 373
155 3300048911 Ga0496108_0203029 Ga0496108_0203029_459_1676 373
156 3300031616 Ga0307508_10239324 Ga0307508_102393241 374
157 3300044693 Ga0466961_0002800 Ga0466961_0002800_8195_9418 374
158 3300044694 Ga0466963_0000510 Ga0466963_0000510_2811_4034 374
159 3300044735 Ga0466968_0041509 Ga0466968_0041509_625_1848 374
160 3300045049 Ga0466959_0016457 Ga0466959_0016457_2684_3907 374
161 3300045836 Ga0466958_0005046 Ga0466958_0005046_4456_5679 374
162 3300003203 JGI25406J46586_10001784 JGI25406J46586_1000178410 375
163 3300005985 Ga0081539_10000086 Ga0081539_1000008610 375
164 3300039450 Ga0436363_0334812 Ga0436363_0334812_47_1279 375
165 3300005937 Ga0081455_10000112 Ga0081455_1000011295 376
166 3300002067 JGI24735J21928_10015421 JGI24735J21928_100154212 377
167 3300005327 Ga0070658_10088812 Ga0070658_100888122 377
168 3300005339 Ga0070660_100051008 Ga0070660_1000510082 377
169 3300005530 Ga0070679_100007291 Ga0070679_1000072915 377
170 3300005614 Ga0068856_100033907 Ga0068856_1000339074 377
171 3300006038 Ga0075365_10145185 Ga0075365_101451852 377
172 3300025909 Ga0207705_10076394 Ga0207705_100763942 377
173 3300025921 Ga0207652_10057318 Ga0207652_100573183 377
174 3300026078 Ga0207702_10027029 Ga0207702_100270294 377
175 3300045836 Ga0466958_0050862 Ga0466958_0050862_1245_2474 377
176 3300061719 Ga0466962_0009905 Ga0466962_0009905_1521_2750 377
177 3300005937 Ga0081455_10028530 Ga0081455_100285304 378
178 3300009551 Ga0105238_10000011 Ga0105238_10000011164 378
179 3300025924 Ga0207694_10000004 Ga0207694_10000004458 378
180 3300053085 Ga0495619_0001230 Ga0495619_0001230_1166_2395 378
181 3300025918 Ga0207662_10023772 Ga0207662_100237722 379
182 3300046543 Ga0495645_0018914 Ga0495645_0018914_2260_3480 379
183 3300047321 Ga0495676_0004999 Ga0495676_0004999_2700_3914 379
184 3300048915 Ga0496112_0000223 Ga0496112_0000223_16629_17846 379
185 3300006028 Ga0070717_10038928 Ga0070717_100389282 380
186 3300005345 Ga0070692_10001979 Ga0070692_100019792 381
187 3300005435 Ga0070714_100000019 Ga0070714_10000001963 381
188 3300005456 Ga0070678_100183974 Ga0070678_1001839742 381
189 3300005564 Ga0070664_100306580 Ga0070664_1003065801 381
190 3300005577 Ga0068857_100005857 Ga0068857_1000058571 381
191 3300009147 Ga0114129_10371161 Ga0114129_103711612 381
192 3300009176 Ga0105242_10219474 Ga0105242_102194741 381
193 3300013102 Ga0157371_10072030 Ga0157371_100720302 381
194 3300013308 Ga0157375_10026372 Ga0157375_100263723 381
195 3300025929 Ga0207664_10000008 Ga0207664_10000008271 381
196 3300025945 Ga0207679_10252051 Ga0207679_102520512 381
197 3300026116 Ga0207674_10001502 Ga0207674_1000150218 381
198 3300026121 Ga0207683_10170782 Ga0207683_101707822 381
199 3300026121 Ga0207683_10202083 Ga0207683_102020832 381
200 3300048912 Ga0496109_0007583 Ga0496109_0007583_7704_8924 381
201 3300049577 Ga0501041_0006202 Ga0501041_0006202_5680_6831 381
202 3300053096 Ga0500641_0004769 Ga0500641_0004769_1146_2360 381
203 3300005327 Ga0070658_10006849 Ga0070658_100068495 382
204 3300005329 Ga0070683_100000641 Ga0070683_1000006418 382
205 3300005337 Ga0070682_100047031 Ga0070682_1000470311 382
206 3300005535 Ga0070684_100002845 Ga0070684_1000028454 382
207 3300005615 Ga0070702_100055460 Ga0070702_1000554602 382
208 3300005843 Ga0068860_100055881 Ga0068860_1000558813 382
209 3300009098 Ga0105245_10050223 Ga0105245_100502232 382
210 3300009148 Ga0105243_10154308 Ga0105243_101543082 382
211 3300009177 Ga0105248_10270004 Ga0105248_102700042 382
212 3300009553 Ga0105249_10109885 Ga0105249_101098852 382
213 3300010375 Ga0105239_10050812 Ga0105239_100508124 382
214 3300011119 Ga0105246_10001248 Ga0105246_1000124816 382
215 3300013306 Ga0163162_10032523 Ga0163162_100325232 382
216 3300013307 Ga0157372_10003488 Ga0157372_1000348814 382
217 3300025901 Ga0207688_10012057 Ga0207688_100120573 382
218 3300025909 Ga0207705_10083163 Ga0207705_100831632 382
219 3300025944 Ga0207661_10040792 Ga0207661_100407922 382
220 3300025961 Ga0207712_10016409 Ga0207712_100164095 382
221 3300028381 Ga0268264_10046651 Ga0268264_100466512 382
222 3300041512 Ga0451853_4057189 Ga0451853_4057189_482_1696 382
223 3300044694 Ga0466963_0005861 Ga0466963_0005861_16_1281 382
224 3300048906 Ga0496103_0029605 Ga0496103_0029605_1116_2336 382
225 3300048927 Ga0496124_0045298 Ga0496124_0045298_55_1272 382
226 3300049572 Ga0501036_0014209 Ga0501036_0014209_1109_2323 382
227 3300049574 Ga0501038_0012061 Ga0501038_0012061_4021_5235 382
228 3300049580 Ga0501046_0061264 Ga0501046_0061264_1512_2726 382
229 3300049581 Ga0501047_0080816 Ga0501047_0080816_1446_2660 382
230 3300049589 Ga0501073_0031643 Ga0501073_0031643_105_1319 382
231 3300049742 Ga0501080_0003998 Ga0501080_0003998_6061_7278 382
232 3300049822 Ga0501035_0033927 Ga0501035_0033927_808_2022 382
233 3300047320 Ga0495672_0030883 Ga0495672_0030883_330_1547 383
234 iso_pu_bacteria 2795385470 2795785898 383
235 3300005842 Ga0068858_100000091 Ga0068858_10000009164 384
236 3300026035 Ga0207703_10000152 Ga0207703_1000015265 384
237 3300044765 Ga0466970_0021172 Ga0466970_0021172_578_1798 384
238 3300046517 Ga0495630_0034134 Ga0495630_0034134_1716_2927 384
239 3300047319 Ga0495674_0152494 Ga0495674_0152494_530_1762 384
240 3300025929 Ga0207664_10044110 Ga0207664_100441103 385
241 3300044901 Ga0466960_0015176 Ga0466960_0015176_1967_3172 385
242 3300045976 Ga0466967_0028857 Ga0466967_0028857_2428_3633 385
243 3300049569 Ga0501032_0002454 Ga0501032_0002454_6253_7458 385
244 3300049571 Ga0501034_0003032 Ga0501034_0003032_3078_4283 385
245 3300049571 Ga0501034_0006537 Ga0501034_0006537_7795_9012 385
246 3300049572 Ga0501036_0064936 Ga0501036_0064936_412_1617 385
247 3300049573 Ga0501037_0006562 Ga0501037_0006562_5941_7146 385
248 3300049580 Ga0501046_0001349 Ga0501046_0001349_6969_8174 385
249 3300049581 Ga0501047_0053133 Ga0501047_0053133_20_1225 385
250 3300049582 Ga0501048_0003341 Ga0501048_0003341_5280_6485 385
251 3300049586 Ga0501070_0004254 Ga0501070_0004254_3934_5139 385
252 3300049587 Ga0501071_0022117 Ga0501071_0022117_1240_2457 385
253 3300049589 Ga0501073_0005104 Ga0501073_0005104_5882_7099 385
254 3300049822 Ga0501035_0007867 Ga0501035_0007867_1965_3170 385
255 3300049823 Ga0501044_0025719 Ga0501044_0025719_1986_3191 385
256 3300049823 Ga0501044_0102835 Ga0501044_0102835_707_1912 385
257 3300054114 Ga0501084_0013369 Ga0501084_0013369_5516_6733 385
258 iso_pu_bacteria 2582580736 2583152661 385
259 iso_pu_bacteria 2795385472 2795795731 385
260 iso_pu_bacteria 2899359706 2899361660 385
261 iso_pu_bacteria 2899370129 2899373078 385
262 3300005618 Ga0068864_100000053 Ga0068864_10000005347 386
263 3300005937 Ga0081455_10089101 Ga0081455_100891012 386
264 3300026095 Ga0207676_10000094 Ga0207676_1000009425 386
265 3300033179 Ga0307507_10002484 Ga0307507_100024846 386
266 3300045049 Ga0466959_0050133 Ga0466959_0050133_1787_3025 386
267 3300044694 Ga0466963_0084469 Ga0466963_0084469_44_1258 387
268 3300044706 Ga0466964_0019908 Ga0466964_0019908_187_1401 387
269 3300047321 Ga0495676_0027971 Ga0495676_0027971_3249_4445 387
270 iso_pu_bacteria 2643221681 2644457230 387
271 iso_pu_bacteria 2643221961 2645719556 387
272 iso_pu_bacteria 2643221962 2645726459 387
273 iso_pu_bacteria 2739367898 2740169324 387
274 iso_pu_bacteria 2773857762 2774392211 387
275 iso_pu_bacteria 2808606439 2809196012 387
276 iso_pu_bacteria 2811994878 2812351852 387
277 iso_pu_bacteria 2855386786 2855387165 387
278 iso_pu_bacteria 2857481737 2857482518 387
279 iso_pu_bacteria 2891968417 2891970512 387
280 3300009148 Ga0105243_10009602 Ga0105243_100096025 388
281 3300009553 Ga0105249_10148463 Ga0105249_101484631 388
282 3300031824 Ga0307413_10005794 Ga0307413_100057947 388
283 3300041404 Ga0439436_0007563 Ga0439436_0007563_1789_2994 388
284 3300041405 Ga0439438_028297 Ga0439438_028297_59_1264 388
285 3300041407 Ga0439447_000769 Ga0439447_000769_7212_8417 388
286 3300041411 Ga0439466_0001145 Ga0439466_0001145_6805_8010 388
287 3300042006 Ga0439432_002550 Ga0439432_002550_4005_5210 388
288 3300042010 Ga0439452_001054 Ga0439452_001054_3102_4307 388
289 3300042156 Ga0439446_0000840 Ga0439446_0000840_158_1363 388
290 3300042435 Ga0439434_0000780 Ga0439434_0000780_7403_8608 388
291 3300045976 Ga0466967_0043094 Ga0466967_0043094_948_2153 388
292 3300048910 Ga0496107_0095337 Ga0496107_0095337_279_1496 388
293 3300048916 Ga0496113_0010757 Ga0496113_0010757_3403_4611 388
294 3300049822 Ga0501035_0300316 Ga0501035_0300316_106_1320 388
295 iso_pu_bacteria 2643221615 2644089080 388
296 iso_pu_bacteria 2643221697 2644537632 388
297 3300005337 Ga0070682_100000117 Ga0070682_10000011756 389
298 3300005435 Ga0070714_100023646 Ga0070714_1000236461 389
299 3300005435 Ga0070714_100052576 Ga0070714_1000525762 389
300 3300005436 Ga0070713_100057834 Ga0070713_1000578342 389
301 3300005548 Ga0070665_100001502 Ga0070665_1000015025 389
302 3300005985 Ga0081539_10002609 Ga0081539_100026094 389
303 3300006028 Ga0070717_10083720 Ga0070717_100837202 389
304 3300022467 Ga0224712_10044474 Ga0224712_100444742 389
305 3300025929 Ga0207664_10032387 Ga0207664_100323872 389
306 3300038735 Ga0400485_08597 Ga0400485_08597_14805_16010 389
307 3300038741 Ga0400488_44500 Ga0400488_44500_1605_2810 389
308 3300038742 Ga0400486_21500 Ga0400486_21500_47002_48207 389
309 3300039437 Ga0436365_0018303 Ga0436365_0018303_358_1584 389
310 3300044694 Ga0466963_0112747 Ga0466963_0112747_282_1487 389
311 3300046460 Ga0495638_0037115 Ga0495638_0037115_929_2137 389
312 3300046529 Ga0495652_0083622 Ga0495652_0083622_653_1885 389
313 3300049581 Ga0501047_0246814 Ga0501047_0246814_119_1327 389
314 3300050513 nmdc:mga0rr50_104887_c1 nmdc:mga0rr50_104887_c1_658_1866 389
315 3300053117 Ga0500593_000263 Ga0500593_000263_2017_3231 389
316 3300005329 Ga0070683_100045129 Ga0070683_1000451292 390
317 3300005329 Ga0070683_100240051 Ga0070683_1002400512 390
318 3300005335 Ga0070666_10016832 Ga0070666_100168322 390
319 3300005338 Ga0068868_100000878 Ga0068868_10000087821 390
320 3300005340 Ga0070689_100114918 Ga0070689_1001149183 390
321 3300005344 Ga0070661_100001375 Ga0070661_10000137510 390
322 3300005347 Ga0070668_100012580 Ga0070668_1000125805 390
323 3300005353 Ga0070669_100013344 Ga0070669_1000133444 390
324 3300005354 Ga0070675_100000111 Ga0070675_10000011113 390
325 3300005366 Ga0070659_100000002 Ga0070659_100000002329 390
326 3300005366 Ga0070659_100038648 Ga0070659_1000386483 390
327 3300005367 Ga0070667_100009407 Ga0070667_1000094075 390
328 3300005435 Ga0070714_100003420 Ga0070714_10000342011 390
329 3300005435 Ga0070714_100030746 Ga0070714_1000307463 390
330 3300005435 Ga0070714_100148679 Ga0070714_1001486792 390
331 3300005436 Ga0070713_100000390 Ga0070713_10000039010 390
332 3300005437 Ga0070710_10000006 Ga0070710_1000000697 390
333 3300005471 Ga0070698_100002059 Ga0070698_1000020594 390
334 3300005530 Ga0070679_100009133 Ga0070679_1000091334 390
335 3300005535 Ga0070684_100011369 Ga0070684_1000113693 390
336 3300005543 Ga0070672_100000015 Ga0070672_10000001521 390
337 3300005548 Ga0070665_100217255 Ga0070665_1002172551 390
338 3300005578 Ga0068854_100000183 Ga0068854_10000018327 390
339 3300005614 Ga0068856_100000757 Ga0068856_1000007574 390
340 3300005616 Ga0068852_100000093 Ga0068852_1000000939 390
341 3300005834 Ga0068851_10011784 Ga0068851_100117843 390
342 3300005841 Ga0068863_100003824 Ga0068863_1000038242 390
343 3300005841 Ga0068863_100023158 Ga0068863_1000231584 390
344 3300005983 Ga0081540_1000049 Ga0081540_100004952 390
345 3300005985 Ga0081539_10040313 Ga0081539_100403132 390
346 3300006028 Ga0070717_10000005 Ga0070717_10000005161 390
347 3300006038 Ga0075365_10059039 Ga0075365_100590392 390
348 3300006042 Ga0075368_10049932 Ga0075368_100499322 390
349 3300006042 Ga0075368_10067331 Ga0075368_100673312 390
350 3300006048 Ga0075363_100021867 Ga0075363_1000218672 390
351 3300006051 Ga0075364_10008289 Ga0075364_100082894 390
352 3300006051 Ga0075364_10008329 Ga0075364_100083295 390
353 3300006175 Ga0070712_100008485 Ga0070712_1000084855 390
354 3300006177 Ga0075362_10003323 Ga0075362_100033232 390
355 3300006178 Ga0075367_10012558 Ga0075367_100125583 390
356 3300006353 Ga0075370_10000475 Ga0075370_1000047511 390
357 3300006353 Ga0075370_10001223 Ga0075370_100012232 390
358 3300006880 Ga0075429_100003759 Ga0075429_1000037597 390
359 3300006881 Ga0068865_100001277 Ga0068865_1000012775 390
360 3300009093 Ga0105240_10108860 Ga0105240_101088603 390
361 3300009094 Ga0111539_10099425 Ga0111539_100994252 390
362 3300009098 Ga0105245_10001831 Ga0105245_100018319 390
363 3300009098 Ga0105245_10024675 Ga0105245_100246752 390
364 3300009177 Ga0105248_10000008 Ga0105248_10000008360 390
365 3300010375 Ga0105239_10056910 Ga0105239_100569104 390
366 3300010375 Ga0105239_10073144 Ga0105239_100731442 390
367 3300011119 Ga0105246_10008649 Ga0105246_100086495 390
368 3300013104 Ga0157370_10073477 Ga0157370_100734774 390
369 3300013105 Ga0157369_10000110 Ga0157369_10000110102 390
370 3300013296 Ga0157374_10165305 Ga0157374_101653052 390
371 3300013297 Ga0157378_10042428 Ga0157378_100424282 390
372 3300013306 Ga0163162_10482755 Ga0163162_104827551 390
373 3300013307 Ga0157372_10001384 Ga0157372_1000138418 390
374 3300013308 Ga0157375_10039653 Ga0157375_100396532 390
375 3300014326 Ga0157380_10000843 Ga0157380_1000084311 390
376 3300014969 Ga0157376_10064613 Ga0157376_100646132 390
377 3300025321 Ga0207656_10002156 Ga0207656_100021562 390
378 3300025321 Ga0207656_10002232 Ga0207656_100022324 390
379 3300025898 Ga0207692_10000001 Ga0207692_10000001134 390
380 3300025909 Ga0207705_10050406 Ga0207705_100504062 390
381 3300025913 Ga0207695_10226847 Ga0207695_102268471 390
382 3300025915 Ga0207693_10006065 Ga0207693_100060657 390
383 3300025916 Ga0207663_10079161 Ga0207663_100791612 390
384 3300025920 Ga0207649_10004012 Ga0207649_100040127 390
385 3300025922 Ga0207646_10287884 Ga0207646_102878841 390
386 3300025923 Ga0207681_10008037 Ga0207681_100080374 390
387 3300025925 Ga0207650_10040316 Ga0207650_100403162 390
388 3300025926 Ga0207659_10000010 Ga0207659_10000010110 390
389 3300025927 Ga0207687_10000007 Ga0207687_10000007378 390
390 3300025927 Ga0207687_10002454 Ga0207687_1000245411 390
391 3300025928 Ga0207700_10000027 Ga0207700_10000027105 390
392 3300025929 Ga0207664_10000529 Ga0207664_1000052911 390
393 3300025929 Ga0207664_10012473 Ga0207664_100124731 390
394 3300025929 Ga0207664_10125303 Ga0207664_101253032 390
395 3300025932 Ga0207690_10000088 Ga0207690_1000008840 390
396 3300025936 Ga0207670_10020188 Ga0207670_100201883 390
397 3300025938 Ga0207704_10000093 Ga0207704_1000009340 390
398 3300025940 Ga0207691_10000044 Ga0207691_1000004446 390
399 3300025941 Ga0207711_10000006 Ga0207711_10000006754 390
400 3300025944 Ga0207661_10010771 Ga0207661_100107714 390
401 3300025944 Ga0207661_10087624 Ga0207661_100876242 390
402 3300025981 Ga0207640_10000200 Ga0207640_1000020011 390
403 3300025986 Ga0207658_10003525 Ga0207658_100035252 390
404 3300026023 Ga0207677_10003263 Ga0207677_100032633 390
405 3300026067 Ga0207678_10014283 Ga0207678_100142834 390
406 3300026078 Ga0207702_10000060 Ga0207702_1000006029 390
407 3300026078 Ga0207702_10061229 Ga0207702_100612292 390
408 3300026142 Ga0207698_10000440 Ga0207698_1000044015 390
409 3300027866 Ga0209813_10002809 Ga0209813_100028093 390
410 3300027866 Ga0209813_10030764 Ga0209813_100307642 390
411 3300028379 Ga0268266_10000285 Ga0268266_100002854 390
412 3300028379 Ga0268266_10005034 Ga0268266_100050347 390
413 3300028558 Ga0265326_10000003 Ga0265326_1000000355 390
414 3300028563 Ga0265319_1000664 Ga0265319_10006644 390
415 3300028666 Ga0265336_10004622 Ga0265336_100046223 390
416 3300028800 Ga0265338_10000844 Ga0265338_1000084418 390
417 3300029957 Ga0265324_10001900 Ga0265324_100019005 390
418 3300031995 Ga0307409_100033771 Ga0307409_1000337712 390
419 3300032004 Ga0307414_10061438 Ga0307414_100614382 390
420 3300032126 Ga0307415_100003742 Ga0307415_1000037423 390
421 3300037418 Ga0395900_0092948 Ga0395900_0092948_365_1582 390
422 3300037466 Ga0395898_0004969 Ga0395898_0004969_10740_11954 390
423 3300044842 Ga0466957_0021361 Ga0466957_0021361_2541_3749 390
424 3300044901 Ga0466960_0000222 Ga0466960_0000222_40_1254 390
425 3300045976 Ga0466967_0050219 Ga0466967_0050219_295_1602 390
426 3300045976 Ga0466967_0055985 Ga0466967_0055985_2019_3233 390
427 3300045976 Ga0466967_0082168 Ga0466967_0082168_276_1487 390
428 3300046459 Ga0495629_0005201 Ga0495629_0005201_34_1239 390
429 3300046475 Ga0495639_0084345 Ga0495639_0084345_66_1277 390
430 3300046507 Ga0495606_0000565 Ga0495606_0000565_43572_44777 390
431 3300046511 Ga0495608_0000068 Ga0495608_0000068_69890_71095 390
432 3300046517 Ga0495630_0000056 Ga0495630_0000056_80750_81955 390
433 3300046674 Ga0495588_0000165 Ga0495588_0000165_9307_10512 390
434 3300046675 Ga0495657_0000004 Ga0495657_0000004_113639_114844 390
435 3300046681 Ga0495647_0000018 Ga0495647_0000018_12733_13938 390
436 3300046689 Ga0495613_0000179 Ga0495613_0000179_13067_14272 390
437 3300046690 Ga0495624_0000008 Ga0495624_0000008_138017_139222 390
438 3300046690 Ga0495624_0000073 Ga0495624_0000073_46345_47550 390
439 3300046809 Ga0495600_0016433 Ga0495600_0016433_471_1676 390
440 3300047317 Ga0495604_0000357 Ga0495604_0000357_7188_8393 390
441 3300047317 Ga0495604_0167644 Ga0495604_0167644_157_1362 390
442 3300047321 Ga0495676_0038541 Ga0495676_0038541_2115_3320 390
443 3300047444 Ga0495675_0000175 Ga0495675_0000175_45322_46527 390
444 3300047673 Ga0495593_0061865 Ga0495593_0061865_605_1810 390
445 3300048088 Ga0495602_0002588 Ga0495602_0002588_7886_9091 390
446 3300048903 Ga0496100_0000018 Ga0496100_0000018_139407_140612 390
447 3300048903 Ga0496100_0003651 Ga0496100_0003651_3588_4805 390
448 3300048904 Ga0496101_0000062 Ga0496101_0000062_52615_53820 390
449 3300048904 Ga0496101_0004877 Ga0496101_0004877_3997_5214 390
450 3300048905 Ga0496102_0010620 Ga0496102_0010620_3673_4884 390
451 3300048909 Ga0496106_0000122 Ga0496106_0000122_58589_59794 390
452 3300048910 Ga0496107_0000006 Ga0496107_0000006_208330_209535 390
453 3300048910 Ga0496107_0019934 Ga0496107_0019934_1850_3061 390
454 3300048911 Ga0496108_0000062 Ga0496108_0000062_114580_115785 390
455 3300048911 Ga0496108_0009387 Ga0496108_0009387_5389_6606 390
456 3300048912 Ga0496109_0000121 Ga0496109_0000121_67660_68865 390
457 3300048912 Ga0496109_0000129 Ga0496109_0000129_66893_68101 390
458 3300048913 Ga0496110_0000089 Ga0496110_0000089_78_1286 390
459 3300048914 Ga0496111_0076543 Ga0496111_0076543_85_1290 390
460 3300048914 Ga0496111_0182051 Ga0496111_0182051_92_1309 390
461 3300048915 Ga0496112_0001770 Ga0496112_0001770_9935_11143 390
462 3300048916 Ga0496113_0000628 Ga0496113_0000628_6618_7826 390
463 3300048916 Ga0496113_0021542 Ga0496113_0021542_348_1562 390
464 3300048919 Ga0496116_0001565 Ga0496116_0001565_12554_13765 390
465 3300048921 Ga0496118_0000818 Ga0496118_0000818_35704_36915 390
466 3300048922 Ga0496119_0052566 Ga0496119_0052566_1057_2268 390
467 3300048923 Ga0496120_0007169 Ga0496120_0007169_6965_8176 390
468 3300048924 Ga0496121_0006714 Ga0496121_0006714_7755_8966 390
469 3300048924 Ga0496121_0062775 Ga0496121_0062775_140_1354 390
470 3300048928 Ga0496125_0007232 Ga0496125_0007232_2197_3408 390
471 3300049569 Ga0501032_0051764 Ga0501032_0051764_700_1911 390
472 3300049571 Ga0501034_0066247 Ga0501034_0066247_166_1377 390
473 3300049572 Ga0501036_0024665 Ga0501036_0024665_2234_3445 390
474 3300049574 Ga0501038_0112865 Ga0501038_0112865_123_1343 390
475 3300049578 Ga0501042_0119524 Ga0501042_0119524_68_1279 390
476 3300049580 Ga0501046_0000799 Ga0501046_0000799_28233_29444 390
477 3300049581 Ga0501047_0067942 Ga0501047_0067942_1175_2386 390
478 3300049581 Ga0501047_0127282 Ga0501047_0127282_160_1371 390
479 3300049581 Ga0501047_0360799 Ga0501047_0360799_37_1257 390
480 3300049582 Ga0501048_0196308 Ga0501048_0196308_52_1263 390
481 3300049583 Ga0501067_0006652 Ga0501067_0006652_4583_5803 390
482 3300049584 Ga0501068_0166982 Ga0501068_0166982_112_1323 390
483 3300049585 Ga0501069_0022967 Ga0501069_0022967_2048_3259 390
484 3300049585 Ga0501069_0076805 Ga0501069_0076805_184_1398 390
485 3300049586 Ga0501070_0000651 Ga0501070_0000651_2165_3376 390
486 3300049586 Ga0501070_0149318 Ga0501070_0149318_585_1796 390
487 3300049586 Ga0501070_0152198 Ga0501070_0152198_587_1807 390
488 3300049589 Ga0501073_0003023 Ga0501073_0003023_4213_5433 390
489 3300049590 Ga0501074_0007354 Ga0501074_0007354_625_1845 390
490 3300049590 Ga0501074_0022863 Ga0501074_0022863_1549_2760 390
491 3300049822 Ga0501035_0035100 Ga0501035_0035100_2165_3376 390
492 3300049822 Ga0501035_0051830 Ga0501035_0051830_1258_2469 390
493 3300049823 Ga0501044_0039969 Ga0501044_0039969_1204_2415 390
494 3300049823 Ga0501044_0097462 Ga0501044_0097462_1570_2781 390
495 3300050490 nmdc:mga03n38_16770_c1 nmdc:mga03n38_16770_c1_1582_2796 390
496 3300050491 nmdc:mga00v17_41493_c1 nmdc:mga00v17_41493_c1_1474_2688 390
497 3300050491 nmdc:mga00v17_96767_c1 nmdc:mga00v17_96767_c1_329_1543 390
498 3300050492 nmdc:mga0yw44_39718_c1 nmdc:mga0yw44_39718_c1_800_2014 390
499 3300050495 nmdc:mga04h51_8902_c1 nmdc:mga04h51_8902_c1_1259_2473 390
500 3300050496 nmdc:mga07m45_14203_c1 nmdc:mga07m45_14203_c1_2934_4148 390
501 3300050508 nmdc:mga09592_12744_c1 nmdc:mga09592_12744_c1_2741_3955 390
502 3300053077 Ga0495601_0000013 Ga0495601_0000013_92206_93411 390
503 3300053084 Ga0495595_0000003 Ga0495595_0000003_113639_114844 390
504 3300053084 Ga0495595_0031516 Ga0495595_0031516_1051_2256 390
505 3300053085 Ga0495619_0000031 Ga0495619_0000031_87208_88416 390
506 3300053085 Ga0495619_0000257 Ga0495619_0000257_54_1259 390
507 3300053088 Ga0500644_0000541 Ga0500644_0000541_10074_11288 390
508 3300053094 Ga0500566_0098016 Ga0500566_0098016_48_1259 390
509 3300060353 Ga0501082_0033473 Ga0501082_0033473_1590_2801 390
510 3300060353 Ga0501082_0101790 Ga0501082_0101790_122_1342 390
511 3300061719 Ga0466962_0061612 Ga0466962_0061612_29_1246 390
512 3300005458 Ga0070681_10025949 Ga0070681_100259491 391
513 3300005530 Ga0070679_100000068 Ga0070679_10000006828 391
514 3300005547 Ga0070693_100001745 Ga0070693_1000017451 391
515 3300005548 Ga0070665_100000106 Ga0070665_10000010680 391
516 3300005842 Ga0068858_100000009 Ga0068858_100000009237 391
517 3300005843 Ga0068860_100000400 Ga0068860_10000040040 391
518 3300006038 Ga0075365_10003743 Ga0075365_100037437 391
519 3300009098 Ga0105245_10001895 Ga0105245_1000189510 391
520 3300009176 Ga0105242_10038851 Ga0105242_100388512 391
521 3300013297 Ga0157378_10031281 Ga0157378_100312814 391
522 3300025912 Ga0207707_10011031 Ga0207707_100110315 391
523 3300025917 Ga0207660_10013455 Ga0207660_100134553 391
524 3300025921 Ga0207652_10000044 Ga0207652_1000004430 391
525 3300025927 Ga0207687_10001023 Ga0207687_100010237 391
526 3300026035 Ga0207703_10000023 Ga0207703_10000023142 391
527 3300026041 Ga0207639_10027752 Ga0207639_100277522 391
528 3300026078 Ga0207702_10003333 Ga0207702_100033332 391
529 3300028379 Ga0268266_10000047 Ga0268266_10000047232 391
530 3300032002 Ga0307416_100193848 Ga0307416_1001938481 391
531 3300032126 Ga0307415_100041426 Ga0307415_1000414262 391
532 3300036401 Ga0373937_0022173 Ga0373937_0022173_3046_4266 391
533 3300044684 Ga0466966_0016687 Ga0466966_0016687_47_1264 391
534 3300044765 Ga0466970_0153435 Ga0466970_0153435_31_1248 391
535 3300044901 Ga0466960_0002576 Ga0466960_0002576_2756_3973 391
536 3300046454 Ga0495592_0101174 Ga0495592_0101174_748_1959 391
537 3300046454 Ga0495592_0132251 Ga0495592_0132251_500_1720 391
538 3300046461 Ga0495641_0000874 Ga0495641_0000874_13631_14851 391
539 3300046462 Ga0495651_0119930 Ga0495651_0119930_65_1285 391
540 3300046463 Ga0495653_0035665 Ga0495653_0035665_641_1855 391
541 3300046516 Ga0495628_0123099 Ga0495628_0123099_754_1974 391
542 3300046517 Ga0495630_0064261 Ga0495630_0064261_58_1278 391
543 3300046529 Ga0495652_0004685 Ga0495652_0004685_10133_11353 391
544 3300046543 Ga0495645_0002246 Ga0495645_0002246_9865_11082 391
545 3300046543 Ga0495645_0162027 Ga0495645_0162027_12_1232 391
546 3300046642 Ga0495634_0007615 Ga0495634_0007615_626_1846 391
547 3300046678 Ga0495599_0013295 Ga0495599_0013295_996_2216 391
548 3300046694 Ga0495649_0000751 Ga0495649_0000751_62_1282 391
549 3300047322 Ga0495680_0000496 Ga0495680_0000496_5824_7044 391
550 3300048907 Ga0496104_0000650 Ga0496104_0000650_20807_22015 391
551 3300048908 Ga0496105_0000347 Ga0496105_0000347_9712_10920 391
552 3300048908 Ga0496105_0082806 Ga0496105_0082806_1114_2340 391
553 3300048913 Ga0496110_0032801 Ga0496110_0032801_87_1307 391
554 3300048914 Ga0496111_0147610 Ga0496111_0147610_410_1630 391
555 3300048917 Ga0496114_0045004 Ga0496114_0045004_214_1440 391
556 3300049569 Ga0501032_0014608 Ga0501032_0014608_1726_2940 391
557 3300049571 Ga0501034_0024940 Ga0501034_0024940_811_2028 391
558 3300049578 Ga0501042_0007948 Ga0501042_0007948_931_2145 391
559 3300049582 Ga0501048_0017290 Ga0501048_0017290_4020_5234 391
560 3300049586 Ga0501070_0215519 Ga0501070_0215519_183_1397 391
561 3300049588 Ga0501072_0008263 Ga0501072_0008263_5385_6599 391
562 3300049590 Ga0501074_0097880 Ga0501074_0097880_276_1490 391
563 3300049592 Ga0501076_0062993 Ga0501076_0062993_381_1595 391
564 3300049593 Ga0501077_0017179 Ga0501077_0017179_1187_2401 391
565 3300049741 Ga0501079_0009411 Ga0501079_0009411_4481_5695 391
566 3300049743 Ga0501081_0055694 Ga0501081_0055694_953_2167 391
567 3300050492 nmdc:mga0yw44_13510_c1 nmdc:mga0yw44_13510_c1_985_2199 391
568 3300053077 Ga0495601_0000124 Ga0495601_0000124_2859_4079 391
569 3300053123 Ga0500614_012010 Ga0500614_012010_604_1824 391
570 3300053140 Ga0500573_0043434 Ga0500573_0043434_1051_2268 391
571 3300061734 Ga0530510_0073683 Ga0530510_0073683_237_1451 391
572 3300001977 JGI24746J21847_1000677 JGI24746J21847_10006773 392
573 3300005329 Ga0070683_100002592 Ga0070683_1000025926 392
574 3300025944 Ga0207661_10001262 Ga0207661_1000126210 392
575 3300044656 Ga0466969_0040728 Ga0466969_0040728_559_1794 392
576 3300044684 Ga0466966_0089662 Ga0466966_0089662_24_1262 392
577 3300044693 Ga0466961_0016137 Ga0466961_0016137_2925_4166 392
578 3300044842 Ga0466957_0019515 Ga0466957_0019515_407_1648 392
579 3300045049 Ga0466959_0057183 Ga0466959_0057183_506_1747 392
580 3300048905 Ga0496102_0183577 Ga0496102_0183577_94_1332 392
581 3300048908 Ga0496105_0033730 Ga0496105_0033730_858_2096 392
582 3300053078 Ga0495612_0001051 Ga0495612_0001051_73_1296 392
583 3300061719 Ga0466962_0002335 Ga0466962_0002335_6633_7874 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

253

405

0.96

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

140

237

0.96

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

269

394

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r7k-assembly1.cif.gz_D crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196 0.7876 7 383
2vig-assembly2.cif.gz_G crystal structure of human short-chain acyl coa dehydrogenase 0.7831 6 384
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.7811 6 384
4u83-assembly2.cif.gz_D structure of brucella abortus butyryl-coa dehydrogenase 0.7808 3 382
2vig-assembly1.cif.gz_B crystal structure of human short-chain acyl coa dehydrogenase 0.7797 6 384
ID Description Score Start End Superfamily
af_P95186_131_245_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9436 133 246 2.40.110.10
4x28B02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9286 131 237 2.40.110.10
af_P95186_131_245_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.928 133 246 2.40.110.10
4irnA02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9236 132 237 2.40.110.10
4n5fB02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9173 132 237 2.40.110.10
ID Description Score Start End GO Terms
AF-A0A399V9H6-F1-model_v4 deleted 0.9264 2 312
AF-A0A399V9H6-F1-model_v4 deleted 0.9236 2 312
AF-X1A816-F1-model_v4 Acyl-CoA oxidase/dehydrogenase middle domain-containing protein 0.8987 106 231 GO:0003995
GO:0050660
AF-A0A164IIM7-F1-model_v4 Putative Isovaleryl-CoA dehydrogenase 0.8951 106 238 GO:0003995
GO:0050660
AF-A0A6A8AS54-F1-model_v4 Acyl-CoA dehydrogenase 0.8919 126 247 GO:0003995

Feature Viewer

pLDDT pTM Quality
78.34 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map