F466248
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 319 | 566 | 392 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100052576|Ga0070714_1000525762 |
| Length | 413 |
| Sequence | MPINLETPKKFNQLISQAHQVAAEILRPNSRKYDTLEHEYPKELDMLAAAIDGLNEGGALGGAGAGAVGTNGSSPATKKKADEGANRNGSNMASLVGLIEMCWGDVGLLLAMPRQGLGQAAIAAVANEEQLQRFGGKWAAMAITEPEAGSDSAAIRTTATLDEATGDYILNGEKIFVTSGDRAELIVVWATLDRSQGRAAIKSFVVERDNPGLKLDRLEHKLGIRASDTANFVLQDCRVPKENLLGSPEIAPKGGFSGVMQTFDNTRPLVAGMAIGVARACLEDTRDHLQSAGIEIDYNLPPHLQSAAAAEFIAMEADWEAARLLTLQAAWMADNKKPNSLQASMAKAKAGRMGTEIALRCVALCGATGFGEGELMEKWARDAKILDLFEGTQQIQLLIIARQLLGKTSAELK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 2 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 3 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 4 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 5 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 6 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 7 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 8 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 9 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 10 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 11 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 12 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 13 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 14 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 15 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 16 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 17 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 18 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 181 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 182 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 183 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 188 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 189 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 190 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 191 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 192 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 193 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 194 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 195 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 196 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 263 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 264 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 265 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 311 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 312 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 313 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 314 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.91 |
| Metatranscriptomes | 0.17 |
| Isolates | 2.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.83 |
| Nodule | 0 |
| Rhizoplane | 7.38 |
| Rhizosphere | 79.25 |
| Stem | 0 |
| Stem Tuber | 0.17 |
| Unclassified | 7.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000677 | 3300001977 | Bacteria | 5215 |
| 2 | JGI24740J21852_10026424 | 3300001979 | Bacteria | 1945 |
| 3 | JGI24739J22299_10022631 | 3300001989 | Bacteria | 2228 |
| 4 | JGI24735J21928_10015421 | 3300002067 | Bacteria | 2384 |
| 5 | JGI24748J21848_1000895 | 3300002074 | Bacteria | 3227 |
| 6 | JGI24034J26672_10000136 | 3300002239 | Bacteria | 10868 |
| 7 | JGI25406J46586_10001784 | 3300003203 | Bacteria | 10117 |
| 8 | Ga0070658_10006849 | 3300005327 | Bacteria | 9212 |
| 9 | Ga0070658_10038129 | 3300005327 | Bacteria | 3876 |
| 10 | Ga0070658_10088812 | 3300005327 | Bacteria | 2545 |
| 11 | Ga0070683_100000641 | 3300005329 | Bacteria | 25186 |
| 12 | Ga0070683_100002592 | 3300005329 | Bacteria | 14452 |
| 13 | Ga0070683_100019348 | 3300005329 | Bacteria | 6046 |
| 14 | Ga0070683_100045129 | 3300005329 | Bacteria | 4068 |
| 15 | Ga0070683_100240051 | 3300005329 | Bacteria | 1723 |
| 16 | Ga0070666_10016832 | 3300005335 | Bacteria | 4681 |
| 17 | Ga0070682_100000117 | 3300005337 | Bacteria | 69662 |
| 18 | Ga0070682_100001006 | 3300005337 | Bacteria | 16317 |
| 19 | Ga0070682_100047031 | 3300005337 | Bacteria | 2680 |
| 20 | Ga0068868_100000878 | 3300005338 | Bacteria | 20396 |
| 21 | Ga0070660_100002223 | 3300005339 | Bacteria | 13368 |
| 22 | Ga0070660_100051008 | 3300005339 | Bacteria | 3185 |
| 23 | Ga0070689_100114918 | 3300005340 | Bacteria | 2145 |
| 24 | Ga0070661_100001375 | 3300005344 | Bacteria | 16996 |
| 25 | Ga0070661_100013239 | 3300005344 | Bacteria | 5789 |
| 26 | Ga0070692_10000576 | 3300005345 | Bacteria | 11521 |
| 27 | Ga0070692_10001979 | 3300005345 | Bacteria | 7760 |
| 28 | Ga0070668_100012580 | 3300005347 | Bacteria | 6302 |
| 29 | Ga0070669_100013344 | 3300005353 | Bacteria | 5840 |
| 30 | Ga0070675_100000111 | 3300005354 | Bacteria | 47699 |
| 31 | Ga0070675_100041648 | 3300005354 | Bacteria | 3751 |
| 32 | Ga0070671_100106756 | 3300005355 | Bacteria | 2351 |
| 33 | Ga0070673_100001567 | 3300005364 | Bacteria | 13472 |
| 34 | Ga0070673_100011909 | 3300005364 | Bacteria | 5957 |
| 35 | Ga0070659_100000002 | 3300005366 | Bacteria | 369239 |
| 36 | Ga0070659_100004130 | 3300005366 | Bacteria | 10350 |
| 37 | Ga0070659_100038648 | 3300005366 | Bacteria | 3723 |
| 38 | Ga0070667_100009407 | 3300005367 | Bacteria | 8107 |
| 39 | Ga0070714_100000019 | 3300005435 | Bacteria | 169455 |
| 40 | Ga0070714_100003420 | 3300005435 | Bacteria | 11825 |
| 41 | Ga0070714_100023646 | 3300005435 | Bacteria | 5052 |
| 42 | Ga0070714_100030746 | 3300005435 | Bacteria | 4473 |
| 43 | Ga0070714_100052576 | 3300005435 | Bacteria | 3474 |
| 44 | Ga0070714_100148679 | 3300005435 | Bacteria | 2109 |
| 45 | Ga0070713_100000390 | 3300005436 | Bacteria | 28149 |
| 46 | Ga0070713_100057834 | 3300005436 | Bacteria | 3230 |
| 47 | Ga0070710_10000006 | 3300005437 | Bacteria | 217422 |
| 48 | Ga0070700_100011326 | 3300005441 | Bacteria | 4936 |
| 49 | Ga0070663_100036165 | 3300005455 | Bacteria | 3430 |
| 50 | Ga0070678_100183974 | 3300005456 | Bacteria | 1713 |
| 51 | Ga0070662_100001863 | 3300005457 | Bacteria | 12915 |
| 52 | Ga0070681_10025949 | 3300005458 | Bacteria | 5891 |
| 53 | Ga0068867_100145468 | 3300005459 | Bacteria | 1857 |
| 54 | Ga0070698_100002059 | 3300005471 | Bacteria | 22349 |
| 55 | Ga0070679_100000068 | 3300005530 | Bacteria | 77184 |
| 56 | Ga0070679_100007291 | 3300005530 | Bacteria | 10328 |
| 57 | Ga0070679_100009133 | 3300005530 | Bacteria | 9358 |
| 58 | Ga0070684_100002845 | 3300005535 | Bacteria | 12858 |
| 59 | Ga0070684_100006126 | 3300005535 | Bacteria | 9269 |
| 60 | Ga0070684_100011369 | 3300005535 | Bacteria | 7089 |
| 61 | Ga0068853_100037768 | 3300005539 | Bacteria | 4111 |
| 62 | Ga0070672_100000015 | 3300005543 | Bacteria | 72591 |
| 63 | Ga0070672_100010387 | 3300005543 | Bacteria | 6458 |
| 64 | Ga0070686_100047303 | 3300005544 | Bacteria | 2720 |
| 65 | Ga0070693_100001745 | 3300005547 | Bacteria | 9896 |
| 66 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 67 | Ga0070665_100001502 | 3300005548 | Bacteria | 27146 |
| 68 | Ga0070665_100008940 | 3300005548 | Bacteria | 10150 |
| 69 | Ga0070665_100217255 | 3300005548 | Bacteria | 1912 |
| 70 | Ga0070664_100034103 | 3300005564 | Bacteria | 4269 |
| 71 | Ga0070664_100306580 | 3300005564 | Bacteria | 1436 |
| 72 | Ga0068857_100005857 | 3300005577 | Bacteria | 10494 |
| 73 | Ga0068857_100027364 | 3300005577 | Bacteria | 5031 |
| 74 | Ga0068857_100193749 | 3300005577 | Bacteria | 1851 |
| 75 | Ga0068854_100000183 | 3300005578 | Bacteria | 42525 |
| 76 | Ga0068856_100000757 | 3300005614 | Bacteria | 35080 |
| 77 | Ga0068856_100033907 | 3300005614 | Bacteria | 4999 |
| 78 | Ga0070702_100033692 | 3300005615 | Bacteria | 2819 |
| 79 | Ga0070702_100055460 | 3300005615 | Bacteria | 2285 |
| 80 | Ga0068852_100000093 | 3300005616 | Bacteria | 60834 |
| 81 | Ga0068852_100057097 | 3300005616 | Bacteria | 3376 |
| 82 | Ga0068864_100000053 | 3300005618 | Bacteria | 133049 |
| 83 | Ga0068864_100003161 | 3300005618 | Bacteria | 13614 |
| 84 | Ga0068851_10011784 | 3300005834 | Bacteria | 4107 |
| 85 | Ga0068851_10027612 | 3300005834 | Bacteria | 2798 |
| 86 | Ga0068863_100003824 | 3300005841 | Bacteria | 14883 |
| 87 | Ga0068863_100023158 | 3300005841 | Bacteria | 5935 |
| 88 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 89 | Ga0068858_100000091 | 3300005842 | Bacteria | 93802 |
| 90 | Ga0068860_100000400 | 3300005843 | Bacteria | 56882 |
| 91 | Ga0068860_100055881 | 3300005843 | Bacteria | 3753 |
| 92 | Ga0081455_10000112 | 3300005937 | Bacteria | 92158 |
| 93 | Ga0081455_10028530 | 3300005937 | Bacteria | 5099 |
| 94 | Ga0081455_10089101 | 3300005937 | Bacteria | 2505 |
| 95 | Ga0081540_1000049 | 3300005983 | Bacteria | 127322 |
| 96 | Ga0081539_10000086 | 3300005985 | Bacteria | 217801 |
| 97 | Ga0081539_10002609 | 3300005985 | Bacteria | 24708 |
| 98 | Ga0081539_10040313 | 3300005985 | Bacteria | 2742 |
| 99 | Ga0070717_10000005 | 3300006028 | Bacteria | 357819 |
| 100 | Ga0070717_10000352 | 3300006028 | Bacteria | 29608 |
| 101 | Ga0070717_10038928 | 3300006028 | Bacteria | 3866 |
| 102 | Ga0070717_10083720 | 3300006028 | Bacteria | 2683 |
| 103 | Ga0075365_10003743 | 3300006038 | Bacteria | 7914 |
| 104 | Ga0075365_10044988 | 3300006038 | Bacteria | 2895 |
| 105 | Ga0075365_10059039 | 3300006038 | Bacteria | 2555 |
| 106 | Ga0075365_10145185 | 3300006038 | Bacteria | 1648 |
| 107 | Ga0075365_10150161 | 3300006038 | Bacteria | 1621 |
| 108 | Ga0075368_10049932 | 3300006042 | Bacteria | 1660 |
| 109 | Ga0075368_10067331 | 3300006042 | Bacteria | 1441 |
| 110 | Ga0075363_100000378 | 3300006048 | Bacteria | 13459 |
| 111 | Ga0075363_100021867 | 3300006048 | Bacteria | 3228 |
| 112 | Ga0075364_10008289 | 3300006051 | Bacteria | 6207 |
| 113 | Ga0075364_10008329 | 3300006051 | Bacteria | 6191 |
| 114 | Ga0070712_100000007 | 3300006175 | Bacteria | 157653 |
| 115 | Ga0070712_100002695 | 3300006175 | Bacteria | 10963 |
| 116 | Ga0070712_100008485 | 3300006175 | Bacteria | 6466 |
| 117 | Ga0075362_10003323 | 3300006177 | Bacteria | 5605 |
| 118 | Ga0075367_10012558 | 3300006178 | Bacteria | 4523 |
| 119 | Ga0075370_10000475 | 3300006353 | Bacteria | 15085 |
| 120 | Ga0075370_10001223 | 3300006353 | Bacteria | 10870 |
| 121 | Ga0075428_100121351 | 3300006844 | Bacteria | 2846 |
| 122 | Ga0075430_100012368 | 3300006846 | Bacteria | 7259 |
| 123 | Ga0075429_100003759 | 3300006880 | Bacteria | 12941 |
| 124 | Ga0068865_100001277 | 3300006881 | Bacteria | 14651 |
| 125 | Ga0068865_100039288 | 3300006881 | Bacteria | 3209 |
| 126 | Ga0105240_10108860 | 3300009093 | Bacteria | 3356 |
| 127 | Ga0111539_10099425 | 3300009094 | Bacteria | 3416 |
| 128 | Ga0111539_10364164 | 3300009094 | Bacteria | 1683 |
| 129 | Ga0105245_10001831 | 3300009098 | Bacteria | 19354 |
| 130 | Ga0105245_10001895 | 3300009098 | Bacteria | 18997 |
| 131 | Ga0105245_10024675 | 3300009098 | Bacteria | 5282 |
| 132 | Ga0105245_10039587 | 3300009098 | Bacteria | 4196 |
| 133 | Ga0105245_10050223 | 3300009098 | Bacteria | 3736 |
| 134 | Ga0105245_10099935 | 3300009098 | Bacteria | 2683 |
| 135 | Ga0105245_10205720 | 3300009098 | Bacteria | 1892 |
| 136 | Ga0114129_10371161 | 3300009147 | Bacteria | 1891 |
| 137 | Ga0105243_10002147 | 3300009148 | Bacteria | 16657 |
| 138 | Ga0105243_10009602 | 3300009148 | Bacteria | 7367 |
| 139 | Ga0105243_10154308 | 3300009148 | Bacteria | 1973 |
| 140 | Ga0105242_10002368 | 3300009176 | Bacteria | 14878 |
| 141 | Ga0105242_10038851 | 3300009176 | Bacteria | 3830 |
| 142 | Ga0105242_10219474 | 3300009176 | Bacteria | 1698 |
| 143 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 144 | Ga0105248_10270004 | 3300009177 | Bacteria | 1915 |
| 145 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 146 | Ga0105249_10109885 | 3300009553 | Bacteria | 2604 |
| 147 | Ga0105249_10113743 | 3300009553 | Bacteria | 2561 |
| 148 | Ga0105249_10148463 | 3300009553 | Bacteria | 2254 |
| 149 | Ga0105239_10050812 | 3300010375 | Bacteria | 4545 |
| 150 | Ga0105239_10056910 | 3300010375 | Bacteria | 4289 |
| 151 | Ga0105239_10073144 | 3300010375 | Bacteria | 3768 |
| 152 | Ga0105239_10102334 | 3300010375 | Bacteria | 3170 |
| 153 | Ga0105246_10001248 | 3300011119 | Bacteria | 14931 |
| 154 | Ga0105246_10008649 | 3300011119 | Bacteria | 6260 |
| 155 | Ga0105246_10132755 | 3300011119 | Bacteria | 1862 |
| 156 | Ga0157371_10072030 | 3300013102 | Bacteria | 2447 |
| 157 | Ga0157370_10073477 | 3300013104 | Bacteria | 3226 |
| 158 | Ga0157369_10000110 | 3300013105 | Bacteria | 115514 |
| 159 | Ga0157374_10165305 | 3300013296 | Bacteria | 2156 |
| 160 | Ga0157374_10523449 | 3300013296 | Bacteria | 1192 |
| 161 | Ga0157378_10031281 | 3300013297 | Bacteria | 4701 |
| 162 | Ga0157378_10042428 | 3300013297 | Bacteria | 4038 |
| 163 | Ga0163162_10032523 | 3300013306 | Bacteria | 5182 |
| 164 | Ga0163162_10133134 | 3300013306 | Bacteria | 2596 |
| 165 | Ga0163162_10482755 | 3300013306 | Bacteria | 1371 |
| 166 | Ga0157372_10001384 | 3300013307 | Bacteria | 26176 |
| 167 | Ga0157372_10003488 | 3300013307 | Bacteria | 16951 |
| 168 | Ga0157375_10026372 | 3300013308 | Bacteria | 5413 |
| 169 | Ga0157375_10039653 | 3300013308 | Bacteria | 4535 |
| 170 | Ga0157380_10000843 | 3300014326 | Bacteria | 19177 |
| 171 | Ga0157377_10024159 | 3300014745 | Bacteria | 3228 |
| 172 | Ga0157379_10159632 | 3300014968 | Bacteria | 2035 |
| 173 | Ga0157376_10064613 | 3300014969 | Bacteria | 3087 |
| 174 | Ga0213873_10015371 | 3300021358 | Bacteria | 1713 |
| 175 | Ga0213876_10060287 | 3300021384 | Bacteria | 2002 |
| 176 | Ga0213876_10068727 | 3300021384 | Bacteria | 1871 |
| 177 | Ga0213875_10041266 | 3300021388 | Bacteria | 2171 |
| 178 | Ga0224712_10044474 | 3300022467 | Bacteria | 1694 |
| 179 | Ga0207656_10002156 | 3300025321 | Bacteria | 6575 |
| 180 | Ga0207656_10002232 | 3300025321 | Bacteria | 6488 |
| 181 | Ga0207656_10022538 | 3300025321 | Bacteria | 2528 |
| 182 | Ga0207692_10000001 | 3300025898 | Bacteria | 558345 |
| 183 | Ga0207688_10010454 | 3300025901 | Bacteria | 5051 |
| 184 | Ga0207688_10012057 | 3300025901 | Bacteria | 4702 |
| 185 | Ga0207705_10039266 | 3300025909 | Bacteria | 3392 |
| 186 | Ga0207705_10050406 | 3300025909 | Bacteria | 2997 |
| 187 | Ga0207705_10076394 | 3300025909 | Bacteria | 2435 |
| 188 | Ga0207705_10083163 | 3300025909 | Bacteria | 2335 |
| 189 | Ga0207707_10011031 | 3300025912 | Bacteria | 7863 |
| 190 | Ga0207695_10226847 | 3300025913 | Bacteria | 1774 |
| 191 | Ga0207693_10000001 | 3300025915 | Bacteria | 469535 |
| 192 | Ga0207693_10004920 | 3300025915 | Bacteria | 11224 |
| 193 | Ga0207693_10006065 | 3300025915 | Bacteria | 10009 |
| 194 | Ga0207663_10079161 | 3300025916 | Bacteria | 2145 |
| 195 | Ga0207660_10013455 | 3300025917 | Bacteria | 5362 |
| 196 | Ga0207662_10023772 | 3300025918 | Bacteria | 3523 |
| 197 | Ga0207662_10088563 | 3300025918 | Bacteria | 1901 |
| 198 | Ga0207657_10000475 | 3300025919 | Bacteria | 42310 |
| 199 | Ga0207649_10004012 | 3300025920 | Bacteria | 8019 |
| 200 | Ga0207649_10026695 | 3300025920 | Bacteria | 3380 |
| 201 | Ga0207652_10000044 | 3300025921 | Bacteria | 127779 |
| 202 | Ga0207652_10057318 | 3300025921 | Bacteria | 3355 |
| 203 | Ga0207646_10287884 | 3300025922 | Bacteria | 1485 |
| 204 | Ga0207681_10008037 | 3300025923 | Bacteria | 6456 |
| 205 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 206 | Ga0207650_10040316 | 3300025925 | Bacteria | 3417 |
| 207 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 208 | Ga0207659_10026112 | 3300025926 | Bacteria | 3937 |
| 209 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 210 | Ga0207687_10001023 | 3300025927 | Bacteria | 18981 |
| 211 | Ga0207687_10002454 | 3300025927 | Bacteria | 12584 |
| 212 | Ga0207687_10005746 | 3300025927 | Bacteria | 8211 |
| 213 | Ga0207687_10030821 | 3300025927 | Bacteria | 3619 |
| 214 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 215 | Ga0207700_10152818 | 3300025928 | Bacteria | 1909 |
| 216 | Ga0207664_10000008 | 3300025929 | Bacteria | 309301 |
| 217 | Ga0207664_10000529 | 3300025929 | Bacteria | 27133 |
| 218 | Ga0207664_10012473 | 3300025929 | Bacteria | 6078 |
| 219 | Ga0207664_10032387 | 3300025929 | Bacteria | 4005 |
| 220 | Ga0207664_10044110 | 3300025929 | Bacteria | 3490 |
| 221 | Ga0207664_10125303 | 3300025929 | Bacteria | 2156 |
| 222 | Ga0207690_10000088 | 3300025932 | Bacteria | 76762 |
| 223 | Ga0207690_10005795 | 3300025932 | Bacteria | 7306 |
| 224 | Ga0207706_10004835 | 3300025933 | Bacteria | 12615 |
| 225 | Ga0207686_10000048 | 3300025934 | Bacteria | 115595 |
| 226 | Ga0207670_10020188 | 3300025936 | Bacteria | 4089 |
| 227 | Ga0207670_10023297 | 3300025936 | Bacteria | 3853 |
| 228 | Ga0207704_10000093 | 3300025938 | Bacteria | 52224 |
| 229 | Ga0207704_10009888 | 3300025938 | Bacteria | 4625 |
| 230 | Ga0207691_10000044 | 3300025940 | Bacteria | 100027 |
| 231 | Ga0207691_10022858 | 3300025940 | Bacteria | 5894 |
| 232 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 233 | Ga0207661_10001262 | 3300025944 | Bacteria | 16919 |
| 234 | Ga0207661_10010771 | 3300025944 | Bacteria | 6592 |
| 235 | Ga0207661_10018784 | 3300025944 | Bacteria | 5142 |
| 236 | Ga0207661_10040792 | 3300025944 | Bacteria | 3651 |
| 237 | Ga0207661_10087624 | 3300025944 | Bacteria | 2586 |
| 238 | Ga0207679_10033917 | 3300025945 | Bacteria | 3596 |
| 239 | Ga0207679_10252051 | 3300025945 | Bacteria | 1501 |
| 240 | Ga0207651_10021082 | 3300025960 | Bacteria | 3950 |
| 241 | Ga0207712_10016409 | 3300025961 | Bacteria | 4795 |
| 242 | Ga0207668_10221809 | 3300025972 | Bacteria | 1519 |
| 243 | Ga0207640_10000200 | 3300025981 | Bacteria | 42738 |
| 244 | Ga0207658_10003525 | 3300025986 | Bacteria | 11041 |
| 245 | Ga0207658_10052319 | 3300025986 | Bacteria | 3013 |
| 246 | Ga0207677_10003263 | 3300026023 | Bacteria | 8568 |
| 247 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 248 | Ga0207703_10000152 | 3300026035 | Bacteria | 79658 |
| 249 | Ga0207639_10027752 | 3300026041 | Bacteria | 4127 |
| 250 | Ga0207639_10040770 | 3300026041 | Bacteria | 3468 |
| 251 | Ga0207678_10014283 | 3300026067 | Bacteria | 6982 |
| 252 | Ga0207678_10065920 | 3300026067 | Bacteria | 3109 |
| 253 | Ga0207708_10000842 | 3300026075 | Bacteria | 23094 |
| 254 | Ga0207702_10000060 | 3300026078 | Bacteria | 125473 |
| 255 | Ga0207702_10003333 | 3300026078 | Bacteria | 14742 |
| 256 | Ga0207702_10027029 | 3300026078 | Bacteria | 4765 |
| 257 | Ga0207702_10061229 | 3300026078 | Bacteria | 3210 |
| 258 | Ga0207648_10071310 | 3300026089 | Bacteria | 3028 |
| 259 | Ga0207676_10000094 | 3300026095 | Bacteria | 80575 |
| 260 | Ga0207674_10001502 | 3300026116 | Bacteria | 30105 |
| 261 | Ga0207674_10040696 | 3300026116 | Bacteria | 4813 |
| 262 | Ga0207675_100060076 | 3300026118 | Bacteria | 3548 |
| 263 | Ga0207683_10170782 | 3300026121 | Bacteria | 1969 |
| 264 | Ga0207683_10196375 | 3300026121 | Bacteria | 1833 |
| 265 | Ga0207683_10202083 | 3300026121 | Bacteria | 1807 |
| 266 | Ga0207698_10000440 | 3300026142 | Bacteria | 23916 |
| 267 | Ga0207698_10052617 | 3300026142 | Bacteria | 3121 |
| 268 | Ga0209813_10002809 | 3300027866 | Bacteria | 4025 |
| 269 | Ga0209813_10030764 | 3300027866 | Bacteria | 1580 |
| 270 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 271 | Ga0268266_10000285 | 3300028379 | Bacteria | 83300 |
| 272 | Ga0268266_10005034 | 3300028379 | Bacteria | 12475 |
| 273 | Ga0268266_10379628 | 3300028379 | Bacteria | 1333 |
| 274 | Ga0268264_10046651 | 3300028381 | Bacteria | 3599 |
| 275 | Ga0265326_10000003 | 3300028558 | Bacteria | 479811 |
| 276 | Ga0265319_1000664 | 3300028563 | Bacteria | 22595 |
| 277 | Ga0265336_10004622 | 3300028666 | Bacteria | 5167 |
| 278 | Ga0307515_10080725 | 3300028794 | Bacteria | 4236 |
| 279 | Ga0307515_10149740 | 3300028794 | Bacteria | 2447 |
| 280 | Ga0265338_10000844 | 3300028800 | Bacteria | 51666 |
| 281 | Ga0265324_10001900 | 3300029957 | Bacteria | 11228 |
| 282 | Ga0307513_10012431 | 3300031456 | Bacteria | 10506 |
| 283 | Ga0307508_10239324 | 3300031616 | Bacteria | 1413 |
| 284 | Ga0307413_10005794 | 3300031824 | Bacteria | 5562 |
| 285 | Ga0307409_100033771 | 3300031995 | Bacteria | 3727 |
| 286 | Ga0307416_100193848 | 3300032002 | Bacteria | 1920 |
| 287 | Ga0307414_10061438 | 3300032004 | Bacteria | 2662 |
| 288 | Ga0307415_100003742 | 3300032126 | Bacteria | 7793 |
| 289 | Ga0307415_100041426 | 3300032126 | Bacteria | 3058 |
| 290 | Ga0307507_10002484 | 3300033179 | Bacteria | 38535 |
| 291 | Ga0373953_0052238 | 3300035117 | Bacteria | 1654 |
| 292 | Ga0373937_0022173 | 3300036401 | Bacteria | 5706 |
| 293 | Ga0373937_0177048 | 3300036401 | Bacteria | 2002 |
| 294 | Ga0395900_0092948 | 3300037418 | Bacteria | 3099 |
| 295 | Ga0395898_0004969 | 3300037466 | Bacteria | 14430 |
| 296 | Ga0436364_0112430 | 3300037853 | Bacteria | 46821 |
| 297 | Ga0400485_08597 | 3300038735 | Bacteria | 35424 |
| 298 | Ga0400488_44500 | 3300038741 | Bacteria | 7837 |
| 299 | Ga0400486_21500 | 3300038742 | Bacteria | 94371 |
| 300 | Ga0436365_0018303 | 3300039437 | Bacteria | 2255 |
| 301 | Ga0436365_0131291 | 3300039437 | Bacteria | 43697 |
| 302 | Ga0436365_0457026 | 3300039437 | Bacteria | 17369 |
| 303 | Ga0436365_1486515 | 3300039437 | Bacteria | 5350 |
| 304 | Ga0436365_1691212 | 3300039437 | Bacteria | 5902 |
| 305 | Ga0436360_0079068 | 3300039438 | Bacteria | 1601 |
| 306 | Ga0436363_0334812 | 3300039450 | Bacteria | 1366 |
| 307 | Ga0436363_0932759 | 3300039450 | Bacteria | 40920 |
| 308 | Ga0436363_0970724 | 3300039450 | Bacteria | 6811 |
| 309 | Ga0436362_0215426 | 3300039453 | Bacteria | 3173 |
| 310 | Ga0439436_0007563 | 3300041404 | Bacteria | 3342 |
| 311 | Ga0439438_028297 | 3300041405 | Bacteria | 1508 |
| 312 | Ga0439447_000769 | 3300041407 | Bacteria | 11818 |
| 313 | Ga0439466_0001145 | 3300041411 | Bacteria | 10310 |
| 314 | Ga0451853_4057189 | 3300041512 | Bacteria | 2563 |
| 315 | Ga0439432_002550 | 3300042006 | Bacteria | 6868 |
| 316 | Ga0439452_001054 | 3300042010 | Bacteria | 12161 |
| 317 | Ga0439446_0000840 | 3300042156 | Bacteria | 6571 |
| 318 | Ga0439434_0000780 | 3300042435 | Bacteria | 9163 |
| 319 | Ga0451577_0001435 | 3300042876 | Bacteria | 31732 |
| 320 | Ga0466969_0001191 | 3300044656 | Bacteria | 14062 |
| 321 | Ga0466969_0040728 | 3300044656 | Bacteria | 2327 |
| 322 | Ga0466966_0016687 | 3300044684 | Bacteria | 4851 |
| 323 | Ga0466966_0089662 | 3300044684 | Bacteria | 1910 |
| 324 | Ga0466961_0002800 | 3300044693 | Bacteria | 10849 |
| 325 | Ga0466961_0015150 | 3300044693 | Bacteria | 4950 |
| 326 | Ga0466961_0016137 | 3300044693 | Bacteria | 4796 |
| 327 | Ga0466963_0000510 | 3300044694 | Bacteria | 18138 |
| 328 | Ga0466963_0005861 | 3300044694 | Bacteria | 7240 |
| 329 | Ga0466963_0020021 | 3300044694 | Bacteria | 4205 |
| 330 | Ga0466963_0084469 | 3300044694 | Bacteria | 2154 |
| 331 | Ga0466963_0088228 | 3300044694 | Bacteria | 2110 |
| 332 | Ga0466963_0112747 | 3300044694 | Bacteria | 1867 |
| 333 | Ga0466964_0019908 | 3300044706 | Bacteria | 2582 |
| 334 | Ga0466968_0041509 | 3300044735 | Bacteria | 1942 |
| 335 | Ga0466970_0021172 | 3300044765 | Bacteria | 3386 |
| 336 | Ga0466970_0071264 | 3300044765 | Bacteria | 1869 |
| 337 | Ga0466970_0153435 | 3300044765 | Bacteria | 1272 |
| 338 | Ga0466957_0019515 | 3300044842 | Bacteria | 3987 |
| 339 | Ga0466957_0021361 | 3300044842 | Bacteria | 3813 |
| 340 | Ga0466957_0050730 | 3300044842 | Bacteria | 2525 |
| 341 | Ga0466957_0054239 | 3300044842 | Bacteria | 2446 |
| 342 | Ga0466960_0000222 | 3300044901 | Bacteria | 19771 |
| 343 | Ga0466960_0002576 | 3300044901 | Bacteria | 6814 |
| 344 | Ga0466960_0015176 | 3300044901 | Bacteria | 3316 |
| 345 | Ga0466960_0043509 | 3300044901 | Bacteria | 2136 |
| 346 | Ga0466959_0002073 | 3300045049 | Bacteria | 12682 |
| 347 | Ga0466959_0009424 | 3300045049 | Bacteria | 6946 |
| 348 | Ga0466959_0016457 | 3300045049 | Bacteria | 5404 |
| 349 | Ga0466959_0028418 | 3300045049 | Bacteria | 4147 |
| 350 | Ga0466959_0050133 | 3300045049 | Bacteria | 3066 |
| 351 | Ga0466959_0057183 | 3300045049 | Bacteria | 2844 |
| 352 | Ga0466958_0005046 | 3300045836 | Bacteria | 7050 |
| 353 | Ga0466958_0013922 | 3300045836 | Bacteria | 4587 |
| 354 | Ga0466958_0050862 | 3300045836 | Bacteria | 2508 |
| 355 | Ga0466967_0000478 | 3300045976 | Bacteria | 19384 |
| 356 | Ga0466967_0028857 | 3300045976 | Bacteria | 4638 |
| 357 | Ga0466967_0043094 | 3300045976 | Bacteria | 3906 |
| 358 | Ga0466967_0050219 | 3300045976 | Bacteria | 3651 |
| 359 | Ga0466967_0055985 | 3300045976 | Bacteria | 3475 |
| 360 | Ga0466967_0082168 | 3300045976 | Bacteria | 2911 |
| 361 | Ga0466967_0127720 | 3300045976 | Bacteria | 2357 |
| 362 | Ga0495592_0101174 | 3300046454 | Bacteria | 2054 |
| 363 | Ga0495592_0132251 | 3300046454 | Bacteria | 1744 |
| 364 | Ga0495629_0005201 | 3300046459 | Bacteria | 9743 |
| 365 | Ga0495638_0037115 | 3300046460 | Bacteria | 3101 |
| 366 | Ga0495641_0000874 | 3300046461 | Bacteria | 25824 |
| 367 | Ga0495641_0088801 | 3300046461 | Bacteria | 1382 |
| 368 | Ga0495651_0119930 | 3300046462 | Bacteria | 1934 |
| 369 | Ga0495653_0035665 | 3300046463 | Bacteria | 3923 |
| 370 | Ga0495580_0016747 | 3300046472 | Bacteria | 5500 |
| 371 | Ga0495639_0084345 | 3300046475 | Bacteria | 1484 |
| 372 | Ga0495606_0000565 | 3300046507 | Bacteria | 58752 |
| 373 | Ga0495608_0000068 | 3300046511 | Bacteria | 79694 |
| 374 | Ga0495608_0020646 | 3300046511 | Bacteria | 4525 |
| 375 | Ga0495628_0121590 | 3300046516 | Bacteria | 2002 |
| 376 | Ga0495628_0123099 | 3300046516 | Bacteria | 1988 |
| 377 | Ga0495630_0000056 | 3300046517 | Bacteria | 91477 |
| 378 | Ga0495630_0034134 | 3300046517 | Bacteria | 3797 |
| 379 | Ga0495630_0064261 | 3300046517 | Bacteria | 2757 |
| 380 | Ga0495652_0004685 | 3300046529 | Bacteria | 13047 |
| 381 | Ga0495652_0083622 | 3300046529 | Bacteria | 2627 |
| 382 | Ga0495640_0106975 | 3300046533 | Bacteria | 1831 |
| 383 | Ga0495645_0002246 | 3300046543 | Bacteria | 13145 |
| 384 | Ga0495645_0018914 | 3300046543 | Bacteria | 4954 |
| 385 | Ga0495645_0162027 | 3300046543 | Bacteria | 1546 |
| 386 | Ga0495667_0189895 | 3300046559 | Bacteria | 1317 |
| 387 | Ga0495634_0007615 | 3300046642 | Bacteria | 8114 |
| 388 | Ga0495625_0000587 | 3300046660 | Bacteria | 52838 |
| 389 | Ga0495635_0071064 | 3300046663 | Bacteria | 2386 |
| 390 | Ga0495588_0000165 | 3300046674 | Bacteria | 85841 |
| 391 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 392 | Ga0495657_0047034 | 3300046675 | Bacteria | 2919 |
| 393 | Ga0495599_0013295 | 3300046678 | Bacteria | 5087 |
| 394 | Ga0495647_0000018 | 3300046681 | Bacteria | 81701 |
| 395 | Ga0495613_0000179 | 3300046689 | Bacteria | 62109 |
| 396 | Ga0495624_0000008 | 3300046690 | Bacteria | 145035 |
| 397 | Ga0495624_0000073 | 3300046690 | Bacteria | 65582 |
| 398 | Ga0495649_0000751 | 3300046694 | Bacteria | 26125 |
| 399 | Ga0495600_0016433 | 3300046809 | Bacteria | 4696 |
| 400 | Ga0495604_0000357 | 3300047317 | Bacteria | 40931 |
| 401 | Ga0495604_0078304 | 3300047317 | Bacteria | 2481 |
| 402 | Ga0495604_0167644 | 3300047317 | Bacteria | 1547 |
| 403 | Ga0495674_0035657 | 3300047319 | Bacteria | 4486 |
| 404 | Ga0495674_0152494 | 3300047319 | Bacteria | 1937 |
| 405 | Ga0495672_0030883 | 3300047320 | Bacteria | 3352 |
| 406 | Ga0495676_0004999 | 3300047321 | Bacteria | 12164 |
| 407 | Ga0495676_0027971 | 3300047321 | Bacteria | 4826 |
| 408 | Ga0495676_0038541 | 3300047321 | Bacteria | 3968 |
| 409 | Ga0495680_0000496 | 3300047322 | Bacteria | 44440 |
| 410 | Ga0495687_000406 | 3300047443 | Bacteria | 53268 |
| 411 | Ga0495675_0000175 | 3300047444 | Bacteria | 46609 |
| 412 | Ga0495684_0043493 | 3300047471 | Bacteria | 3439 |
| 413 | Ga0495593_0061865 | 3300047673 | Bacteria | 1957 |
| 414 | Ga0495602_0002588 | 3300048088 | Bacteria | 18471 |
| 415 | Ga0495602_0031032 | 3300048088 | Bacteria | 5059 |
| 416 | Ga0496100_0000018 | 3300048903 | Bacteria | 162451 |
| 417 | Ga0496100_0003651 | 3300048903 | Bacteria | 8048 |
| 418 | Ga0496101_0000062 | 3300048904 | Bacteria | 126595 |
| 419 | Ga0496101_0004877 | 3300048904 | Bacteria | 8515 |
| 420 | Ga0496101_0173669 | 3300048904 | Bacteria | 1657 |
| 421 | Ga0496102_0000039 | 3300048905 | Bacteria | 198306 |
| 422 | Ga0496102_0010620 | 3300048905 | Bacteria | 7933 |
| 423 | Ga0496102_0183577 | 3300048905 | Bacteria | 1971 |
| 424 | Ga0496103_0000008 | 3300048906 | Bacteria | 340474 |
| 425 | Ga0496103_0029605 | 3300048906 | Bacteria | 3329 |
| 426 | Ga0496104_0000650 | 3300048907 | Bacteria | 29817 |
| 427 | Ga0496105_0000347 | 3300048908 | Bacteria | 30490 |
| 428 | Ga0496105_0033730 | 3300048908 | Bacteria | 4206 |
| 429 | Ga0496105_0082806 | 3300048908 | Bacteria | 2650 |
| 430 | Ga0496106_0000122 | 3300048909 | Bacteria | 59816 |
| 431 | Ga0496106_0000312 | 3300048909 | Bacteria | 34208 |
| 432 | Ga0496106_0017353 | 3300048909 | Bacteria | 5327 |
| 433 | Ga0496107_0000006 | 3300048910 | Bacteria | 258746 |
| 434 | Ga0496107_0019934 | 3300048910 | Bacteria | 4736 |
| 435 | Ga0496107_0028789 | 3300048910 | Bacteria | 3949 |
| 436 | Ga0496107_0095337 | 3300048910 | Bacteria | 2177 |
| 437 | Ga0496108_0000062 | 3300048911 | Bacteria | 122391 |
| 438 | Ga0496108_0008150 | 3300048911 | Bacteria | 8497 |
| 439 | Ga0496108_0009387 | 3300048911 | Bacteria | 7921 |
| 440 | Ga0496108_0203029 | 3300048911 | Bacteria | 1720 |
| 441 | Ga0496109_0000121 | 3300048912 | Bacteria | 81487 |
| 442 | Ga0496109_0000129 | 3300048912 | Bacteria | 77469 |
| 443 | Ga0496109_0003623 | 3300048912 | Bacteria | 12912 |
| 444 | Ga0496109_0007583 | 3300048912 | Bacteria | 9200 |
| 445 | Ga0496110_0000089 | 3300048913 | Bacteria | 48723 |
| 446 | Ga0496110_0032801 | 3300048913 | Bacteria | 4489 |
| 447 | Ga0496110_0056938 | 3300048913 | Bacteria | 3440 |
| 448 | Ga0496110_0146152 | 3300048913 | Bacteria | 2139 |
| 449 | Ga0496111_0076543 | 3300048914 | Bacteria | 2439 |
| 450 | Ga0496111_0147610 | 3300048914 | Bacteria | 1744 |
| 451 | Ga0496111_0182051 | 3300048914 | Bacteria | 1562 |
| 452 | Ga0496112_0000223 | 3300048915 | Bacteria | 36875 |
| 453 | Ga0496112_0001770 | 3300048915 | Bacteria | 16950 |
| 454 | Ga0496113_0000628 | 3300048916 | Bacteria | 17756 |
| 455 | Ga0496113_0010757 | 3300048916 | Bacteria | 6066 |
| 456 | Ga0496113_0021542 | 3300048916 | Bacteria | 4548 |
| 457 | Ga0496114_0045004 | 3300048917 | Bacteria | 3664 |
| 458 | Ga0496114_0204212 | 3300048917 | Bacteria | 1732 |
| 459 | Ga0496116_0001565 | 3300048919 | Bacteria | 25265 |
| 460 | Ga0496118_0000818 | 3300048921 | Bacteria | 49518 |
| 461 | Ga0496119_0052566 | 3300048922 | Bacteria | 2494 |
| 462 | Ga0496120_0007169 | 3300048923 | Bacteria | 8354 |
| 463 | Ga0496121_0006714 | 3300048924 | Bacteria | 14134 |
| 464 | Ga0496121_0062775 | 3300048924 | Bacteria | 3040 |
| 465 | Ga0496124_0045298 | 3300048927 | Bacteria | 3772 |
| 466 | Ga0496125_0007232 | 3300048928 | Bacteria | 11827 |
| 467 | Ga0501032_0002454 | 3300049569 | Bacteria | 14486 |
| 468 | Ga0501032_0014608 | 3300049569 | Bacteria | 5562 |
| 469 | Ga0501032_0051764 | 3300049569 | Bacteria | 2768 |
| 470 | Ga0501034_0003032 | 3300049571 | Bacteria | 19417 |
| 471 | Ga0501034_0006537 | 3300049571 | Bacteria | 12527 |
| 472 | Ga0501034_0024940 | 3300049571 | Bacteria | 6083 |
| 473 | Ga0501034_0066247 | 3300049571 | Bacteria | 3624 |
| 474 | Ga0501036_0014209 | 3300049572 | Bacteria | 6624 |
| 475 | Ga0501036_0024665 | 3300049572 | Bacteria | 5070 |
| 476 | Ga0501036_0064936 | 3300049572 | Bacteria | 3089 |
| 477 | Ga0501037_0006562 | 3300049573 | Bacteria | 8515 |
| 478 | Ga0501037_0132425 | 3300049573 | Bacteria | 1787 |
| 479 | Ga0501038_0012061 | 3300049574 | Bacteria | 7892 |
| 480 | Ga0501038_0112865 | 3300049574 | Bacteria | 2250 |
| 481 | Ga0501041_0006202 | 3300049577 | Bacteria | 6990 |
| 482 | Ga0501042_0007948 | 3300049578 | Bacteria | 6977 |
| 483 | Ga0501042_0119524 | 3300049578 | Bacteria | 1897 |
| 484 | Ga0501046_0000799 | 3300049580 | Bacteria | 30520 |
| 485 | Ga0501046_0001349 | 3300049580 | Bacteria | 23762 |
| 486 | Ga0501046_0061264 | 3300049580 | Bacteria | 2943 |
| 487 | Ga0501047_0053133 | 3300049581 | Bacteria | 3916 |
| 488 | Ga0501047_0067942 | 3300049581 | Bacteria | 3433 |
| 489 | Ga0501047_0080816 | 3300049581 | Bacteria | 3124 |
| 490 | Ga0501047_0127282 | 3300049581 | Bacteria | 2427 |
| 491 | Ga0501047_0246814 | 3300049581 | Bacteria | 1634 |
| 492 | Ga0501047_0360799 | 3300049581 | Bacteria | 1289 |
| 493 | Ga0501048_0003341 | 3300049582 | Bacteria | 12204 |
| 494 | Ga0501048_0017290 | 3300049582 | Bacteria | 5313 |
| 495 | Ga0501048_0196308 | 3300049582 | Bacteria | 1430 |
| 496 | Ga0501067_0006652 | 3300049583 | Bacteria | 6414 |
| 497 | Ga0501068_0166982 | 3300049584 | Bacteria | 1388 |
| 498 | Ga0501069_0022967 | 3300049585 | Bacteria | 3396 |
| 499 | Ga0501069_0076805 | 3300049585 | Bacteria | 1878 |
| 500 | Ga0501070_0000651 | 3300049586 | Bacteria | 31939 |
| 501 | Ga0501070_0004254 | 3300049586 | Bacteria | 12308 |
| 502 | Ga0501070_0149318 | 3300049586 | Bacteria | 1928 |
| 503 | Ga0501070_0152198 | 3300049586 | Bacteria | 1908 |
| 504 | Ga0501070_0215519 | 3300049586 | Bacteria | 1575 |
| 505 | Ga0501071_0022117 | 3300049587 | Bacteria | 4431 |
| 506 | Ga0501072_0008263 | 3300049588 | Bacteria | 7908 |
| 507 | Ga0501073_0003023 | 3300049589 | Bacteria | 12608 |
| 508 | Ga0501073_0005104 | 3300049589 | Bacteria | 9845 |
| 509 | Ga0501073_0031643 | 3300049589 | Bacteria | 3775 |
| 510 | Ga0501074_0007354 | 3300049590 | Bacteria | 7963 |
| 511 | Ga0501074_0022863 | 3300049590 | Bacteria | 4546 |
| 512 | Ga0501074_0097880 | 3300049590 | Bacteria | 2100 |
| 513 | Ga0501076_0042557 | 3300049592 | Bacteria | 3576 |
| 514 | Ga0501076_0062993 | 3300049592 | Bacteria | 2954 |
| 515 | Ga0501077_0017179 | 3300049593 | Bacteria | 4564 |
| 516 | Ga0501077_0227206 | 3300049593 | Bacteria | 1186 |
| 517 | Ga0501079_0009411 | 3300049741 | Bacteria | 7406 |
| 518 | Ga0501080_0003998 | 3300049742 | Bacteria | 13053 |
| 519 | Ga0501081_0055694 | 3300049743 | Bacteria | 2732 |
| 520 | Ga0501035_0007867 | 3300049822 | Bacteria | 9963 |
| 521 | Ga0501035_0033927 | 3300049822 | Bacteria | 4639 |
| 522 | Ga0501035_0035100 | 3300049822 | Bacteria | 4553 |
| 523 | Ga0501035_0051830 | 3300049822 | Bacteria | 3672 |
| 524 | Ga0501035_0300316 | 3300049822 | Bacteria | 1353 |
| 525 | Ga0501044_0025719 | 3300049823 | Bacteria | 6239 |
| 526 | Ga0501044_0039969 | 3300049823 | Bacteria | 4890 |
| 527 | Ga0501044_0097462 | 3300049823 | Bacteria | 2961 |
| 528 | Ga0501044_0102835 | 3300049823 | Bacteria | 2872 |
| 529 | Ga0501045_0098538 | 3300049824 | Bacteria | 2163 |
| 530 | nmdc:mga03n38_10033_c1 | 3300050490 | Bacteria | 3468 |
| 531 | nmdc:mga03n38_16770_c1 | 3300050490 | Bacteria | 2857 |
| 532 | nmdc:mga00v17_41493_c1 | 3300050491 | Bacteria | 2764 |
| 533 | nmdc:mga00v17_96767_c1 | 3300050491 | Bacteria | 1860 |
| 534 | nmdc:mga0yw44_13510_c1 | 3300050492 | Bacteria | 4303 |
| 535 | nmdc:mga0yw44_39718_c1 | 3300050492 | Bacteria | 2792 |
| 536 | nmdc:mga0yw44_790_c1 | 3300050492 | Bacteria | 4685 |
| 537 | nmdc:mga04h51_8902_c1 | 3300050495 | Bacteria | 2700 |
| 538 | nmdc:mga07m45_14203_c1 | 3300050496 | Bacteria | 4237 |
| 539 | nmdc:mga09592_12744_c1 | 3300050508 | Bacteria | 6854 |
| 540 | nmdc:mga06r32_27104_c1 | 3300050510 | Bacteria | 3689 |
| 541 | nmdc:mga0rr50_104887_c1 | 3300050513 | Bacteria | 2227 |
| 542 | Ga0495601_0000013 | 3300053077 | Bacteria | 226476 |
| 543 | Ga0495601_0000124 | 3300053077 | Bacteria | 43205 |
| 544 | Ga0495612_0001051 | 3300053078 | Bacteria | 11297 |
| 545 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 546 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 547 | Ga0495595_0031516 | 3300053084 | Bacteria | 2383 |
| 548 | Ga0495619_0000031 | 3300053085 | Bacteria | 145508 |
| 549 | Ga0495619_0000257 | 3300053085 | Bacteria | 38653 |
| 550 | Ga0495619_0001230 | 3300053085 | Bacteria | 16755 |
| 551 | Ga0495619_0007664 | 3300053085 | Bacteria | 6836 |
| 552 | Ga0500644_0000541 | 3300053088 | Bacteria | 15557 |
| 553 | Ga0500566_0098016 | 3300053094 | Bacteria | 1611 |
| 554 | Ga0500641_0004769 | 3300053096 | Bacteria | 4801 |
| 555 | Ga0500593_000263 | 3300053117 | Bacteria | 21458 |
| 556 | Ga0500614_012010 | 3300053123 | Bacteria | 1883 |
| 557 | Ga0500628_000010 | 3300053129 | Bacteria | 122210 |
| 558 | Ga0500658_0000447 | 3300053134 | Bacteria | 17605 |
| 559 | Ga0500573_0043434 | 3300053140 | Bacteria | 2593 |
| 560 | Ga0501084_0013369 | 3300054114 | Bacteria | 6791 |
| 561 | Ga0501082_0033473 | 3300060353 | Bacteria | 4435 |
| 562 | Ga0501082_0101790 | 3300060353 | Bacteria | 2485 |
| 563 | Ga0466962_0002335 | 3300061719 | Bacteria | 8997 |
| 564 | Ga0466962_0009905 | 3300061719 | Bacteria | 4572 |
| 565 | Ga0466962_0061612 | 3300061719 | Bacteria | 1791 |
| 566 | Ga0530510_0073683 | 3300061734 | Bacteria | 2479 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048904 | Ga0496101_0173669 | Ga0496101_0173669_565_1644 | 319 |
| 2 | 3300005355 | Ga0070671_100106756 | Ga0070671_1001067561 | 323 |
| 3 | 3300005618 | Ga0068864_100003161 | Ga0068864_10000316110 | 323 |
| 4 | 3300009098 | Ga0105245_10099935 | Ga0105245_100999353 | 323 |
| 5 | 3300014968 | Ga0157379_10159632 | Ga0157379_101596321 | 323 |
| 6 | 3300025927 | Ga0207687_10005746 | Ga0207687_100057466 | 323 |
| 7 | 3300028379 | Ga0268266_10379628 | Ga0268266_103796281 | 323 |
| 8 | 3300053134 | Ga0500658_0000447 | Ga0500658_0000447_1799_3010 | 324 |
| 9 | 3300009094 | Ga0111539_10364164 | Ga0111539_103641641 | 325 |
| 10 | 3300005548 | Ga0070665_100008940 | Ga0070665_1000089406 | 326 |
| 11 | 3300009098 | Ga0105245_10039587 | Ga0105245_100395873 | 326 |
| 12 | 3300039450 | Ga0436363_0932759 | Ga0436363_0932759_39864_40901 | 326 |
| 13 | 3300047443 | Ga0495687_000406 | Ga0495687_000406_50050_51213 | 326 |
| 14 | 3300013296 | Ga0157374_10523449 | Ga0157374_105234491 | 329 |
| 15 | 3300028794 | Ga0307515_10080725 | Ga0307515_100807253 | 333 |
| 16 | 3300031456 | Ga0307513_10012431 | Ga0307513_100124313 | 333 |
| 17 | 3300046559 | Ga0495667_0189895 | Ga0495667_0189895_35_1192 | 335 |
| 18 | 3300028794 | Ga0307515_10149740 | Ga0307515_101497401 | 338 |
| 19 | 3300046472 | Ga0495580_0016747 | Ga0495580_0016747_2510_3661 | 342 |
| 20 | 3300046461 | Ga0495641_0088801 | Ga0495641_0088801_25_1098 | 346 |
| 21 | 3300046663 | Ga0495635_0071064 | Ga0495635_0071064_506_1714 | 348 |
| 22 | 3300053085 | Ga0495619_0007664 | Ga0495619_0007664_5315_6523 | 348 |
| 23 | 3300037853 | Ga0436364_0112430 | Ga0436364_0112430_37880_39106 | 349 |
| 24 | 3300039437 | Ga0436365_0457026 | Ga0436365_0457026_8546_9772 | 349 |
| 25 | 3300039450 | Ga0436363_0970724 | Ga0436363_0970724_912_2138 | 349 |
| 26 | 3300045976 | Ga0466967_0127720 | Ga0466967_0127720_522_1745 | 351 |
| 27 | 3300044656 | Ga0466969_0001191 | Ga0466969_0001191_7279_8493 | 356 |
| 28 | 3300045049 | Ga0466959_0009424 | Ga0466959_0009424_1640_2854 | 356 |
| 29 | 3300006846 | Ga0075430_100012368 | Ga0075430_1000123685 | 357 |
| 30 | 3300006038 | Ga0075365_10150161 | Ga0075365_101501612 | 358 |
| 31 | 3300045976 | Ga0466967_0000478 | Ga0466967_0000478_9624_10862 | 360 |
| 32 | 3300049824 | Ga0501045_0098538 | Ga0501045_0098538_89_1303 | 360 |
| 33 | 3300039437 | Ga0436365_1691212 | Ga0436365_1691212_1066_2301 | 361 |
| 34 | 3300044842 | Ga0466957_0054239 | Ga0466957_0054239_20_1150 | 361 |
| 35 | 3300049573 | Ga0501037_0132425 | Ga0501037_0132425_25_1173 | 361 |
| 36 | 3300042876 | Ga0451577_0001435 | Ga0451577_0001435_5875_7086 | 362 |
| 37 | 3300048909 | Ga0496106_0000312 | Ga0496106_0000312_60_1271 | 362 |
| 38 | 3300005327 | Ga0070658_10038129 | Ga0070658_100381292 | 363 |
| 39 | 3300005329 | Ga0070683_100019348 | Ga0070683_1000193485 | 363 |
| 40 | 3300005337 | Ga0070682_100001006 | Ga0070682_1000010063 | 363 |
| 41 | 3300005339 | Ga0070660_100002223 | Ga0070660_1000022236 | 363 |
| 42 | 3300005344 | Ga0070661_100013239 | Ga0070661_1000132395 | 363 |
| 43 | 3300005345 | Ga0070692_10000576 | Ga0070692_100005769 | 363 |
| 44 | 3300005354 | Ga0070675_100041648 | Ga0070675_1000416483 | 363 |
| 45 | 3300005364 | Ga0070673_100011909 | Ga0070673_1000119093 | 363 |
| 46 | 3300005366 | Ga0070659_100004130 | Ga0070659_1000041302 | 363 |
| 47 | 3300005441 | Ga0070700_100011326 | Ga0070700_1000113263 | 363 |
| 48 | 3300005455 | Ga0070663_100036165 | Ga0070663_1000361651 | 363 |
| 49 | 3300005457 | Ga0070662_100001863 | Ga0070662_1000018638 | 363 |
| 50 | 3300005459 | Ga0068867_100145468 | Ga0068867_1001454682 | 363 |
| 51 | 3300005535 | Ga0070684_100006126 | Ga0070684_1000061262 | 363 |
| 52 | 3300005539 | Ga0068853_100037768 | Ga0068853_1000377683 | 363 |
| 53 | 3300005543 | Ga0070672_100010387 | Ga0070672_1000103874 | 363 |
| 54 | 3300005544 | Ga0070686_100047303 | Ga0070686_1000473032 | 363 |
| 55 | 3300005564 | Ga0070664_100034103 | Ga0070664_1000341032 | 363 |
| 56 | 3300005577 | Ga0068857_100193749 | Ga0068857_1001937491 | 363 |
| 57 | 3300005615 | Ga0070702_100033692 | Ga0070702_1000336922 | 363 |
| 58 | 3300005616 | Ga0068852_100057097 | Ga0068852_1000570973 | 363 |
| 59 | 3300005834 | Ga0068851_10027612 | Ga0068851_100276122 | 363 |
| 60 | 3300006038 | Ga0075365_10044988 | Ga0075365_100449882 | 363 |
| 61 | 3300006048 | Ga0075363_100000378 | Ga0075363_10000037811 | 363 |
| 62 | 3300006881 | Ga0068865_100039288 | Ga0068865_1000392882 | 363 |
| 63 | 3300009098 | Ga0105245_10205720 | Ga0105245_102057202 | 363 |
| 64 | 3300009148 | Ga0105243_10002147 | Ga0105243_100021478 | 363 |
| 65 | 3300009553 | Ga0105249_10113743 | Ga0105249_101137431 | 363 |
| 66 | 3300010375 | Ga0105239_10102334 | Ga0105239_101023342 | 363 |
| 67 | 3300013306 | Ga0163162_10133134 | Ga0163162_101331342 | 363 |
| 68 | 3300014745 | Ga0157377_10024159 | Ga0157377_100241592 | 363 |
| 69 | 3300021358 | Ga0213873_10015371 | Ga0213873_100153712 | 363 |
| 70 | 3300021384 | Ga0213876_10060287 | Ga0213876_100602872 | 363 |
| 71 | 3300025321 | Ga0207656_10022538 | Ga0207656_100225382 | 363 |
| 72 | 3300025901 | Ga0207688_10010454 | Ga0207688_100104543 | 363 |
| 73 | 3300025909 | Ga0207705_10039266 | Ga0207705_100392662 | 363 |
| 74 | 3300025918 | Ga0207662_10088563 | Ga0207662_100885631 | 363 |
| 75 | 3300025919 | Ga0207657_10000475 | Ga0207657_1000047523 | 363 |
| 76 | 3300025920 | Ga0207649_10026695 | Ga0207649_100266951 | 363 |
| 77 | 3300025926 | Ga0207659_10026112 | Ga0207659_100261123 | 363 |
| 78 | 3300025927 | Ga0207687_10030821 | Ga0207687_100308212 | 363 |
| 79 | 3300025932 | Ga0207690_10005795 | Ga0207690_100057952 | 363 |
| 80 | 3300025933 | Ga0207706_10004835 | Ga0207706_100048354 | 363 |
| 81 | 3300025936 | Ga0207670_10023297 | Ga0207670_100232973 | 363 |
| 82 | 3300025938 | Ga0207704_10009888 | Ga0207704_100098883 | 363 |
| 83 | 3300025940 | Ga0207691_10022858 | Ga0207691_100228586 | 363 |
| 84 | 3300025944 | Ga0207661_10018784 | Ga0207661_100187843 | 363 |
| 85 | 3300025945 | Ga0207679_10033917 | Ga0207679_100339172 | 363 |
| 86 | 3300026041 | Ga0207639_10040770 | Ga0207639_100407702 | 363 |
| 87 | 3300026067 | Ga0207678_10065920 | Ga0207678_100659202 | 363 |
| 88 | 3300026075 | Ga0207708_10000842 | Ga0207708_100008423 | 363 |
| 89 | 3300026089 | Ga0207648_10071310 | Ga0207648_100713102 | 363 |
| 90 | 3300026118 | Ga0207675_100060076 | Ga0207675_1000600762 | 363 |
| 91 | 3300026142 | Ga0207698_10052617 | Ga0207698_100526173 | 363 |
| 92 | 3300039453 | Ga0436362_0215426 | Ga0436362_0215426_1500_2735 | 363 |
| 93 | 3300048909 | Ga0496106_0017353 | Ga0496106_0017353_1999_3213 | 363 |
| 94 | 3300048910 | Ga0496107_0028789 | Ga0496107_0028789_1476_2690 | 363 |
| 95 | 3300048911 | Ga0496108_0008150 | Ga0496108_0008150_873_2087 | 363 |
| 96 | 3300048912 | Ga0496109_0003623 | Ga0496109_0003623_9690_10904 | 363 |
| 97 | 3300048913 | Ga0496110_0056938 | Ga0496110_0056938_868_2082 | 363 |
| 98 | 3300050490 | nmdc:mga03n38_10033_c1 | nmdc:mga03n38_10033_c1_1018_2232 | 363 |
| 99 | 3300050492 | nmdc:mga0yw44_790_c1 | nmdc:mga0yw44_790_c1_2144_3358 | 363 |
| 100 | 3300044694 | Ga0466963_0020021 | Ga0466963_0020021_2097_3335 | 364 |
| 101 | 3300006844 | Ga0075428_100121351 | Ga0075428_1001213513 | 365 |
| 102 | 3300044694 | Ga0466963_0088228 | Ga0466963_0088228_642_1880 | 365 |
| 103 | 3300044842 | Ga0466957_0050730 | Ga0466957_0050730_217_1455 | 365 |
| 104 | 3300045836 | Ga0466958_0013922 | Ga0466958_0013922_169_1410 | 365 |
| 105 | 3300050510 | nmdc:mga06r32_27104_c1 | nmdc:mga06r32_27104_c1_1519_2703 | 366 |
| 106 | 3300002074 | JGI24748J21848_1000895 | JGI24748J21848_10008953 | 369 |
| 107 | 3300002239 | JGI24034J26672_10000136 | JGI24034J26672_1000013610 | 369 |
| 108 | 3300006028 | Ga0070717_10000352 | Ga0070717_100003522 | 369 |
| 109 | 3300044901 | Ga0466960_0043509 | Ga0466960_0043509_492_1715 | 369 |
| 110 | 3300048917 | Ga0496114_0204212 | Ga0496114_0204212_570_1718 | 369 |
| 111 | 3300049593 | Ga0501077_0227206 | Ga0501077_0227206_19_1173 | 369 |
| 112 | 3300021384 | Ga0213876_10068727 | Ga0213876_100687272 | 370 |
| 113 | 3300039437 | Ga0436365_0131291 | Ga0436365_0131291_40560_41786 | 370 |
| 114 | 3300005364 | Ga0070673_100001567 | Ga0070673_10000156710 | 371 |
| 115 | 3300009176 | Ga0105242_10002368 | Ga0105242_1000236810 | 371 |
| 116 | 3300025934 | Ga0207686_10000048 | Ga0207686_10000048100 | 371 |
| 117 | 3300025960 | Ga0207651_10021082 | Ga0207651_100210822 | 371 |
| 118 | 3300035117 | Ga0373953_0052238 | Ga0373953_0052238_49_1275 | 371 |
| 119 | 3300044693 | Ga0466961_0015150 | Ga0466961_0015150_3613_4863 | 371 |
| 120 | 3300044765 | Ga0466970_0071264 | Ga0466970_0071264_359_1567 | 371 |
| 121 | 3300045049 | Ga0466959_0002073 | Ga0466959_0002073_10103_11353 | 371 |
| 122 | 3300048905 | Ga0496102_0000039 | Ga0496102_0000039_82862_84070 | 371 |
| 123 | 3300048906 | Ga0496103_0000008 | Ga0496103_0000008_204117_205325 | 371 |
| 124 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_195646_196854 | 371 |
| 125 | 3300053129 | Ga0500628_000010 | Ga0500628_000010_69847_71055 | 371 |
| 126 | 3300006175 | Ga0070712_100000007 | Ga0070712_100000007154 | 372 |
| 127 | 3300006175 | Ga0070712_100002695 | Ga0070712_1000026952 | 372 |
| 128 | 3300025915 | Ga0207693_10000001 | Ga0207693_10000001282 | 372 |
| 129 | 3300025915 | Ga0207693_10004920 | Ga0207693_100049202 | 372 |
| 130 | 3300025928 | Ga0207700_10152818 | Ga0207700_101528182 | 372 |
| 131 | 3300026121 | Ga0207683_10196375 | Ga0207683_101963751 | 372 |
| 132 | 3300036401 | Ga0373937_0177048 | Ga0373937_0177048_339_1589 | 372 |
| 133 | 3300039437 | Ga0436365_1486515 | Ga0436365_1486515_881_2110 | 372 |
| 134 | 3300046511 | Ga0495608_0020646 | Ga0495608_0020646_1773_3023 | 372 |
| 135 | 3300046516 | Ga0495628_0121590 | Ga0495628_0121590_542_1792 | 372 |
| 136 | 3300046533 | Ga0495640_0106975 | Ga0495640_0106975_479_1729 | 372 |
| 137 | 3300046660 | Ga0495625_0000587 | Ga0495625_0000587_25341_26546 | 372 |
| 138 | 3300046675 | Ga0495657_0047034 | Ga0495657_0047034_1333_2583 | 372 |
| 139 | 3300047317 | Ga0495604_0078304 | Ga0495604_0078304_115_1365 | 372 |
| 140 | 3300047319 | Ga0495674_0035657 | Ga0495674_0035657_759_1997 | 372 |
| 141 | 3300047471 | Ga0495684_0043493 | Ga0495684_0043493_1754_2998 | 372 |
| 142 | 3300048088 | Ga0495602_0031032 | Ga0495602_0031032_1252_2502 | 372 |
| 143 | 3300048913 | Ga0496110_0146152 | Ga0496110_0146152_559_1809 | 372 |
| 144 | 3300049592 | Ga0501076_0042557 | Ga0501076_0042557_2322_3533 | 372 |
| 145 | 3300001979 | JGI24740J21852_10026424 | JGI24740J21852_100264241 | 373 |
| 146 | 3300001989 | JGI24739J22299_10022631 | JGI24739J22299_100226311 | 373 |
| 147 | 3300005577 | Ga0068857_100027364 | Ga0068857_1000273642 | 373 |
| 148 | 3300011119 | Ga0105246_10132755 | Ga0105246_101327552 | 373 |
| 149 | 3300021388 | Ga0213875_10041266 | Ga0213875_100412662 | 373 |
| 150 | 3300025972 | Ga0207668_10221809 | Ga0207668_102218091 | 373 |
| 151 | 3300025986 | Ga0207658_10052319 | Ga0207658_100523192 | 373 |
| 152 | 3300026116 | Ga0207674_10040696 | Ga0207674_100406964 | 373 |
| 153 | 3300039438 | Ga0436360_0079068 | Ga0436360_0079068_113_1330 | 373 |
| 154 | 3300045049 | Ga0466959_0028418 | Ga0466959_0028418_189_1430 | 373 |
| 155 | 3300048911 | Ga0496108_0203029 | Ga0496108_0203029_459_1676 | 373 |
| 156 | 3300031616 | Ga0307508_10239324 | Ga0307508_102393241 | 374 |
| 157 | 3300044693 | Ga0466961_0002800 | Ga0466961_0002800_8195_9418 | 374 |
| 158 | 3300044694 | Ga0466963_0000510 | Ga0466963_0000510_2811_4034 | 374 |
| 159 | 3300044735 | Ga0466968_0041509 | Ga0466968_0041509_625_1848 | 374 |
| 160 | 3300045049 | Ga0466959_0016457 | Ga0466959_0016457_2684_3907 | 374 |
| 161 | 3300045836 | Ga0466958_0005046 | Ga0466958_0005046_4456_5679 | 374 |
| 162 | 3300003203 | JGI25406J46586_10001784 | JGI25406J46586_1000178410 | 375 |
| 163 | 3300005985 | Ga0081539_10000086 | Ga0081539_1000008610 | 375 |
| 164 | 3300039450 | Ga0436363_0334812 | Ga0436363_0334812_47_1279 | 375 |
| 165 | 3300005937 | Ga0081455_10000112 | Ga0081455_1000011295 | 376 |
| 166 | 3300002067 | JGI24735J21928_10015421 | JGI24735J21928_100154212 | 377 |
| 167 | 3300005327 | Ga0070658_10088812 | Ga0070658_100888122 | 377 |
| 168 | 3300005339 | Ga0070660_100051008 | Ga0070660_1000510082 | 377 |
| 169 | 3300005530 | Ga0070679_100007291 | Ga0070679_1000072915 | 377 |
| 170 | 3300005614 | Ga0068856_100033907 | Ga0068856_1000339074 | 377 |
| 171 | 3300006038 | Ga0075365_10145185 | Ga0075365_101451852 | 377 |
| 172 | 3300025909 | Ga0207705_10076394 | Ga0207705_100763942 | 377 |
| 173 | 3300025921 | Ga0207652_10057318 | Ga0207652_100573183 | 377 |
| 174 | 3300026078 | Ga0207702_10027029 | Ga0207702_100270294 | 377 |
| 175 | 3300045836 | Ga0466958_0050862 | Ga0466958_0050862_1245_2474 | 377 |
| 176 | 3300061719 | Ga0466962_0009905 | Ga0466962_0009905_1521_2750 | 377 |
| 177 | 3300005937 | Ga0081455_10028530 | Ga0081455_100285304 | 378 |
| 178 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011164 | 378 |
| 179 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004458 | 378 |
| 180 | 3300053085 | Ga0495619_0001230 | Ga0495619_0001230_1166_2395 | 378 |
| 181 | 3300025918 | Ga0207662_10023772 | Ga0207662_100237722 | 379 |
| 182 | 3300046543 | Ga0495645_0018914 | Ga0495645_0018914_2260_3480 | 379 |
| 183 | 3300047321 | Ga0495676_0004999 | Ga0495676_0004999_2700_3914 | 379 |
| 184 | 3300048915 | Ga0496112_0000223 | Ga0496112_0000223_16629_17846 | 379 |
| 185 | 3300006028 | Ga0070717_10038928 | Ga0070717_100389282 | 380 |
| 186 | 3300005345 | Ga0070692_10001979 | Ga0070692_100019792 | 381 |
| 187 | 3300005435 | Ga0070714_100000019 | Ga0070714_10000001963 | 381 |
| 188 | 3300005456 | Ga0070678_100183974 | Ga0070678_1001839742 | 381 |
| 189 | 3300005564 | Ga0070664_100306580 | Ga0070664_1003065801 | 381 |
| 190 | 3300005577 | Ga0068857_100005857 | Ga0068857_1000058571 | 381 |
| 191 | 3300009147 | Ga0114129_10371161 | Ga0114129_103711612 | 381 |
| 192 | 3300009176 | Ga0105242_10219474 | Ga0105242_102194741 | 381 |
| 193 | 3300013102 | Ga0157371_10072030 | Ga0157371_100720302 | 381 |
| 194 | 3300013308 | Ga0157375_10026372 | Ga0157375_100263723 | 381 |
| 195 | 3300025929 | Ga0207664_10000008 | Ga0207664_10000008271 | 381 |
| 196 | 3300025945 | Ga0207679_10252051 | Ga0207679_102520512 | 381 |
| 197 | 3300026116 | Ga0207674_10001502 | Ga0207674_1000150218 | 381 |
| 198 | 3300026121 | Ga0207683_10170782 | Ga0207683_101707822 | 381 |
| 199 | 3300026121 | Ga0207683_10202083 | Ga0207683_102020832 | 381 |
| 200 | 3300048912 | Ga0496109_0007583 | Ga0496109_0007583_7704_8924 | 381 |
| 201 | 3300049577 | Ga0501041_0006202 | Ga0501041_0006202_5680_6831 | 381 |
| 202 | 3300053096 | Ga0500641_0004769 | Ga0500641_0004769_1146_2360 | 381 |
| 203 | 3300005327 | Ga0070658_10006849 | Ga0070658_100068495 | 382 |
| 204 | 3300005329 | Ga0070683_100000641 | Ga0070683_1000006418 | 382 |
| 205 | 3300005337 | Ga0070682_100047031 | Ga0070682_1000470311 | 382 |
| 206 | 3300005535 | Ga0070684_100002845 | Ga0070684_1000028454 | 382 |
| 207 | 3300005615 | Ga0070702_100055460 | Ga0070702_1000554602 | 382 |
| 208 | 3300005843 | Ga0068860_100055881 | Ga0068860_1000558813 | 382 |
| 209 | 3300009098 | Ga0105245_10050223 | Ga0105245_100502232 | 382 |
| 210 | 3300009148 | Ga0105243_10154308 | Ga0105243_101543082 | 382 |
| 211 | 3300009177 | Ga0105248_10270004 | Ga0105248_102700042 | 382 |
| 212 | 3300009553 | Ga0105249_10109885 | Ga0105249_101098852 | 382 |
| 213 | 3300010375 | Ga0105239_10050812 | Ga0105239_100508124 | 382 |
| 214 | 3300011119 | Ga0105246_10001248 | Ga0105246_1000124816 | 382 |
| 215 | 3300013306 | Ga0163162_10032523 | Ga0163162_100325232 | 382 |
| 216 | 3300013307 | Ga0157372_10003488 | Ga0157372_1000348814 | 382 |
| 217 | 3300025901 | Ga0207688_10012057 | Ga0207688_100120573 | 382 |
| 218 | 3300025909 | Ga0207705_10083163 | Ga0207705_100831632 | 382 |
| 219 | 3300025944 | Ga0207661_10040792 | Ga0207661_100407922 | 382 |
| 220 | 3300025961 | Ga0207712_10016409 | Ga0207712_100164095 | 382 |
| 221 | 3300028381 | Ga0268264_10046651 | Ga0268264_100466512 | 382 |
| 222 | 3300041512 | Ga0451853_4057189 | Ga0451853_4057189_482_1696 | 382 |
| 223 | 3300044694 | Ga0466963_0005861 | Ga0466963_0005861_16_1281 | 382 |
| 224 | 3300048906 | Ga0496103_0029605 | Ga0496103_0029605_1116_2336 | 382 |
| 225 | 3300048927 | Ga0496124_0045298 | Ga0496124_0045298_55_1272 | 382 |
| 226 | 3300049572 | Ga0501036_0014209 | Ga0501036_0014209_1109_2323 | 382 |
| 227 | 3300049574 | Ga0501038_0012061 | Ga0501038_0012061_4021_5235 | 382 |
| 228 | 3300049580 | Ga0501046_0061264 | Ga0501046_0061264_1512_2726 | 382 |
| 229 | 3300049581 | Ga0501047_0080816 | Ga0501047_0080816_1446_2660 | 382 |
| 230 | 3300049589 | Ga0501073_0031643 | Ga0501073_0031643_105_1319 | 382 |
| 231 | 3300049742 | Ga0501080_0003998 | Ga0501080_0003998_6061_7278 | 382 |
| 232 | 3300049822 | Ga0501035_0033927 | Ga0501035_0033927_808_2022 | 382 |
| 233 | 3300047320 | Ga0495672_0030883 | Ga0495672_0030883_330_1547 | 383 |
| 234 | iso_pu_bacteria | 2795385470 | 2795785898 | 383 |
| 235 | 3300005842 | Ga0068858_100000091 | Ga0068858_10000009164 | 384 |
| 236 | 3300026035 | Ga0207703_10000152 | Ga0207703_1000015265 | 384 |
| 237 | 3300044765 | Ga0466970_0021172 | Ga0466970_0021172_578_1798 | 384 |
| 238 | 3300046517 | Ga0495630_0034134 | Ga0495630_0034134_1716_2927 | 384 |
| 239 | 3300047319 | Ga0495674_0152494 | Ga0495674_0152494_530_1762 | 384 |
| 240 | 3300025929 | Ga0207664_10044110 | Ga0207664_100441103 | 385 |
| 241 | 3300044901 | Ga0466960_0015176 | Ga0466960_0015176_1967_3172 | 385 |
| 242 | 3300045976 | Ga0466967_0028857 | Ga0466967_0028857_2428_3633 | 385 |
| 243 | 3300049569 | Ga0501032_0002454 | Ga0501032_0002454_6253_7458 | 385 |
| 244 | 3300049571 | Ga0501034_0003032 | Ga0501034_0003032_3078_4283 | 385 |
| 245 | 3300049571 | Ga0501034_0006537 | Ga0501034_0006537_7795_9012 | 385 |
| 246 | 3300049572 | Ga0501036_0064936 | Ga0501036_0064936_412_1617 | 385 |
| 247 | 3300049573 | Ga0501037_0006562 | Ga0501037_0006562_5941_7146 | 385 |
| 248 | 3300049580 | Ga0501046_0001349 | Ga0501046_0001349_6969_8174 | 385 |
| 249 | 3300049581 | Ga0501047_0053133 | Ga0501047_0053133_20_1225 | 385 |
| 250 | 3300049582 | Ga0501048_0003341 | Ga0501048_0003341_5280_6485 | 385 |
| 251 | 3300049586 | Ga0501070_0004254 | Ga0501070_0004254_3934_5139 | 385 |
| 252 | 3300049587 | Ga0501071_0022117 | Ga0501071_0022117_1240_2457 | 385 |
| 253 | 3300049589 | Ga0501073_0005104 | Ga0501073_0005104_5882_7099 | 385 |
| 254 | 3300049822 | Ga0501035_0007867 | Ga0501035_0007867_1965_3170 | 385 |
| 255 | 3300049823 | Ga0501044_0025719 | Ga0501044_0025719_1986_3191 | 385 |
| 256 | 3300049823 | Ga0501044_0102835 | Ga0501044_0102835_707_1912 | 385 |
| 257 | 3300054114 | Ga0501084_0013369 | Ga0501084_0013369_5516_6733 | 385 |
| 258 | iso_pu_bacteria | 2582580736 | 2583152661 | 385 |
| 259 | iso_pu_bacteria | 2795385472 | 2795795731 | 385 |
| 260 | iso_pu_bacteria | 2899359706 | 2899361660 | 385 |
| 261 | iso_pu_bacteria | 2899370129 | 2899373078 | 385 |
| 262 | 3300005618 | Ga0068864_100000053 | Ga0068864_10000005347 | 386 |
| 263 | 3300005937 | Ga0081455_10089101 | Ga0081455_100891012 | 386 |
| 264 | 3300026095 | Ga0207676_10000094 | Ga0207676_1000009425 | 386 |
| 265 | 3300033179 | Ga0307507_10002484 | Ga0307507_100024846 | 386 |
| 266 | 3300045049 | Ga0466959_0050133 | Ga0466959_0050133_1787_3025 | 386 |
| 267 | 3300044694 | Ga0466963_0084469 | Ga0466963_0084469_44_1258 | 387 |
| 268 | 3300044706 | Ga0466964_0019908 | Ga0466964_0019908_187_1401 | 387 |
| 269 | 3300047321 | Ga0495676_0027971 | Ga0495676_0027971_3249_4445 | 387 |
| 270 | iso_pu_bacteria | 2643221681 | 2644457230 | 387 |
| 271 | iso_pu_bacteria | 2643221961 | 2645719556 | 387 |
| 272 | iso_pu_bacteria | 2643221962 | 2645726459 | 387 |
| 273 | iso_pu_bacteria | 2739367898 | 2740169324 | 387 |
| 274 | iso_pu_bacteria | 2773857762 | 2774392211 | 387 |
| 275 | iso_pu_bacteria | 2808606439 | 2809196012 | 387 |
| 276 | iso_pu_bacteria | 2811994878 | 2812351852 | 387 |
| 277 | iso_pu_bacteria | 2855386786 | 2855387165 | 387 |
| 278 | iso_pu_bacteria | 2857481737 | 2857482518 | 387 |
| 279 | iso_pu_bacteria | 2891968417 | 2891970512 | 387 |
| 280 | 3300009148 | Ga0105243_10009602 | Ga0105243_100096025 | 388 |
| 281 | 3300009553 | Ga0105249_10148463 | Ga0105249_101484631 | 388 |
| 282 | 3300031824 | Ga0307413_10005794 | Ga0307413_100057947 | 388 |
| 283 | 3300041404 | Ga0439436_0007563 | Ga0439436_0007563_1789_2994 | 388 |
| 284 | 3300041405 | Ga0439438_028297 | Ga0439438_028297_59_1264 | 388 |
| 285 | 3300041407 | Ga0439447_000769 | Ga0439447_000769_7212_8417 | 388 |
| 286 | 3300041411 | Ga0439466_0001145 | Ga0439466_0001145_6805_8010 | 388 |
| 287 | 3300042006 | Ga0439432_002550 | Ga0439432_002550_4005_5210 | 388 |
| 288 | 3300042010 | Ga0439452_001054 | Ga0439452_001054_3102_4307 | 388 |
| 289 | 3300042156 | Ga0439446_0000840 | Ga0439446_0000840_158_1363 | 388 |
| 290 | 3300042435 | Ga0439434_0000780 | Ga0439434_0000780_7403_8608 | 388 |
| 291 | 3300045976 | Ga0466967_0043094 | Ga0466967_0043094_948_2153 | 388 |
| 292 | 3300048910 | Ga0496107_0095337 | Ga0496107_0095337_279_1496 | 388 |
| 293 | 3300048916 | Ga0496113_0010757 | Ga0496113_0010757_3403_4611 | 388 |
| 294 | 3300049822 | Ga0501035_0300316 | Ga0501035_0300316_106_1320 | 388 |
| 295 | iso_pu_bacteria | 2643221615 | 2644089080 | 388 |
| 296 | iso_pu_bacteria | 2643221697 | 2644537632 | 388 |
| 297 | 3300005337 | Ga0070682_100000117 | Ga0070682_10000011756 | 389 |
| 298 | 3300005435 | Ga0070714_100023646 | Ga0070714_1000236461 | 389 |
| 299 | 3300005435 | Ga0070714_100052576 | Ga0070714_1000525762 | 389 |
| 300 | 3300005436 | Ga0070713_100057834 | Ga0070713_1000578342 | 389 |
| 301 | 3300005548 | Ga0070665_100001502 | Ga0070665_1000015025 | 389 |
| 302 | 3300005985 | Ga0081539_10002609 | Ga0081539_100026094 | 389 |
| 303 | 3300006028 | Ga0070717_10083720 | Ga0070717_100837202 | 389 |
| 304 | 3300022467 | Ga0224712_10044474 | Ga0224712_100444742 | 389 |
| 305 | 3300025929 | Ga0207664_10032387 | Ga0207664_100323872 | 389 |
| 306 | 3300038735 | Ga0400485_08597 | Ga0400485_08597_14805_16010 | 389 |
| 307 | 3300038741 | Ga0400488_44500 | Ga0400488_44500_1605_2810 | 389 |
| 308 | 3300038742 | Ga0400486_21500 | Ga0400486_21500_47002_48207 | 389 |
| 309 | 3300039437 | Ga0436365_0018303 | Ga0436365_0018303_358_1584 | 389 |
| 310 | 3300044694 | Ga0466963_0112747 | Ga0466963_0112747_282_1487 | 389 |
| 311 | 3300046460 | Ga0495638_0037115 | Ga0495638_0037115_929_2137 | 389 |
| 312 | 3300046529 | Ga0495652_0083622 | Ga0495652_0083622_653_1885 | 389 |
| 313 | 3300049581 | Ga0501047_0246814 | Ga0501047_0246814_119_1327 | 389 |
| 314 | 3300050513 | nmdc:mga0rr50_104887_c1 | nmdc:mga0rr50_104887_c1_658_1866 | 389 |
| 315 | 3300053117 | Ga0500593_000263 | Ga0500593_000263_2017_3231 | 389 |
| 316 | 3300005329 | Ga0070683_100045129 | Ga0070683_1000451292 | 390 |
| 317 | 3300005329 | Ga0070683_100240051 | Ga0070683_1002400512 | 390 |
| 318 | 3300005335 | Ga0070666_10016832 | Ga0070666_100168322 | 390 |
| 319 | 3300005338 | Ga0068868_100000878 | Ga0068868_10000087821 | 390 |
| 320 | 3300005340 | Ga0070689_100114918 | Ga0070689_1001149183 | 390 |
| 321 | 3300005344 | Ga0070661_100001375 | Ga0070661_10000137510 | 390 |
| 322 | 3300005347 | Ga0070668_100012580 | Ga0070668_1000125805 | 390 |
| 323 | 3300005353 | Ga0070669_100013344 | Ga0070669_1000133444 | 390 |
| 324 | 3300005354 | Ga0070675_100000111 | Ga0070675_10000011113 | 390 |
| 325 | 3300005366 | Ga0070659_100000002 | Ga0070659_100000002329 | 390 |
| 326 | 3300005366 | Ga0070659_100038648 | Ga0070659_1000386483 | 390 |
| 327 | 3300005367 | Ga0070667_100009407 | Ga0070667_1000094075 | 390 |
| 328 | 3300005435 | Ga0070714_100003420 | Ga0070714_10000342011 | 390 |
| 329 | 3300005435 | Ga0070714_100030746 | Ga0070714_1000307463 | 390 |
| 330 | 3300005435 | Ga0070714_100148679 | Ga0070714_1001486792 | 390 |
| 331 | 3300005436 | Ga0070713_100000390 | Ga0070713_10000039010 | 390 |
| 332 | 3300005437 | Ga0070710_10000006 | Ga0070710_1000000697 | 390 |
| 333 | 3300005471 | Ga0070698_100002059 | Ga0070698_1000020594 | 390 |
| 334 | 3300005530 | Ga0070679_100009133 | Ga0070679_1000091334 | 390 |
| 335 | 3300005535 | Ga0070684_100011369 | Ga0070684_1000113693 | 390 |
| 336 | 3300005543 | Ga0070672_100000015 | Ga0070672_10000001521 | 390 |
| 337 | 3300005548 | Ga0070665_100217255 | Ga0070665_1002172551 | 390 |
| 338 | 3300005578 | Ga0068854_100000183 | Ga0068854_10000018327 | 390 |
| 339 | 3300005614 | Ga0068856_100000757 | Ga0068856_1000007574 | 390 |
| 340 | 3300005616 | Ga0068852_100000093 | Ga0068852_1000000939 | 390 |
| 341 | 3300005834 | Ga0068851_10011784 | Ga0068851_100117843 | 390 |
| 342 | 3300005841 | Ga0068863_100003824 | Ga0068863_1000038242 | 390 |
| 343 | 3300005841 | Ga0068863_100023158 | Ga0068863_1000231584 | 390 |
| 344 | 3300005983 | Ga0081540_1000049 | Ga0081540_100004952 | 390 |
| 345 | 3300005985 | Ga0081539_10040313 | Ga0081539_100403132 | 390 |
| 346 | 3300006028 | Ga0070717_10000005 | Ga0070717_10000005161 | 390 |
| 347 | 3300006038 | Ga0075365_10059039 | Ga0075365_100590392 | 390 |
| 348 | 3300006042 | Ga0075368_10049932 | Ga0075368_100499322 | 390 |
| 349 | 3300006042 | Ga0075368_10067331 | Ga0075368_100673312 | 390 |
| 350 | 3300006048 | Ga0075363_100021867 | Ga0075363_1000218672 | 390 |
| 351 | 3300006051 | Ga0075364_10008289 | Ga0075364_100082894 | 390 |
| 352 | 3300006051 | Ga0075364_10008329 | Ga0075364_100083295 | 390 |
| 353 | 3300006175 | Ga0070712_100008485 | Ga0070712_1000084855 | 390 |
| 354 | 3300006177 | Ga0075362_10003323 | Ga0075362_100033232 | 390 |
| 355 | 3300006178 | Ga0075367_10012558 | Ga0075367_100125583 | 390 |
| 356 | 3300006353 | Ga0075370_10000475 | Ga0075370_1000047511 | 390 |
| 357 | 3300006353 | Ga0075370_10001223 | Ga0075370_100012232 | 390 |
| 358 | 3300006880 | Ga0075429_100003759 | Ga0075429_1000037597 | 390 |
| 359 | 3300006881 | Ga0068865_100001277 | Ga0068865_1000012775 | 390 |
| 360 | 3300009093 | Ga0105240_10108860 | Ga0105240_101088603 | 390 |
| 361 | 3300009094 | Ga0111539_10099425 | Ga0111539_100994252 | 390 |
| 362 | 3300009098 | Ga0105245_10001831 | Ga0105245_100018319 | 390 |
| 363 | 3300009098 | Ga0105245_10024675 | Ga0105245_100246752 | 390 |
| 364 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008360 | 390 |
| 365 | 3300010375 | Ga0105239_10056910 | Ga0105239_100569104 | 390 |
| 366 | 3300010375 | Ga0105239_10073144 | Ga0105239_100731442 | 390 |
| 367 | 3300011119 | Ga0105246_10008649 | Ga0105246_100086495 | 390 |
| 368 | 3300013104 | Ga0157370_10073477 | Ga0157370_100734774 | 390 |
| 369 | 3300013105 | Ga0157369_10000110 | Ga0157369_10000110102 | 390 |
| 370 | 3300013296 | Ga0157374_10165305 | Ga0157374_101653052 | 390 |
| 371 | 3300013297 | Ga0157378_10042428 | Ga0157378_100424282 | 390 |
| 372 | 3300013306 | Ga0163162_10482755 | Ga0163162_104827551 | 390 |
| 373 | 3300013307 | Ga0157372_10001384 | Ga0157372_1000138418 | 390 |
| 374 | 3300013308 | Ga0157375_10039653 | Ga0157375_100396532 | 390 |
| 375 | 3300014326 | Ga0157380_10000843 | Ga0157380_1000084311 | 390 |
| 376 | 3300014969 | Ga0157376_10064613 | Ga0157376_100646132 | 390 |
| 377 | 3300025321 | Ga0207656_10002156 | Ga0207656_100021562 | 390 |
| 378 | 3300025321 | Ga0207656_10002232 | Ga0207656_100022324 | 390 |
| 379 | 3300025898 | Ga0207692_10000001 | Ga0207692_10000001134 | 390 |
| 380 | 3300025909 | Ga0207705_10050406 | Ga0207705_100504062 | 390 |
| 381 | 3300025913 | Ga0207695_10226847 | Ga0207695_102268471 | 390 |
| 382 | 3300025915 | Ga0207693_10006065 | Ga0207693_100060657 | 390 |
| 383 | 3300025916 | Ga0207663_10079161 | Ga0207663_100791612 | 390 |
| 384 | 3300025920 | Ga0207649_10004012 | Ga0207649_100040127 | 390 |
| 385 | 3300025922 | Ga0207646_10287884 | Ga0207646_102878841 | 390 |
| 386 | 3300025923 | Ga0207681_10008037 | Ga0207681_100080374 | 390 |
| 387 | 3300025925 | Ga0207650_10040316 | Ga0207650_100403162 | 390 |
| 388 | 3300025926 | Ga0207659_10000010 | Ga0207659_10000010110 | 390 |
| 389 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007378 | 390 |
| 390 | 3300025927 | Ga0207687_10002454 | Ga0207687_1000245411 | 390 |
| 391 | 3300025928 | Ga0207700_10000027 | Ga0207700_10000027105 | 390 |
| 392 | 3300025929 | Ga0207664_10000529 | Ga0207664_1000052911 | 390 |
| 393 | 3300025929 | Ga0207664_10012473 | Ga0207664_100124731 | 390 |
| 394 | 3300025929 | Ga0207664_10125303 | Ga0207664_101253032 | 390 |
| 395 | 3300025932 | Ga0207690_10000088 | Ga0207690_1000008840 | 390 |
| 396 | 3300025936 | Ga0207670_10020188 | Ga0207670_100201883 | 390 |
| 397 | 3300025938 | Ga0207704_10000093 | Ga0207704_1000009340 | 390 |
| 398 | 3300025940 | Ga0207691_10000044 | Ga0207691_1000004446 | 390 |
| 399 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006754 | 390 |
| 400 | 3300025944 | Ga0207661_10010771 | Ga0207661_100107714 | 390 |
| 401 | 3300025944 | Ga0207661_10087624 | Ga0207661_100876242 | 390 |
| 402 | 3300025981 | Ga0207640_10000200 | Ga0207640_1000020011 | 390 |
| 403 | 3300025986 | Ga0207658_10003525 | Ga0207658_100035252 | 390 |
| 404 | 3300026023 | Ga0207677_10003263 | Ga0207677_100032633 | 390 |
| 405 | 3300026067 | Ga0207678_10014283 | Ga0207678_100142834 | 390 |
| 406 | 3300026078 | Ga0207702_10000060 | Ga0207702_1000006029 | 390 |
| 407 | 3300026078 | Ga0207702_10061229 | Ga0207702_100612292 | 390 |
| 408 | 3300026142 | Ga0207698_10000440 | Ga0207698_1000044015 | 390 |
| 409 | 3300027866 | Ga0209813_10002809 | Ga0209813_100028093 | 390 |
| 410 | 3300027866 | Ga0209813_10030764 | Ga0209813_100307642 | 390 |
| 411 | 3300028379 | Ga0268266_10000285 | Ga0268266_100002854 | 390 |
| 412 | 3300028379 | Ga0268266_10005034 | Ga0268266_100050347 | 390 |
| 413 | 3300028558 | Ga0265326_10000003 | Ga0265326_1000000355 | 390 |
| 414 | 3300028563 | Ga0265319_1000664 | Ga0265319_10006644 | 390 |
| 415 | 3300028666 | Ga0265336_10004622 | Ga0265336_100046223 | 390 |
| 416 | 3300028800 | Ga0265338_10000844 | Ga0265338_1000084418 | 390 |
| 417 | 3300029957 | Ga0265324_10001900 | Ga0265324_100019005 | 390 |
| 418 | 3300031995 | Ga0307409_100033771 | Ga0307409_1000337712 | 390 |
| 419 | 3300032004 | Ga0307414_10061438 | Ga0307414_100614382 | 390 |
| 420 | 3300032126 | Ga0307415_100003742 | Ga0307415_1000037423 | 390 |
| 421 | 3300037418 | Ga0395900_0092948 | Ga0395900_0092948_365_1582 | 390 |
| 422 | 3300037466 | Ga0395898_0004969 | Ga0395898_0004969_10740_11954 | 390 |
| 423 | 3300044842 | Ga0466957_0021361 | Ga0466957_0021361_2541_3749 | 390 |
| 424 | 3300044901 | Ga0466960_0000222 | Ga0466960_0000222_40_1254 | 390 |
| 425 | 3300045976 | Ga0466967_0050219 | Ga0466967_0050219_295_1602 | 390 |
| 426 | 3300045976 | Ga0466967_0055985 | Ga0466967_0055985_2019_3233 | 390 |
| 427 | 3300045976 | Ga0466967_0082168 | Ga0466967_0082168_276_1487 | 390 |
| 428 | 3300046459 | Ga0495629_0005201 | Ga0495629_0005201_34_1239 | 390 |
| 429 | 3300046475 | Ga0495639_0084345 | Ga0495639_0084345_66_1277 | 390 |
| 430 | 3300046507 | Ga0495606_0000565 | Ga0495606_0000565_43572_44777 | 390 |
| 431 | 3300046511 | Ga0495608_0000068 | Ga0495608_0000068_69890_71095 | 390 |
| 432 | 3300046517 | Ga0495630_0000056 | Ga0495630_0000056_80750_81955 | 390 |
| 433 | 3300046674 | Ga0495588_0000165 | Ga0495588_0000165_9307_10512 | 390 |
| 434 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_113639_114844 | 390 |
| 435 | 3300046681 | Ga0495647_0000018 | Ga0495647_0000018_12733_13938 | 390 |
| 436 | 3300046689 | Ga0495613_0000179 | Ga0495613_0000179_13067_14272 | 390 |
| 437 | 3300046690 | Ga0495624_0000008 | Ga0495624_0000008_138017_139222 | 390 |
| 438 | 3300046690 | Ga0495624_0000073 | Ga0495624_0000073_46345_47550 | 390 |
| 439 | 3300046809 | Ga0495600_0016433 | Ga0495600_0016433_471_1676 | 390 |
| 440 | 3300047317 | Ga0495604_0000357 | Ga0495604_0000357_7188_8393 | 390 |
| 441 | 3300047317 | Ga0495604_0167644 | Ga0495604_0167644_157_1362 | 390 |
| 442 | 3300047321 | Ga0495676_0038541 | Ga0495676_0038541_2115_3320 | 390 |
| 443 | 3300047444 | Ga0495675_0000175 | Ga0495675_0000175_45322_46527 | 390 |
| 444 | 3300047673 | Ga0495593_0061865 | Ga0495593_0061865_605_1810 | 390 |
| 445 | 3300048088 | Ga0495602_0002588 | Ga0495602_0002588_7886_9091 | 390 |
| 446 | 3300048903 | Ga0496100_0000018 | Ga0496100_0000018_139407_140612 | 390 |
| 447 | 3300048903 | Ga0496100_0003651 | Ga0496100_0003651_3588_4805 | 390 |
| 448 | 3300048904 | Ga0496101_0000062 | Ga0496101_0000062_52615_53820 | 390 |
| 449 | 3300048904 | Ga0496101_0004877 | Ga0496101_0004877_3997_5214 | 390 |
| 450 | 3300048905 | Ga0496102_0010620 | Ga0496102_0010620_3673_4884 | 390 |
| 451 | 3300048909 | Ga0496106_0000122 | Ga0496106_0000122_58589_59794 | 390 |
| 452 | 3300048910 | Ga0496107_0000006 | Ga0496107_0000006_208330_209535 | 390 |
| 453 | 3300048910 | Ga0496107_0019934 | Ga0496107_0019934_1850_3061 | 390 |
| 454 | 3300048911 | Ga0496108_0000062 | Ga0496108_0000062_114580_115785 | 390 |
| 455 | 3300048911 | Ga0496108_0009387 | Ga0496108_0009387_5389_6606 | 390 |
| 456 | 3300048912 | Ga0496109_0000121 | Ga0496109_0000121_67660_68865 | 390 |
| 457 | 3300048912 | Ga0496109_0000129 | Ga0496109_0000129_66893_68101 | 390 |
| 458 | 3300048913 | Ga0496110_0000089 | Ga0496110_0000089_78_1286 | 390 |
| 459 | 3300048914 | Ga0496111_0076543 | Ga0496111_0076543_85_1290 | 390 |
| 460 | 3300048914 | Ga0496111_0182051 | Ga0496111_0182051_92_1309 | 390 |
| 461 | 3300048915 | Ga0496112_0001770 | Ga0496112_0001770_9935_11143 | 390 |
| 462 | 3300048916 | Ga0496113_0000628 | Ga0496113_0000628_6618_7826 | 390 |
| 463 | 3300048916 | Ga0496113_0021542 | Ga0496113_0021542_348_1562 | 390 |
| 464 | 3300048919 | Ga0496116_0001565 | Ga0496116_0001565_12554_13765 | 390 |
| 465 | 3300048921 | Ga0496118_0000818 | Ga0496118_0000818_35704_36915 | 390 |
| 466 | 3300048922 | Ga0496119_0052566 | Ga0496119_0052566_1057_2268 | 390 |
| 467 | 3300048923 | Ga0496120_0007169 | Ga0496120_0007169_6965_8176 | 390 |
| 468 | 3300048924 | Ga0496121_0006714 | Ga0496121_0006714_7755_8966 | 390 |
| 469 | 3300048924 | Ga0496121_0062775 | Ga0496121_0062775_140_1354 | 390 |
| 470 | 3300048928 | Ga0496125_0007232 | Ga0496125_0007232_2197_3408 | 390 |
| 471 | 3300049569 | Ga0501032_0051764 | Ga0501032_0051764_700_1911 | 390 |
| 472 | 3300049571 | Ga0501034_0066247 | Ga0501034_0066247_166_1377 | 390 |
| 473 | 3300049572 | Ga0501036_0024665 | Ga0501036_0024665_2234_3445 | 390 |
| 474 | 3300049574 | Ga0501038_0112865 | Ga0501038_0112865_123_1343 | 390 |
| 475 | 3300049578 | Ga0501042_0119524 | Ga0501042_0119524_68_1279 | 390 |
| 476 | 3300049580 | Ga0501046_0000799 | Ga0501046_0000799_28233_29444 | 390 |
| 477 | 3300049581 | Ga0501047_0067942 | Ga0501047_0067942_1175_2386 | 390 |
| 478 | 3300049581 | Ga0501047_0127282 | Ga0501047_0127282_160_1371 | 390 |
| 479 | 3300049581 | Ga0501047_0360799 | Ga0501047_0360799_37_1257 | 390 |
| 480 | 3300049582 | Ga0501048_0196308 | Ga0501048_0196308_52_1263 | 390 |
| 481 | 3300049583 | Ga0501067_0006652 | Ga0501067_0006652_4583_5803 | 390 |
| 482 | 3300049584 | Ga0501068_0166982 | Ga0501068_0166982_112_1323 | 390 |
| 483 | 3300049585 | Ga0501069_0022967 | Ga0501069_0022967_2048_3259 | 390 |
| 484 | 3300049585 | Ga0501069_0076805 | Ga0501069_0076805_184_1398 | 390 |
| 485 | 3300049586 | Ga0501070_0000651 | Ga0501070_0000651_2165_3376 | 390 |
| 486 | 3300049586 | Ga0501070_0149318 | Ga0501070_0149318_585_1796 | 390 |
| 487 | 3300049586 | Ga0501070_0152198 | Ga0501070_0152198_587_1807 | 390 |
| 488 | 3300049589 | Ga0501073_0003023 | Ga0501073_0003023_4213_5433 | 390 |
| 489 | 3300049590 | Ga0501074_0007354 | Ga0501074_0007354_625_1845 | 390 |
| 490 | 3300049590 | Ga0501074_0022863 | Ga0501074_0022863_1549_2760 | 390 |
| 491 | 3300049822 | Ga0501035_0035100 | Ga0501035_0035100_2165_3376 | 390 |
| 492 | 3300049822 | Ga0501035_0051830 | Ga0501035_0051830_1258_2469 | 390 |
| 493 | 3300049823 | Ga0501044_0039969 | Ga0501044_0039969_1204_2415 | 390 |
| 494 | 3300049823 | Ga0501044_0097462 | Ga0501044_0097462_1570_2781 | 390 |
| 495 | 3300050490 | nmdc:mga03n38_16770_c1 | nmdc:mga03n38_16770_c1_1582_2796 | 390 |
| 496 | 3300050491 | nmdc:mga00v17_41493_c1 | nmdc:mga00v17_41493_c1_1474_2688 | 390 |
| 497 | 3300050491 | nmdc:mga00v17_96767_c1 | nmdc:mga00v17_96767_c1_329_1543 | 390 |
| 498 | 3300050492 | nmdc:mga0yw44_39718_c1 | nmdc:mga0yw44_39718_c1_800_2014 | 390 |
| 499 | 3300050495 | nmdc:mga04h51_8902_c1 | nmdc:mga04h51_8902_c1_1259_2473 | 390 |
| 500 | 3300050496 | nmdc:mga07m45_14203_c1 | nmdc:mga07m45_14203_c1_2934_4148 | 390 |
| 501 | 3300050508 | nmdc:mga09592_12744_c1 | nmdc:mga09592_12744_c1_2741_3955 | 390 |
| 502 | 3300053077 | Ga0495601_0000013 | Ga0495601_0000013_92206_93411 | 390 |
| 503 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_113639_114844 | 390 |
| 504 | 3300053084 | Ga0495595_0031516 | Ga0495595_0031516_1051_2256 | 390 |
| 505 | 3300053085 | Ga0495619_0000031 | Ga0495619_0000031_87208_88416 | 390 |
| 506 | 3300053085 | Ga0495619_0000257 | Ga0495619_0000257_54_1259 | 390 |
| 507 | 3300053088 | Ga0500644_0000541 | Ga0500644_0000541_10074_11288 | 390 |
| 508 | 3300053094 | Ga0500566_0098016 | Ga0500566_0098016_48_1259 | 390 |
| 509 | 3300060353 | Ga0501082_0033473 | Ga0501082_0033473_1590_2801 | 390 |
| 510 | 3300060353 | Ga0501082_0101790 | Ga0501082_0101790_122_1342 | 390 |
| 511 | 3300061719 | Ga0466962_0061612 | Ga0466962_0061612_29_1246 | 390 |
| 512 | 3300005458 | Ga0070681_10025949 | Ga0070681_100259491 | 391 |
| 513 | 3300005530 | Ga0070679_100000068 | Ga0070679_10000006828 | 391 |
| 514 | 3300005547 | Ga0070693_100001745 | Ga0070693_1000017451 | 391 |
| 515 | 3300005548 | Ga0070665_100000106 | Ga0070665_10000010680 | 391 |
| 516 | 3300005842 | Ga0068858_100000009 | Ga0068858_100000009237 | 391 |
| 517 | 3300005843 | Ga0068860_100000400 | Ga0068860_10000040040 | 391 |
| 518 | 3300006038 | Ga0075365_10003743 | Ga0075365_100037437 | 391 |
| 519 | 3300009098 | Ga0105245_10001895 | Ga0105245_1000189510 | 391 |
| 520 | 3300009176 | Ga0105242_10038851 | Ga0105242_100388512 | 391 |
| 521 | 3300013297 | Ga0157378_10031281 | Ga0157378_100312814 | 391 |
| 522 | 3300025912 | Ga0207707_10011031 | Ga0207707_100110315 | 391 |
| 523 | 3300025917 | Ga0207660_10013455 | Ga0207660_100134553 | 391 |
| 524 | 3300025921 | Ga0207652_10000044 | Ga0207652_1000004430 | 391 |
| 525 | 3300025927 | Ga0207687_10001023 | Ga0207687_100010237 | 391 |
| 526 | 3300026035 | Ga0207703_10000023 | Ga0207703_10000023142 | 391 |
| 527 | 3300026041 | Ga0207639_10027752 | Ga0207639_100277522 | 391 |
| 528 | 3300026078 | Ga0207702_10003333 | Ga0207702_100033332 | 391 |
| 529 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047232 | 391 |
| 530 | 3300032002 | Ga0307416_100193848 | Ga0307416_1001938481 | 391 |
| 531 | 3300032126 | Ga0307415_100041426 | Ga0307415_1000414262 | 391 |
| 532 | 3300036401 | Ga0373937_0022173 | Ga0373937_0022173_3046_4266 | 391 |
| 533 | 3300044684 | Ga0466966_0016687 | Ga0466966_0016687_47_1264 | 391 |
| 534 | 3300044765 | Ga0466970_0153435 | Ga0466970_0153435_31_1248 | 391 |
| 535 | 3300044901 | Ga0466960_0002576 | Ga0466960_0002576_2756_3973 | 391 |
| 536 | 3300046454 | Ga0495592_0101174 | Ga0495592_0101174_748_1959 | 391 |
| 537 | 3300046454 | Ga0495592_0132251 | Ga0495592_0132251_500_1720 | 391 |
| 538 | 3300046461 | Ga0495641_0000874 | Ga0495641_0000874_13631_14851 | 391 |
| 539 | 3300046462 | Ga0495651_0119930 | Ga0495651_0119930_65_1285 | 391 |
| 540 | 3300046463 | Ga0495653_0035665 | Ga0495653_0035665_641_1855 | 391 |
| 541 | 3300046516 | Ga0495628_0123099 | Ga0495628_0123099_754_1974 | 391 |
| 542 | 3300046517 | Ga0495630_0064261 | Ga0495630_0064261_58_1278 | 391 |
| 543 | 3300046529 | Ga0495652_0004685 | Ga0495652_0004685_10133_11353 | 391 |
| 544 | 3300046543 | Ga0495645_0002246 | Ga0495645_0002246_9865_11082 | 391 |
| 545 | 3300046543 | Ga0495645_0162027 | Ga0495645_0162027_12_1232 | 391 |
| 546 | 3300046642 | Ga0495634_0007615 | Ga0495634_0007615_626_1846 | 391 |
| 547 | 3300046678 | Ga0495599_0013295 | Ga0495599_0013295_996_2216 | 391 |
| 548 | 3300046694 | Ga0495649_0000751 | Ga0495649_0000751_62_1282 | 391 |
| 549 | 3300047322 | Ga0495680_0000496 | Ga0495680_0000496_5824_7044 | 391 |
| 550 | 3300048907 | Ga0496104_0000650 | Ga0496104_0000650_20807_22015 | 391 |
| 551 | 3300048908 | Ga0496105_0000347 | Ga0496105_0000347_9712_10920 | 391 |
| 552 | 3300048908 | Ga0496105_0082806 | Ga0496105_0082806_1114_2340 | 391 |
| 553 | 3300048913 | Ga0496110_0032801 | Ga0496110_0032801_87_1307 | 391 |
| 554 | 3300048914 | Ga0496111_0147610 | Ga0496111_0147610_410_1630 | 391 |
| 555 | 3300048917 | Ga0496114_0045004 | Ga0496114_0045004_214_1440 | 391 |
| 556 | 3300049569 | Ga0501032_0014608 | Ga0501032_0014608_1726_2940 | 391 |
| 557 | 3300049571 | Ga0501034_0024940 | Ga0501034_0024940_811_2028 | 391 |
| 558 | 3300049578 | Ga0501042_0007948 | Ga0501042_0007948_931_2145 | 391 |
| 559 | 3300049582 | Ga0501048_0017290 | Ga0501048_0017290_4020_5234 | 391 |
| 560 | 3300049586 | Ga0501070_0215519 | Ga0501070_0215519_183_1397 | 391 |
| 561 | 3300049588 | Ga0501072_0008263 | Ga0501072_0008263_5385_6599 | 391 |
| 562 | 3300049590 | Ga0501074_0097880 | Ga0501074_0097880_276_1490 | 391 |
| 563 | 3300049592 | Ga0501076_0062993 | Ga0501076_0062993_381_1595 | 391 |
| 564 | 3300049593 | Ga0501077_0017179 | Ga0501077_0017179_1187_2401 | 391 |
| 565 | 3300049741 | Ga0501079_0009411 | Ga0501079_0009411_4481_5695 | 391 |
| 566 | 3300049743 | Ga0501081_0055694 | Ga0501081_0055694_953_2167 | 391 |
| 567 | 3300050492 | nmdc:mga0yw44_13510_c1 | nmdc:mga0yw44_13510_c1_985_2199 | 391 |
| 568 | 3300053077 | Ga0495601_0000124 | Ga0495601_0000124_2859_4079 | 391 |
| 569 | 3300053123 | Ga0500614_012010 | Ga0500614_012010_604_1824 | 391 |
| 570 | 3300053140 | Ga0500573_0043434 | Ga0500573_0043434_1051_2268 | 391 |
| 571 | 3300061734 | Ga0530510_0073683 | Ga0530510_0073683_237_1451 | 391 |
| 572 | 3300001977 | JGI24746J21847_1000677 | JGI24746J21847_10006773 | 392 |
| 573 | 3300005329 | Ga0070683_100002592 | Ga0070683_1000025926 | 392 |
| 574 | 3300025944 | Ga0207661_10001262 | Ga0207661_1000126210 | 392 |
| 575 | 3300044656 | Ga0466969_0040728 | Ga0466969_0040728_559_1794 | 392 |
| 576 | 3300044684 | Ga0466966_0089662 | Ga0466966_0089662_24_1262 | 392 |
| 577 | 3300044693 | Ga0466961_0016137 | Ga0466961_0016137_2925_4166 | 392 |
| 578 | 3300044842 | Ga0466957_0019515 | Ga0466957_0019515_407_1648 | 392 |
| 579 | 3300045049 | Ga0466959_0057183 | Ga0466959_0057183_506_1747 | 392 |
| 580 | 3300048905 | Ga0496102_0183577 | Ga0496102_0183577_94_1332 | 392 |
| 581 | 3300048908 | Ga0496105_0033730 | Ga0496105_0033730_858_2096 | 392 |
| 582 | 3300053078 | Ga0495612_0001051 | Ga0495612_0001051_73_1296 | 392 |
| 583 | 3300061719 | Ga0466962_0002335 | Ga0466962_0002335_6633_7874 | 392 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r7k-assembly1.cif.gz_D | crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196 | 0.7876 | 7 | 383 |
| 2vig-assembly2.cif.gz_G | crystal structure of human short-chain acyl coa dehydrogenase | 0.7831 | 6 | 384 |
| 2vig-assembly1.cif.gz_A | crystal structure of human short-chain acyl coa dehydrogenase | 0.7811 | 6 | 384 |
| 4u83-assembly2.cif.gz_D | structure of brucella abortus butyryl-coa dehydrogenase | 0.7808 | 3 | 382 |
| 2vig-assembly1.cif.gz_B | crystal structure of human short-chain acyl coa dehydrogenase | 0.7797 | 6 | 384 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P95186_131_245_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9436 | 133 | 246 | 2.40.110.10 |
| 4x28B02 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9286 | 131 | 237 | 2.40.110.10 |
| af_P95186_131_245_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.928 | 133 | 246 | 2.40.110.10 |
| 4irnA02 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9236 | 132 | 237 | 2.40.110.10 |
| 4n5fB02 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9173 | 132 | 237 | 2.40.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A399V9H6-F1-model_v4 | deleted | 0.9264 | 2 | 312 |
|
| AF-A0A399V9H6-F1-model_v4 | deleted | 0.9236 | 2 | 312 |
|
| AF-X1A816-F1-model_v4 | Acyl-CoA oxidase/dehydrogenase middle domain-containing protein | 0.8987 | 106 | 231 |
GO:0003995
GO:0050660 |
| AF-A0A164IIM7-F1-model_v4 | Putative Isovaleryl-CoA dehydrogenase | 0.8951 | 106 | 238 |
GO:0003995
GO:0050660 |
| AF-A0A6A8AS54-F1-model_v4 | Acyl-CoA dehydrogenase | 0.8919 | 126 | 247 |
GO:0003995
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar