F466207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 582 | 317 | 577 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300046525|Ga0495663_0058623|Ga0495663_0058623_497_1153 |
| Length | 218 |
| Sequence | LSLPPVAGIAGGVRHRVALGREKEGELQMDKFFGNLHAVLGAGLVLASILMLGLNGQNFEDGAAAAGAVMRWLHTFFGVLWIGLLYYFNFVQIPTMPKIPAELKPGVSKHIAPAALFWFRWAAAATVVLGLAIAGHAKYLVPALSFQDPYKLIGVGMWLGLIMAFNVWFVIWPNQKKALGIVAADDATKAKSAKTAMIFSRTNTLLSIPMLYAMVSFS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 2 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 3 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 4 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 5 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 219 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 223 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 226 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 227 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 269 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 270 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 287 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 303 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 304 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 305 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 310 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 311 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.97 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.42 |
| Nodule | 0 |
| Rhizoplane | 2.58 |
| Rhizosphere | 86.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10135463 | 3300002067 | Bacteria | 710 |
| 2 | JGI25153J46596_10001493 | 3300003215 | Bacteria | 13955 |
| 3 | Ga0055536_1002550 | 3300003781 | Bacteria | 10179 |
| 4 | Ga0055536_1007994 | 3300003781 | Bacteria | 4628 |
| 5 | Ga0055536_1013607 | 3300003781 | Bacteria | 2917 |
| 6 | Ga0055534_1013686 | 3300003784 | Bacteria | 1550 |
| 7 | Ga0055530_10000522 | 3300003791 | Bacteria | 33291 |
| 8 | Ga0055530_10073589 | 3300003791 | Bacteria | 731 |
| 9 | Ga0055531_10002871 | 3300003794 | Bacteria | 11231 |
| 10 | Ga0065704_10308270 | 3300005289 | Bacteria | 873 |
| 11 | Ga0065712_10318943 | 3300005290 | Bacteria | 832 |
| 12 | Ga0065715_10530377 | 3300005293 | Bacteria | 756 |
| 13 | Ga0065707_10168593 | 3300005295 | Bacteria | 1502 |
| 14 | Ga0070676_10019938 | 3300005328 | Bacteria | 3736 |
| 15 | Ga0070683_100053606 | 3300005329 | Bacteria | 3737 |
| 16 | Ga0070683_100121420 | 3300005329 | Bacteria | 2468 |
| 17 | Ga0070690_100060358 | 3300005330 | Bacteria | 2440 |
| 18 | Ga0070690_100169261 | 3300005330 | Bacteria | 1503 |
| 19 | Ga0070670_100000570 | 3300005331 | Bacteria | 29190 |
| 20 | Ga0070670_100028698 | 3300005331 | Bacteria | 4789 |
| 21 | Ga0070670_100078166 | 3300005331 | Bacteria | 2842 |
| 22 | Ga0070670_100645169 | 3300005331 | Bacteria | 949 |
| 23 | Ga0070677_10085856 | 3300005333 | Bacteria | 1358 |
| 24 | Ga0070682_100995762 | 3300005337 | Bacteria | 695 |
| 25 | Ga0068868_100000063 | 3300005338 | Bacteria | 61783 |
| 26 | Ga0068868_100004436 | 3300005338 | Bacteria | 9841 |
| 27 | Ga0068868_101070760 | 3300005338 | Bacteria | 741 |
| 28 | Ga0070660_100019823 | 3300005339 | Bacteria | 4934 |
| 29 | Ga0070689_100009271 | 3300005340 | Bacteria | 6973 |
| 30 | Ga0070689_100121635 | 3300005340 | Bacteria | 2085 |
| 31 | Ga0070687_100185033 | 3300005343 | Bacteria | 1251 |
| 32 | Ga0070687_100247443 | 3300005343 | Bacteria | 1106 |
| 33 | Ga0070687_100290079 | 3300005343 | Bacteria | 1034 |
| 34 | Ga0070661_100019873 | 3300005344 | Bacteria | 4786 |
| 35 | Ga0070668_100000001 | 3300005347 | Bacteria | 275905 |
| 36 | Ga0070668_100074846 | 3300005347 | Bacteria | 2643 |
| 37 | Ga0070668_100299186 | 3300005347 | Bacteria | 1349 |
| 38 | Ga0070669_100022464 | 3300005353 | Bacteria | 4510 |
| 39 | Ga0070669_100345079 | 3300005353 | Bacteria | 1207 |
| 40 | Ga0070675_100004568 | 3300005354 | Bacteria | 10566 |
| 41 | Ga0070675_100015141 | 3300005354 | Bacteria | 6090 |
| 42 | Ga0070675_100127337 | 3300005354 | Bacteria | 2168 |
| 43 | Ga0070675_100264366 | 3300005354 | Bacteria | 1508 |
| 44 | Ga0070675_100272925 | 3300005354 | Bacteria | 1484 |
| 45 | Ga0070671_100000167 | 3300005355 | Bacteria | 43269 |
| 46 | Ga0070671_100136363 | 3300005355 | Bacteria | 2069 |
| 47 | Ga0070671_100197770 | 3300005355 | Bacteria | 1704 |
| 48 | Ga0070671_100351490 | 3300005355 | Bacteria | 1258 |
| 49 | Ga0070674_100008899 | 3300005356 | Bacteria | 5994 |
| 50 | Ga0070674_100073308 | 3300005356 | Bacteria | 2426 |
| 51 | Ga0070674_100202326 | 3300005356 | Bacteria | 1534 |
| 52 | Ga0070673_100102438 | 3300005364 | Bacteria | 2360 |
| 53 | Ga0070659_100000034 | 3300005366 | Bacteria | 115416 |
| 54 | Ga0070667_100000006 | 3300005367 | Bacteria | 336732 |
| 55 | Ga0070667_100171897 | 3300005367 | Bacteria | 1913 |
| 56 | Ga0070701_10130632 | 3300005438 | Bacteria | 1426 |
| 57 | Ga0070705_100068326 | 3300005440 | Bacteria | 2138 |
| 58 | Ga0070705_100243702 | 3300005440 | Bacteria | 1258 |
| 59 | Ga0070705_100609465 | 3300005440 | Bacteria | 846 |
| 60 | Ga0070700_100106550 | 3300005441 | Bacteria | 1856 |
| 61 | Ga0070694_100106377 | 3300005444 | Bacteria | 1992 |
| 62 | Ga0070694_100130111 | 3300005444 | Unclassified | 1817 |
| 63 | Ga0070694_100162686 | 3300005444 | Bacteria | 1639 |
| 64 | Ga0070694_100188574 | 3300005444 | Bacteria | 1530 |
| 65 | Ga0070708_100137586 | 3300005445 | Unclassified | 2263 |
| 66 | Ga0070663_100201931 | 3300005455 | Bacteria | 1552 |
| 67 | Ga0070678_100019701 | 3300005456 | Bacteria | 4407 |
| 68 | Ga0070678_100053499 | 3300005456 | Bacteria | 2936 |
| 69 | Ga0070662_100063538 | 3300005457 | Bacteria | 2701 |
| 70 | Ga0070662_100941763 | 3300005457 | Bacteria | 738 |
| 71 | Ga0070681_10077083 | 3300005458 | Bacteria | 3291 |
| 72 | Ga0068867_100006451 | 3300005459 | Bacteria | 8284 |
| 73 | Ga0068867_100104461 | 3300005459 | Bacteria | 2168 |
| 74 | Ga0068867_100229217 | 3300005459 | Bacteria | 1501 |
| 75 | Ga0068867_100324926 | 3300005459 | Bacteria | 1276 |
| 76 | Ga0070685_10285373 | 3300005466 | Bacteria | 1107 |
| 77 | Ga0070685_10360115 | 3300005466 | Bacteria | 997 |
| 78 | Ga0070706_100107619 | 3300005467 | Bacteria | 2594 |
| 79 | Ga0070707_100011178 | 3300005468 | Bacteria | 8366 |
| 80 | Ga0070707_100419461 | 3300005468 | Bacteria | 1299 |
| 81 | Ga0070707_100695297 | 3300005468 | Bacteria | 980 |
| 82 | Ga0070679_100092115 | 3300005530 | Bacteria | 3019 |
| 83 | Ga0070697_100019678 | 3300005536 | Bacteria | 5332 |
| 84 | Ga0070697_100495558 | 3300005536 | Bacteria | 1068 |
| 85 | Ga0068853_100233628 | 3300005539 | Bacteria | 1683 |
| 86 | Ga0070672_100021266 | 3300005543 | Bacteria | 4745 |
| 87 | Ga0070672_100065270 | 3300005543 | Bacteria | 2879 |
| 88 | Ga0070686_100000140 | 3300005544 | Bacteria | 49544 |
| 89 | Ga0070686_100318664 | 3300005544 | Bacteria | 1158 |
| 90 | Ga0070695_100043021 | 3300005545 | Bacteria | 2870 |
| 91 | Ga0070695_100098510 | 3300005545 | Bacteria | 1965 |
| 92 | Ga0070696_100004761 | 3300005546 | Bacteria | 9063 |
| 93 | Ga0070696_100098839 | 3300005546 | Bacteria | 2088 |
| 94 | Ga0070696_100347609 | 3300005546 | Bacteria | 1148 |
| 95 | Ga0070693_100126339 | 3300005547 | Bacteria | 1593 |
| 96 | Ga0070693_100279134 | 3300005547 | Bacteria | 1118 |
| 97 | Ga0070665_100000105 | 3300005548 | Bacteria | 157734 |
| 98 | Ga0070665_100002184 | 3300005548 | Bacteria | 21806 |
| 99 | Ga0070665_100172679 | 3300005548 | Bacteria | 2162 |
| 100 | Ga0070665_100462250 | 3300005548 | Bacteria | 1279 |
| 101 | Ga0070704_100069165 | 3300005549 | Bacteria | 2557 |
| 102 | Ga0070704_100106528 | 3300005549 | Bacteria | 2124 |
| 103 | Ga0070704_100495014 | 3300005549 | Bacteria | 1060 |
| 104 | Ga0070704_100644614 | 3300005549 | Bacteria | 935 |
| 105 | Ga0070704_101018157 | 3300005549 | Bacteria | 750 |
| 106 | Ga0068855_100309264 | 3300005563 | Bacteria | 1749 |
| 107 | Ga0070664_100164957 | 3300005564 | Bacteria | 1962 |
| 108 | Ga0068857_100027365 | 3300005577 | Bacteria | 5031 |
| 109 | Ga0068854_100499613 | 3300005578 | Bacteria | 1024 |
| 110 | Ga0068854_100521423 | 3300005578 | Bacteria | 1004 |
| 111 | Ga0068852_100002785 | 3300005616 | Bacteria | 12109 |
| 112 | Ga0068852_100214509 | 3300005616 | Bacteria | 1828 |
| 113 | Ga0068852_100866795 | 3300005616 | Bacteria | 919 |
| 114 | Ga0068859_100027031 | 3300005617 | Bacteria | 5755 |
| 115 | Ga0068859_100028919 | 3300005617 | Bacteria | 5560 |
| 116 | Ga0068859_100156144 | 3300005617 | Bacteria | 2359 |
| 117 | Ga0068859_100224662 | 3300005617 | Bacteria | 1966 |
| 118 | Ga0068859_100487604 | 3300005617 | Bacteria | 1328 |
| 119 | Ga0068864_100002091 | 3300005618 | Bacteria | 16490 |
| 120 | Ga0068864_100170796 | 3300005618 | Bacteria | 1982 |
| 121 | Ga0068864_100582411 | 3300005618 | Bacteria | 1084 |
| 122 | Ga0068864_100761466 | 3300005618 | Bacteria | 949 |
| 123 | Ga0068861_100031256 | 3300005719 | Bacteria | 3910 |
| 124 | Ga0068861_100073769 | 3300005719 | Bacteria | 2652 |
| 125 | Ga0068861_100961631 | 3300005719 | Bacteria | 813 |
| 126 | Ga0068861_101312257 | 3300005719 | Bacteria | 704 |
| 127 | Ga0068851_10288278 | 3300005834 | Bacteria | 941 |
| 128 | Ga0068870_10222769 | 3300005840 | Bacteria | 1155 |
| 129 | Ga0068870_10477842 | 3300005840 | Bacteria | 826 |
| 130 | Ga0068863_100001776 | 3300005841 | Bacteria | 21388 |
| 131 | Ga0068863_100022271 | 3300005841 | Bacteria | 6050 |
| 132 | Ga0068863_100220834 | 3300005841 | Bacteria | 1826 |
| 133 | Ga0068863_100446185 | 3300005841 | Bacteria | 1269 |
| 134 | Ga0068858_100000412 | 3300005842 | Bacteria | 44458 |
| 135 | Ga0068858_100049472 | 3300005842 | Bacteria | 3893 |
| 136 | Ga0068860_100000120 | 3300005843 | Bacteria | 125823 |
| 137 | Ga0068860_100000903 | 3300005843 | Bacteria | 32899 |
| 138 | Ga0068860_100046033 | 3300005843 | Bacteria | 4160 |
| 139 | Ga0068860_100123687 | 3300005843 | Bacteria | 2479 |
| 140 | Ga0068860_100333878 | 3300005843 | Bacteria | 1489 |
| 141 | Ga0068860_100475791 | 3300005843 | Bacteria | 1244 |
| 142 | Ga0068862_100000365 | 3300005844 | Bacteria | 49043 |
| 143 | Ga0068862_100033939 | 3300005844 | Bacteria | 4316 |
| 144 | Ga0068862_100040916 | 3300005844 | Bacteria | 3942 |
| 145 | Ga0070717_10811336 | 3300006028 | Bacteria | 851 |
| 146 | Ga0070716_100039011 | 3300006173 | Bacteria | 2633 |
| 147 | Ga0075362_10030142 | 3300006177 | Bacteria | 2341 |
| 148 | Ga0075367_10070525 | 3300006178 | Bacteria | 2101 |
| 149 | Ga0075366_10056864 | 3300006195 | Bacteria | 2324 |
| 150 | Ga0097621_100150814 | 3300006237 | Bacteria | 1993 |
| 151 | Ga0075370_10268647 | 3300006353 | Bacteria | 1012 |
| 152 | Ga0068871_100035672 | 3300006358 | Bacteria | 3954 |
| 153 | Ga0068871_100182195 | 3300006358 | Bacteria | 1805 |
| 154 | Ga0075428_100198067 | 3300006844 | Bacteria | 2172 |
| 155 | Ga0075428_100858405 | 3300006844 | Bacteria | 964 |
| 156 | Ga0075430_100004710 | 3300006846 | Bacteria | 11472 |
| 157 | Ga0075430_100037762 | 3300006846 | Bacteria | 4093 |
| 158 | Ga0075430_100475185 | 3300006846 | Bacteria | 1031 |
| 159 | Ga0075431_100054682 | 3300006847 | Bacteria | 4116 |
| 160 | Ga0075431_100199942 | 3300006847 | Bacteria | 2045 |
| 161 | Ga0075431_100448870 | 3300006847 | Bacteria | 1285 |
| 162 | Ga0075433_10629491 | 3300006852 | Bacteria | 941 |
| 163 | Ga0075434_100039264 | 3300006871 | Bacteria | 4690 |
| 164 | Ga0075434_100144328 | 3300006871 | Bacteria | 2401 |
| 165 | Ga0075434_100194328 | 3300006871 | Bacteria | 2049 |
| 166 | Ga0075434_100443445 | 3300006871 | Bacteria | 1319 |
| 167 | Ga0075429_100340084 | 3300006880 | Bacteria | 1314 |
| 168 | Ga0075429_100343100 | 3300006880 | Bacteria | 1307 |
| 169 | Ga0068865_100003663 | 3300006881 | Bacteria | 9226 |
| 170 | Ga0068865_100109023 | 3300006881 | Bacteria | 2039 |
| 171 | Ga0068865_100321729 | 3300006881 | Bacteria | 1244 |
| 172 | Ga0075436_100000111 | 3300006914 | Bacteria | 47863 |
| 173 | Ga0097620_100027032 | 3300006931 | Bacteria | 5755 |
| 174 | Ga0097620_100028919 | 3300006931 | Bacteria | 5560 |
| 175 | Ga0097620_100156131 | 3300006931 | Bacteria | 2359 |
| 176 | Ga0097620_100224668 | 3300006931 | Bacteria | 1966 |
| 177 | Ga0097620_100487595 | 3300006931 | Bacteria | 1328 |
| 178 | Ga0075435_100130668 | 3300007076 | Bacteria | 2101 |
| 179 | Ga0075435_100294055 | 3300007076 | Bacteria | 1388 |
| 180 | Ga0075435_100451210 | 3300007076 | Bacteria | 1109 |
| 181 | Ga0105240_10008445 | 3300009093 | Bacteria | 14731 |
| 182 | Ga0111539_10179513 | 3300009094 | Bacteria | 2473 |
| 183 | Ga0105245_10009778 | 3300009098 | Bacteria | 8355 |
| 184 | Ga0105245_10246709 | 3300009098 | Bacteria | 1733 |
| 185 | Ga0105245_10309642 | 3300009098 | Bacteria | 1552 |
| 186 | Ga0105245_10412655 | 3300009098 | Bacteria | 1352 |
| 187 | Ga0114129_10033159 | 3300009147 | Bacteria | 7298 |
| 188 | Ga0114129_10164186 | 3300009147 | Bacteria | 3032 |
| 189 | Ga0114129_10585700 | 3300009147 | Bacteria | 1447 |
| 190 | Ga0105243_10037366 | 3300009148 | Bacteria | 3774 |
| 191 | Ga0105243_10162637 | 3300009148 | Bacteria | 1926 |
| 192 | Ga0105243_10451846 | 3300009148 | Bacteria | 1206 |
| 193 | Ga0105243_10637569 | 3300009148 | Bacteria | 1031 |
| 194 | Ga0105243_10820076 | 3300009148 | Bacteria | 919 |
| 195 | Ga0105242_10002502 | 3300009176 | Bacteria | 14410 |
| 196 | Ga0105242_10069596 | 3300009176 | Bacteria | 2915 |
| 197 | Ga0105242_10078105 | 3300009176 | Bacteria | 2763 |
| 198 | Ga0105242_10186724 | 3300009176 | Bacteria | 1832 |
| 199 | Ga0105242_10884420 | 3300009176 | Bacteria | 892 |
| 200 | Ga0105248_10075044 | 3300009177 | Bacteria | 3800 |
| 201 | Ga0105248_10417796 | 3300009177 | Bacteria | 1510 |
| 202 | Ga0105248_10476008 | 3300009177 | Bacteria | 1408 |
| 203 | Ga0105237_10401355 | 3300009545 | Bacteria | 1376 |
| 204 | Ga0105238_10591871 | 3300009551 | Bacteria | 1116 |
| 205 | Ga0105238_10683603 | 3300009551 | Bacteria | 1038 |
| 206 | Ga0105249_10361463 | 3300009553 | Bacteria | 1473 |
| 207 | Ga0105249_10442664 | 3300009553 | Bacteria | 1337 |
| 208 | Ga0105249_11573734 | 3300009553 | Bacteria | 730 |
| 209 | Ga0157370_10672990 | 3300013104 | Bacteria | 945 |
| 210 | Ga0157374_10125352 | 3300013296 | Bacteria | 2482 |
| 211 | Ga0157378_10004527 | 3300013297 | Bacteria | 12196 |
| 212 | Ga0157378_10046586 | 3300013297 | Bacteria | 3854 |
| 213 | Ga0157378_10385566 | 3300013297 | Bacteria | 1377 |
| 214 | Ga0157378_10797836 | 3300013297 | Bacteria | 970 |
| 215 | Ga0163162_10005803 | 3300013306 | Bacteria | 11947 |
| 216 | Ga0163162_10040290 | 3300013306 | Bacteria | 4671 |
| 217 | Ga0157372_10408544 | 3300013307 | Bacteria | 1582 |
| 218 | Ga0157375_10058576 | 3300013308 | Bacteria | 3811 |
| 219 | Ga0157375_10442310 | 3300013308 | Bacteria | 1466 |
| 220 | Ga0157375_10605346 | 3300013308 | Bacteria | 1255 |
| 221 | Ga0157375_11006614 | 3300013308 | Bacteria | 973 |
| 222 | Ga0157375_11501661 | 3300013308 | Bacteria | 795 |
| 223 | Ga0163163_10382828 | 3300014325 | Bacteria | 1464 |
| 224 | Ga0163163_10844886 | 3300014325 | Bacteria | 979 |
| 225 | Ga0157380_10007364 | 3300014326 | Bacteria | 7813 |
| 226 | Ga0157380_10231710 | 3300014326 | Bacteria | 1659 |
| 227 | Ga0157380_10770998 | 3300014326 | Bacteria | 975 |
| 228 | Ga0182008_10552911 | 3300014497 | Bacteria | 640 |
| 229 | Ga0157379_10035631 | 3300014968 | Bacteria | 4437 |
| 230 | Ga0157379_10066556 | 3300014968 | Bacteria | 3221 |
| 231 | Ga0157379_10117893 | 3300014968 | Bacteria | 2388 |
| 232 | Ga0157379_10232735 | 3300014968 | Bacteria | 1670 |
| 233 | Ga0163161_10065092 | 3300017792 | Bacteria | 2660 |
| 234 | Ga0163161_10209428 | 3300017792 | Bacteria | 1506 |
| 235 | Ga0163161_10452167 | 3300017792 | Bacteria | 1038 |
| 236 | Ga0206350_11574848 | 3300020080 | Bacteria | 756 |
| 237 | Ga0209455_1010168 | 3300025272 | Bacteria | 2410 |
| 238 | Ga0209675_1003710 | 3300025291 | Bacteria | 7103 |
| 239 | Ga0209676_1000557 | 3300025292 | Bacteria | 56440 |
| 240 | Ga0209676_1001387 | 3300025292 | Bacteria | 23537 |
| 241 | Ga0209676_1001888 | 3300025292 | Bacteria | 17095 |
| 242 | Ga0209676_1014718 | 3300025292 | Bacteria | 2925 |
| 243 | Ga0209676_1062433 | 3300025292 | Bacteria | 921 |
| 244 | Ga0209025_1036502 | 3300025294 | Bacteria | 2200 |
| 245 | Ga0209025_1038151 | 3300025294 | Bacteria | 2118 |
| 246 | Ga0209758_1000036 | 3300025297 | Bacteria | 441671 |
| 247 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 248 | Ga0209050_1003770 | 3300025298 | Bacteria | 10850 |
| 249 | Ga0209257_1001118 | 3300025304 | Bacteria | 34674 |
| 250 | Ga0209257_1001176 | 3300025304 | Bacteria | 33109 |
| 251 | Ga0209257_1001719 | 3300025304 | Bacteria | 24483 |
| 252 | Ga0207697_10009458 | 3300025315 | Bacteria | 4210 |
| 253 | Ga0207656_10358661 | 3300025321 | Bacteria | 728 |
| 254 | Ga0207682_10030036 | 3300025893 | Bacteria | 2175 |
| 255 | Ga0207682_10034359 | 3300025893 | Bacteria | 2044 |
| 256 | Ga0207688_10008762 | 3300025901 | Bacteria | 5504 |
| 257 | Ga0207680_10153493 | 3300025903 | Bacteria | 1537 |
| 258 | Ga0207680_10166946 | 3300025903 | Bacteria | 1480 |
| 259 | Ga0207680_10240699 | 3300025903 | Bacteria | 1247 |
| 260 | Ga0207645_10012727 | 3300025907 | Bacteria | 5703 |
| 261 | Ga0207645_10161383 | 3300025907 | Bacteria | 1467 |
| 262 | Ga0207643_10020601 | 3300025908 | Bacteria | 3620 |
| 263 | Ga0207684_10117974 | 3300025910 | Bacteria | 2274 |
| 264 | Ga0207684_10166258 | 3300025910 | Bacteria | 1901 |
| 265 | Ga0207707_10346502 | 3300025912 | Unclassified | 1280 |
| 266 | Ga0207695_10152244 | 3300025913 | Bacteria | 2251 |
| 267 | Ga0207662_10042493 | 3300025918 | Bacteria | 2679 |
| 268 | Ga0207662_10149753 | 3300025918 | Bacteria | 1483 |
| 269 | Ga0207657_10000839 | 3300025919 | Bacteria | 32505 |
| 270 | Ga0207649_10005015 | 3300025920 | Bacteria | 7157 |
| 271 | Ga0207652_10126216 | 3300025921 | Unclassified | 2279 |
| 272 | Ga0207646_10046396 | 3300025922 | Bacteria | 3898 |
| 273 | Ga0207646_10479208 | 3300025922 | Bacteria | 1122 |
| 274 | Ga0207681_10082302 | 3300025923 | Bacteria | 2275 |
| 275 | Ga0207681_10150675 | 3300025923 | Bacteria | 1742 |
| 276 | Ga0207650_10014606 | 3300025925 | Bacteria | 5454 |
| 277 | Ga0207650_10244708 | 3300025925 | Bacteria | 1450 |
| 278 | Ga0207659_10035258 | 3300025926 | Bacteria | 3456 |
| 279 | Ga0207659_10186644 | 3300025926 | Bacteria | 1647 |
| 280 | Ga0207659_10203034 | 3300025926 | Bacteria | 1584 |
| 281 | Ga0207659_10881900 | 3300025926 | Bacteria | 769 |
| 282 | Ga0207687_10029259 | 3300025927 | Bacteria | 3705 |
| 283 | Ga0207687_10499813 | 3300025927 | Bacteria | 1015 |
| 284 | Ga0207687_10609067 | 3300025927 | Bacteria | 921 |
| 285 | Ga0207644_10000047 | 3300025931 | Bacteria | 103158 |
| 286 | Ga0207644_10035090 | 3300025931 | Bacteria | 3512 |
| 287 | Ga0207644_10262625 | 3300025931 | Bacteria | 1381 |
| 288 | Ga0207644_10342530 | 3300025931 | Bacteria | 1212 |
| 289 | Ga0207644_10342622 | 3300025931 | Bacteria | 1212 |
| 290 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 291 | Ga0207706_10041710 | 3300025933 | Bacteria | 4068 |
| 292 | Ga0207686_10017443 | 3300025934 | Bacteria | 4046 |
| 293 | Ga0207686_10046068 | 3300025934 | Bacteria | 2687 |
| 294 | Ga0207686_10146154 | 3300025934 | Bacteria | 1640 |
| 295 | Ga0207709_10041714 | 3300025935 | Bacteria | 2756 |
| 296 | Ga0207709_10208451 | 3300025935 | Bacteria | 1401 |
| 297 | Ga0207709_10224338 | 3300025935 | Bacteria | 1357 |
| 298 | Ga0207709_10250607 | 3300025935 | Bacteria | 1293 |
| 299 | Ga0207670_10094949 | 3300025936 | Bacteria | 2117 |
| 300 | Ga0207669_10792508 | 3300025937 | Bacteria | 785 |
| 301 | Ga0207669_10927805 | 3300025937 | Bacteria | 729 |
| 302 | Ga0207704_10005537 | 3300025938 | Bacteria | 5819 |
| 303 | Ga0207704_10115058 | 3300025938 | Bacteria | 1827 |
| 304 | Ga0207665_10019582 | 3300025939 | Bacteria | 4450 |
| 305 | Ga0207665_10300827 | 3300025939 | Bacteria | 1199 |
| 306 | Ga0207691_10006268 | 3300025940 | Bacteria | 11483 |
| 307 | Ga0207691_10219991 | 3300025940 | Bacteria | 1647 |
| 308 | Ga0207691_10332307 | 3300025940 | Bacteria | 1302 |
| 309 | Ga0207711_10214071 | 3300025941 | Bacteria | 1760 |
| 310 | Ga0207689_10195671 | 3300025942 | Bacteria | 1668 |
| 311 | Ga0207661_10010949 | 3300025944 | Bacteria | 6549 |
| 312 | Ga0207679_10000906 | 3300025945 | Bacteria | 18937 |
| 313 | Ga0207667_10638013 | 3300025949 | Bacteria | 1072 |
| 314 | Ga0207651_10013310 | 3300025960 | Bacteria | 4702 |
| 315 | Ga0207651_10583017 | 3300025960 | Bacteria | 976 |
| 316 | Ga0207712_10050532 | 3300025961 | Bacteria | 2903 |
| 317 | Ga0207712_10515660 | 3300025961 | Bacteria | 1024 |
| 318 | Ga0207712_10697973 | 3300025961 | Bacteria | 885 |
| 319 | Ga0207712_11032911 | 3300025961 | Bacteria | 730 |
| 320 | Ga0207668_10000043 | 3300025972 | Bacteria | 103738 |
| 321 | Ga0207668_10146778 | 3300025972 | Bacteria | 1821 |
| 322 | Ga0207668_10586643 | 3300025972 | Bacteria | 969 |
| 323 | Ga0207640_10163832 | 3300025981 | Bacteria | 1648 |
| 324 | Ga0207640_10653420 | 3300025981 | Bacteria | 896 |
| 325 | Ga0207658_10000010 | 3300025986 | Bacteria | 240224 |
| 326 | Ga0207658_10238386 | 3300025986 | Bacteria | 1539 |
| 327 | Ga0207677_10000044 | 3300026023 | Bacteria | 107614 |
| 328 | Ga0207677_10686216 | 3300026023 | Bacteria | 907 |
| 329 | Ga0207703_10003516 | 3300026035 | Bacteria | 13106 |
| 330 | Ga0207703_10031316 | 3300026035 | Bacteria | 4205 |
| 331 | Ga0207703_10273572 | 3300026035 | Bacteria | 1531 |
| 332 | Ga0207639_10401833 | 3300026041 | Bacteria | 1234 |
| 333 | Ga0207639_10492166 | 3300026041 | Bacteria | 1119 |
| 334 | Ga0207639_10631123 | 3300026041 | Bacteria | 990 |
| 335 | Ga0207678_10121197 | 3300026067 | Bacteria | 2232 |
| 336 | Ga0207678_11165008 | 3300026067 | Bacteria | 682 |
| 337 | Ga0207708_10019486 | 3300026075 | Bacteria | 5115 |
| 338 | Ga0207708_10209280 | 3300026075 | Bacteria | 1558 |
| 339 | Ga0207641_10000294 | 3300026088 | Bacteria | 62469 |
| 340 | Ga0207641_10012528 | 3300026088 | Bacteria | 6951 |
| 341 | Ga0207641_10035171 | 3300026088 | Bacteria | 4172 |
| 342 | Ga0207641_10198953 | 3300026088 | Bacteria | 1846 |
| 343 | Ga0207641_10302402 | 3300026088 | Bacteria | 1511 |
| 344 | Ga0207641_10475736 | 3300026088 | Bacteria | 1210 |
| 345 | Ga0207648_10007566 | 3300026089 | Bacteria | 10660 |
| 346 | Ga0207648_10010128 | 3300026089 | Bacteria | 8962 |
| 347 | Ga0207676_10002645 | 3300026095 | Bacteria | 12750 |
| 348 | Ga0207676_10026026 | 3300026095 | Bacteria | 4346 |
| 349 | Ga0207676_10077980 | 3300026095 | Bacteria | 2681 |
| 350 | Ga0207676_10561714 | 3300026095 | Bacteria | 1091 |
| 351 | Ga0207676_10886521 | 3300026095 | Bacteria | 874 |
| 352 | Ga0207674_10034895 | 3300026116 | Bacteria | 5253 |
| 353 | Ga0207674_10077608 | 3300026116 | Bacteria | 3327 |
| 354 | Ga0207675_100007331 | 3300026118 | Bacteria | 10423 |
| 355 | Ga0207675_100042970 | 3300026118 | Bacteria | 4220 |
| 356 | Ga0207683_10008343 | 3300026121 | Bacteria | 8861 |
| 357 | Ga0207698_10010035 | 3300026142 | Bacteria | 6064 |
| 358 | Ga0207698_10607701 | 3300026142 | Bacteria | 1079 |
| 359 | Ga0207698_10728667 | 3300026142 | Bacteria | 989 |
| 360 | Ga0207698_10811690 | 3300026142 | Bacteria | 938 |
| 361 | Ga0209967_1000193 | 3300027364 | Bacteria | 8591 |
| 362 | Ga0209981_1002518 | 3300027378 | Bacteria | 2338 |
| 363 | Ga0209981_1005097 | 3300027378 | Bacteria | 1739 |
| 364 | Ga0209996_1007658 | 3300027395 | Bacteria | 1409 |
| 365 | Ga0209996_1014881 | 3300027395 | Bacteria | 1059 |
| 366 | Ga0210000_1000435 | 3300027462 | Bacteria | 5732 |
| 367 | Ga0210000_1000719 | 3300027462 | Bacteria | 4592 |
| 368 | Ga0209995_1000658 | 3300027471 | Bacteria | 5325 |
| 369 | Ga0209968_1005366 | 3300027526 | Bacteria | 1929 |
| 370 | Ga0209968_1005975 | 3300027526 | Bacteria | 1833 |
| 371 | Ga0209999_1008603 | 3300027543 | Bacteria | 1842 |
| 372 | Ga0209999_1038090 | 3300027543 | Bacteria | 899 |
| 373 | Ga0209983_1021933 | 3300027665 | Bacteria | 1337 |
| 374 | Ga0209966_1002399 | 3300027695 | Bacteria | 3123 |
| 375 | Ga0209974_10049378 | 3300027876 | Bacteria | 1411 |
| 376 | Ga0207428_10080158 | 3300027907 | Bacteria | 2551 |
| 377 | Ga0268266_10000055 | 3300028379 | Bacteria | 291630 |
| 378 | Ga0268266_10098288 | 3300028379 | Bacteria | 2575 |
| 379 | Ga0268266_10443517 | 3300028379 | Bacteria | 1233 |
| 380 | Ga0268266_10695186 | 3300028379 | Bacteria | 980 |
| 381 | Ga0268265_10000143 | 3300028380 | Bacteria | 90469 |
| 382 | Ga0268265_10017185 | 3300028380 | Bacteria | 4986 |
| 383 | Ga0268265_10059327 | 3300028380 | Bacteria | 2927 |
| 384 | Ga0268265_10196026 | 3300028380 | Bacteria | 1748 |
| 385 | Ga0268264_10000070 | 3300028381 | Bacteria | 268524 |
| 386 | Ga0268264_10016446 | 3300028381 | Bacteria | 6057 |
| 387 | Ga0268264_10096134 | 3300028381 | Bacteria | 2565 |
| 388 | Ga0268264_10451617 | 3300028381 | Bacteria | 1245 |
| 389 | Ga0265318_10062847 | 3300028577 | Bacteria | 1382 |
| 390 | Ga0307517_10078802 | 3300028786 | Bacteria | 2844 |
| 391 | Ga0265330_10059375 | 3300031235 | Bacteria | 1666 |
| 392 | Ga0265332_10004178 | 3300031238 | Bacteria | 6848 |
| 393 | Ga0265328_10014479 | 3300031239 | Bacteria | 3106 |
| 394 | Ga0265320_10023211 | 3300031240 | Bacteria | 3306 |
| 395 | Ga0265329_10039391 | 3300031242 | Bacteria | 1518 |
| 396 | Ga0265331_10001179 | 3300031250 | Bacteria | 19910 |
| 397 | Ga0265331_10017366 | 3300031250 | Bacteria | 3755 |
| 398 | Ga0265327_10002178 | 3300031251 | Bacteria | 21530 |
| 399 | Ga0265327_10163829 | 3300031251 | Bacteria | 1025 |
| 400 | Ga0265316_10001190 | 3300031344 | Bacteria | 28178 |
| 401 | Ga0265316_10049383 | 3300031344 | Bacteria | 3315 |
| 402 | Ga0307408_100707213 | 3300031548 | Bacteria | 906 |
| 403 | Ga0307408_101342037 | 3300031548 | Bacteria | 671 |
| 404 | Ga0265313_10053687 | 3300031595 | Bacteria | 1917 |
| 405 | Ga0265314_10000887 | 3300031711 | Bacteria | 35662 |
| 406 | Ga0265342_10029125 | 3300031712 | Bacteria | 3432 |
| 407 | Ga0307516_10000094 | 3300031730 | Bacteria | 100401 |
| 408 | Ga0307410_10294831 | 3300031852 | Bacteria | 1278 |
| 409 | Ga0307406_10041841 | 3300031901 | Bacteria | 2858 |
| 410 | Ga0307406_10182713 | 3300031901 | Bacteria | 1528 |
| 411 | Ga0307406_10375685 | 3300031901 | Bacteria | 1119 |
| 412 | Ga0307412_10046703 | 3300031911 | Bacteria | 2839 |
| 413 | Ga0307409_100409845 | 3300031995 | Bacteria | 1297 |
| 414 | Ga0307416_100122364 | 3300032002 | Bacteria | 2322 |
| 415 | Ga0307416_100521998 | 3300032002 | Bacteria | 1256 |
| 416 | Ga0307416_101746943 | 3300032002 | Bacteria | 726 |
| 417 | Ga0307414_10001549 | 3300032004 | Bacteria | 11941 |
| 418 | Ga0307414_10005871 | 3300032004 | Bacteria | 6791 |
| 419 | Ga0307414_10079731 | 3300032004 | Bacteria | 2391 |
| 420 | Ga0307414_10090859 | 3300032004 | Bacteria | 2267 |
| 421 | Ga0307414_10163229 | 3300032004 | Bacteria | 1772 |
| 422 | Ga0307414_10369030 | 3300032004 | Bacteria | 1237 |
| 423 | Ga0307414_10433509 | 3300032004 | Bacteria | 1149 |
| 424 | Ga0307414_10444246 | 3300032004 | Bacteria | 1136 |
| 425 | Ga0307411_10040338 | 3300032005 | Bacteria | 2961 |
| 426 | Ga0307411_10216370 | 3300032005 | Bacteria | 1483 |
| 427 | Ga0307411_10440116 | 3300032005 | Bacteria | 1088 |
| 428 | Ga0307411_10653775 | 3300032005 | Bacteria | 910 |
| 429 | Ga0307411_11221363 | 3300032005 | Bacteria | 682 |
| 430 | Ga0373932_0113151 | 3300035112 | Bacteria | 897 |
| 431 | Ga0373953_0062726 | 3300035117 | Bacteria | 1522 |
| 432 | Ga0373927_0009397 | 3300035695 | Bacteria | 6558 |
| 433 | Ga0373937_0016620 | 3300036401 | Bacteria | 6538 |
| 434 | Ga0373925_0001850 | 3300037068 | Bacteria | 17621 |
| 435 | Ga0395898_0402019 | 3300037466 | Bacteria | 1306 |
| 436 | Ga0395905_0673841 | 3300037471 | Bacteria | 936 |
| 437 | Ga0436364_1446039 | 3300037853 | Bacteria | 1319 |
| 438 | Ga0395901_0019134 | 3300038443 | Bacteria | 7001 |
| 439 | Ga0237819_00574 | 3300038705 | Bacteria | 12342 |
| 440 | Ga0436365_1862304 | 3300039437 | Bacteria | 21258 |
| 441 | Ga0436363_1179848 | 3300039450 | Bacteria | 1442 |
| 442 | Ga0439436_0074971 | 3300041404 | Bacteria | 942 |
| 443 | Ga0451798_0420236 | 3300041458 | Bacteria | 535 |
| 444 | Ga0451804_0684765 | 3300041463 | Bacteria | 811 |
| 445 | Ga0451853_0042166 | 3300041512 | Bacteria | 658 |
| 446 | Ga0439441_001972 | 3300042001 | Bacteria | 2817 |
| 447 | Ga0439446_0007782 | 3300042156 | Bacteria | 2824 |
| 448 | Ga0439434_0008995 | 3300042435 | Bacteria | 2935 |
| 449 | Ga0439435_0001153 | 3300042436 | Bacteria | 4737 |
| 450 | Ga0439435_0016940 | 3300042436 | Bacteria | 1835 |
| 451 | Ga0439444_0010931 | 3300042437 | Bacteria | 1460 |
| 452 | Ga0439464_0137737 | 3300042439 | Bacteria | 759 |
| 453 | Ga0451576_0318366 | 3300045051 | Bacteria | 1628 |
| 454 | Ga0495592_0000739 | 3300046454 | Bacteria | 22747 |
| 455 | Ga0495629_0185204 | 3300046459 | Bacteria | 1442 |
| 456 | Ga0495653_0125097 | 3300046463 | Bacteria | 1827 |
| 457 | Ga0495650_0094611 | 3300046471 | Bacteria | 1131 |
| 458 | Ga0495639_0309824 | 3300046475 | Bacteria | 788 |
| 459 | Ga0495608_0000167 | 3300046511 | Bacteria | 46550 |
| 460 | Ga0495610_0162692 | 3300046512 | Bacteria | 942 |
| 461 | Ga0495616_0000022 | 3300046513 | Bacteria | 149720 |
| 462 | Ga0495628_0002132 | 3300046516 | Bacteria | 17926 |
| 463 | Ga0495630_0023037 | 3300046517 | Bacteria | 4601 |
| 464 | Ga0495632_0054694 | 3300046519 | Bacteria | 1956 |
| 465 | Ga0495643_0025809 | 3300046522 | Bacteria | 3321 |
| 466 | Ga0495663_0058623 | 3300046525 | Bacteria | 1207 |
| 467 | Ga0495666_0002610 | 3300046526 | Bacteria | 8968 |
| 468 | Ga0495652_0576694 | 3300046529 | Bacteria | 770 |
| 469 | Ga0495640_0003327 | 3300046533 | Bacteria | 12939 |
| 470 | Ga0495586_0000552 | 3300046535 | Bacteria | 21719 |
| 471 | Ga0495622_0001538 | 3300046557 | Bacteria | 11470 |
| 472 | Ga0495667_0009148 | 3300046559 | Bacteria | 6728 |
| 473 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 474 | Ga0495634_0002697 | 3300046642 | Bacteria | 14598 |
| 475 | Ga0495625_0000553 | 3300046660 | Bacteria | 54796 |
| 476 | Ga0495635_0019697 | 3300046663 | Bacteria | 4699 |
| 477 | Ga0495658_0018110 | 3300046683 | Bacteria | 3654 |
| 478 | Ga0495658_0607773 | 3300046683 | Bacteria | 700 |
| 479 | Ga0495613_0036492 | 3300046689 | Bacteria | 3645 |
| 480 | Ga0495604_0002495 | 3300047317 | Bacteria | 14695 |
| 481 | Ga0495680_0002018 | 3300047322 | Bacteria | 21287 |
| 482 | Ga0495593_0025368 | 3300047673 | Bacteria | 3281 |
| 483 | Ga0496103_0184047 | 3300048906 | Bacteria | 1343 |
| 484 | Ga0496104_0470133 | 3300048907 | Bacteria | 1169 |
| 485 | Ga0496105_0636460 | 3300048908 | Bacteria | 824 |
| 486 | Ga0496106_0062415 | 3300048909 | Bacteria | 2829 |
| 487 | Ga0496106_0296786 | 3300048909 | Bacteria | 1296 |
| 488 | Ga0496107_0090125 | 3300048910 | Bacteria | 2240 |
| 489 | Ga0496108_0096722 | 3300048911 | Bacteria | 2515 |
| 490 | Ga0496109_0224488 | 3300048912 | Bacteria | 1767 |
| 491 | Ga0496110_0022145 | 3300048913 | Bacteria | 5392 |
| 492 | Ga0496110_0948959 | 3300048913 | Bacteria | 767 |
| 493 | Ga0496111_0577511 | 3300048914 | Bacteria | 824 |
| 494 | Ga0496112_0165469 | 3300048915 | Bacteria | 2178 |
| 495 | Ga0496113_0234721 | 3300048916 | Bacteria | 1463 |
| 496 | Ga0496124_0382684 | 3300048927 | Bacteria | 983 |
| 497 | Ga0496124_0522998 | 3300048927 | Bacteria | 790 |
| 498 | Ga0501300_032631 | 3300049523 | Bacteria | 771 |
| 499 | Ga0501033_0158268 | 3300049570 | Bacteria | 1631 |
| 500 | Ga0501036_0581603 | 3300049572 | Bacteria | 930 |
| 501 | Ga0501039_0077735 | 3300049575 | Bacteria | 2581 |
| 502 | Ga0501040_0014062 | 3300049576 | Bacteria | 5268 |
| 503 | Ga0501040_0018340 | 3300049576 | Bacteria | 4645 |
| 504 | Ga0501041_0320973 | 3300049577 | Bacteria | 977 |
| 505 | Ga0501042_0075207 | 3300049578 | Bacteria | 2417 |
| 506 | Ga0501042_0294965 | 3300049578 | Bacteria | 1171 |
| 507 | Ga0501046_0362659 | 3300049580 | Bacteria | 1051 |
| 508 | Ga0501048_0160788 | 3300049582 | Bacteria | 1590 |
| 509 | Ga0501048_0348405 | 3300049582 | Bacteria | 1056 |
| 510 | Ga0501067_0113761 | 3300049583 | Bacteria | 1505 |
| 511 | Ga0501071_0042208 | 3300049587 | Bacteria | 3267 |
| 512 | Ga0501071_0079255 | 3300049587 | Bacteria | 2401 |
| 513 | Ga0501072_0035972 | 3300049588 | Bacteria | 3881 |
| 514 | Ga0501073_0612673 | 3300049589 | Bacteria | 752 |
| 515 | Ga0501075_0035578 | 3300049591 | Bacteria | 3714 |
| 516 | Ga0501075_0083029 | 3300049591 | Bacteria | 2427 |
| 517 | Ga0501076_0003038 | 3300049592 | Bacteria | 11668 |
| 518 | Ga0501076_0385907 | 3300049592 | Bacteria | 1151 |
| 519 | Ga0501079_0254217 | 3300049741 | Bacteria | 1373 |
| 520 | Ga0501080_0024662 | 3300049742 | Bacteria | 5578 |
| 521 | Ga0501262_025252 | 3300049759 | Bacteria | 833 |
| 522 | Ga0501283_007881 | 3300049779 | Bacteria | 1525 |
| 523 | Ga0501035_0363052 | 3300049822 | Bacteria | 1210 |
| 524 | Ga0501035_0465048 | 3300049822 | Bacteria | 1045 |
| 525 | Ga0501045_0038895 | 3300049824 | Bacteria | 3461 |
| 526 | nmdc:mga03683_248435_c1 | 3300050489 | Bacteria | 826 |
| 527 | nmdc:mga03683_36513_c1 | 3300050489 | Bacteria | 1999 |
| 528 | nmdc:mga0k408_28373_c1 | 3300050493 | Bacteria | 3182 |
| 529 | nmdc:mga0k408_357172_c1 | 3300050493 | Bacteria | 871 |
| 530 | nmdc:mga05p37_27888_c1 | 3300050507 | Bacteria | 6879 |
| 531 | nmdc:mga05p37_45790_c1 | 3300050507 | Bacteria | 5379 |
| 532 | nmdc:mga05p37_466751_c1 | 3300050507 | Bacteria | 1457 |
| 533 | nmdc:mga05p37_96085_c1 | 3300050507 | Bacteria | 3650 |
| 534 | nmdc:mga09592_330962_c1 | 3300050508 | Bacteria | 1319 |
| 535 | nmdc:mga09592_94489_c1 | 3300050508 | Bacteria | 2557 |
| 536 | nmdc:mga0qj67_102112_c1 | 3300050509 | Bacteria | 2312 |
| 537 | nmdc:mga0qj67_528938_c1 | 3300050509 | Bacteria | 947 |
| 538 | nmdc:mga0qj67_6110_c1 | 3300050509 | Bacteria | 8827 |
| 539 | nmdc:mga06r32_13589_c1 | 3300050510 | Bacteria | 7380 |
| 540 | nmdc:mga06r32_150345_c1 | 3300050510 | Bacteria | 2307 |
| 541 | nmdc:mga06r32_595505_c1 | 3300050510 | Bacteria | 1077 |
| 542 | nmdc:mga08y16_125138_c1 | 3300050511 | Bacteria | 2674 |
| 543 | nmdc:mga0n895_20283_c1 | 3300050512 | Bacteria | 6196 |
| 544 | nmdc:mga0n895_379976_c1 | 3300050512 | Bacteria | 1429 |
| 545 | nmdc:mga0n895_45914_c1 | 3300050512 | Bacteria | 4265 |
| 546 | nmdc:mga0n895_92159_c1 | 3300050512 | Bacteria | 3033 |
| 547 | nmdc:mga0rr50_213794_c1 | 3300050513 | Bacteria | 1590 |
| 548 | nmdc:mga0rr50_86207_c1 | 3300050513 | Bacteria | 2435 |
| 549 | nmdc:mga08x19_12629_c1 | 3300050514 | Bacteria | 5093 |
| 550 | nmdc:mga08x19_14797_c1 | 3300050514 | Bacteria | 4737 |
| 551 | nmdc:mga08x19_401_c1 | 3300050514 | Bacteria | 30460 |
| 552 | nmdc:mga08x19_477428_c1 | 3300050514 | Bacteria | 879 |
| 553 | nmdc:mga08x19_71125_c1 | 3300050514 | Bacteria | 2268 |
| 554 | nmdc:mga0a205_156041_c1 | 3300050515 | Bacteria | 2181 |
| 555 | nmdc:mga0a205_93318_c1 | 3300050515 | Bacteria | 2908 |
| 556 | Ga0495601_0011164 | 3300053077 | Bacteria | 5366 |
| 557 | Ga0500643_000219 | 3300053087 | Bacteria | 53403 |
| 558 | Ga0500643_000465 | 3300053087 | Bacteria | 29876 |
| 559 | Ga0500643_001114 | 3300053087 | Bacteria | 16085 |
| 560 | Ga0500647_0078205 | 3300053091 | Bacteria | 1587 |
| 561 | Ga0500562_010572 | 3300053108 | Bacteria | 2340 |
| 562 | Ga0500595_013353 | 3300053119 | Bacteria | 3148 |
| 563 | Ga0500658_0151592 | 3300053134 | Bacteria | 1045 |
| 564 | Ga0500561_0044765 | 3300053137 | Bacteria | 1184 |
| 565 | Ga0500568_0002510 | 3300053139 | Bacteria | 10740 |
| 566 | Ga0500573_0069531 | 3300053140 | Bacteria | 2009 |
| 567 | Ga0500588_0077147 | 3300053146 | Bacteria | 1107 |
| 568 | Ga0500604_0000031 | 3300053151 | Bacteria | 57942 |
| 569 | Ga0500604_0002272 | 3300053151 | Bacteria | 5258 |
| 570 | Ga0500616_0001465 | 3300053153 | Bacteria | 22527 |
| 571 | Ga0500627_0000049 | 3300053158 | Bacteria | 58947 |
| 572 | Ga0500627_0016099 | 3300053158 | Bacteria | 2909 |
| 573 | Ga0500627_0036470 | 3300053158 | Bacteria | 2094 |
| 574 | Ga0500587_000417 | 3300053739 | Bacteria | 4970 |
| 575 | Ga0501084_0003460 | 3300054114 | Bacteria | 12817 |
| 576 | Ga0501082_0006112 | 3300060353 | Bacteria | 10454 |
| 577 | Ga0530510_0003204 | 3300061734 | Bacteria | 11234 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025937 | Ga0207669_10927805 | Ga0207669_109278051 | 147 |
| 2 | 3300041458 | Ga0451798_0420236 | Ga0451798_0420236_13_507 | 147 |
| 3 | 3300006914 | Ga0075436_100000111 | Ga0075436_10000011145 | 155 |
| 4 | 3300050514 | nmdc:mga08x19_401_c1 | nmdc:mga08x19_401_c1_19663_20259 | 155 |
| 5 | 3300048927 | Ga0496124_0522998 | Ga0496124_0522998_126_698 | 157 |
| 6 | 3300049587 | Ga0501071_0079255 | Ga0501071_0079255_618_1217 | 159 |
| 7 | 3300049591 | Ga0501075_0083029 | Ga0501075_0083029_1548_2147 | 159 |
| 8 | 3300005456 | Ga0070678_100053499 | Ga0070678_1000534993 | 160 |
| 9 | 3300026067 | Ga0207678_11165008 | Ga0207678_111650081 | 160 |
| 10 | 3300032005 | Ga0307411_10440116 | Ga0307411_104401162 | 160 |
| 11 | 3300049779 | Ga0501283_007881 | Ga0501283_007881_185_781 | 162 |
| 12 | 3300026041 | Ga0207639_10492166 | Ga0207639_104921662 | 164 |
| 13 | 3300031901 | Ga0307406_10041841 | Ga0307406_100418413 | 164 |
| 14 | 3300050507 | nmdc:mga05p37_96085_c1 | nmdc:mga05p37_96085_c1_2293_2889 | 165 |
| 15 | 3300005293 | Ga0065715_10530377 | Ga0065715_105303771 | 167 |
| 16 | 3300005337 | Ga0070682_100995762 | Ga0070682_1009957621 | 167 |
| 17 | 3300005444 | Ga0070694_100130111 | Ga0070694_1001301111 | 167 |
| 18 | 3300005445 | Ga0070708_100137586 | Ga0070708_1001375864 | 167 |
| 19 | 3300005458 | Ga0070681_10077083 | Ga0070681_100770833 | 167 |
| 20 | 3300005468 | Ga0070707_100011178 | Ga0070707_1000111783 | 167 |
| 21 | 3300005530 | Ga0070679_100092115 | Ga0070679_1000921153 | 167 |
| 22 | 3300006871 | Ga0075434_100144328 | Ga0075434_1001443281 | 167 |
| 23 | 3300025912 | Ga0207707_10346502 | Ga0207707_103465022 | 167 |
| 24 | 3300025921 | Ga0207652_10126216 | Ga0207652_101262163 | 167 |
| 25 | 3300025922 | Ga0207646_10046396 | Ga0207646_100463964 | 167 |
| 26 | 3300050512 | nmdc:mga0n895_379976_c1 | nmdc:mga0n895_379976_c1_293_892 | 167 |
| 27 | 3300050513 | nmdc:mga0rr50_86207_c1 | nmdc:mga0rr50_86207_c1_1537_2136 | 167 |
| 28 | 3300053087 | Ga0500643_001114 | Ga0500643_001114_12_545 | 167 |
| 29 | 3300053146 | Ga0500588_0077147 | Ga0500588_0077147_192_821 | 167 |
| 30 | 3300005329 | Ga0070683_100053606 | Ga0070683_1000536063 | 168 |
| 31 | 3300005331 | Ga0070670_100078166 | Ga0070670_1000781663 | 168 |
| 32 | 3300005333 | Ga0070677_10085856 | Ga0070677_100858561 | 168 |
| 33 | 3300005338 | Ga0068868_100004436 | Ga0068868_1000044369 | 168 |
| 34 | 3300005344 | Ga0070661_100019873 | Ga0070661_1000198735 | 168 |
| 35 | 3300005354 | Ga0070675_100015141 | Ga0070675_1000151413 | 168 |
| 36 | 3300005355 | Ga0070671_100197770 | Ga0070671_1001977703 | 168 |
| 37 | 3300005356 | Ga0070674_100073308 | Ga0070674_1000733083 | 168 |
| 38 | 3300005456 | Ga0070678_100019701 | Ga0070678_1000197012 | 168 |
| 39 | 3300005457 | Ga0070662_100941763 | Ga0070662_1009417631 | 168 |
| 40 | 3300005459 | Ga0068867_100229217 | Ga0068867_1002292172 | 168 |
| 41 | 3300005539 | Ga0068853_100233628 | Ga0068853_1002336282 | 168 |
| 42 | 3300005543 | Ga0070672_100021266 | Ga0070672_1000212664 | 168 |
| 43 | 3300005548 | Ga0070665_100462250 | Ga0070665_1004622502 | 168 |
| 44 | 3300005564 | Ga0070664_100164957 | Ga0070664_1001649573 | 168 |
| 45 | 3300005578 | Ga0068854_100521423 | Ga0068854_1005214232 | 168 |
| 46 | 3300005616 | Ga0068852_100002785 | Ga0068852_1000027858 | 168 |
| 47 | 3300005618 | Ga0068864_100170796 | Ga0068864_1001707962 | 168 |
| 48 | 3300005834 | Ga0068851_10288278 | Ga0068851_102882781 | 168 |
| 49 | 3300006353 | Ga0075370_10268647 | Ga0075370_102686472 | 168 |
| 50 | 3300006358 | Ga0068871_100035672 | Ga0068871_1000356723 | 168 |
| 51 | 3300009098 | Ga0105245_10309642 | Ga0105245_103096423 | 168 |
| 52 | 3300009176 | Ga0105242_10186724 | Ga0105242_101867243 | 168 |
| 53 | 3300009177 | Ga0105248_10075044 | Ga0105248_100750445 | 168 |
| 54 | 3300013104 | Ga0157370_10672990 | Ga0157370_106729902 | 168 |
| 55 | 3300013297 | Ga0157378_10004527 | Ga0157378_1000452711 | 168 |
| 56 | 3300013306 | Ga0163162_10005803 | Ga0163162_100058032 | 168 |
| 57 | 3300013308 | Ga0157375_10058576 | Ga0157375_100585764 | 168 |
| 58 | 3300017792 | Ga0163161_10209428 | Ga0163161_102094282 | 168 |
| 59 | 3300025321 | Ga0207656_10358661 | Ga0207656_103586611 | 168 |
| 60 | 3300025893 | Ga0207682_10034359 | Ga0207682_100343593 | 168 |
| 61 | 3300025903 | Ga0207680_10166946 | Ga0207680_101669462 | 168 |
| 62 | 3300025920 | Ga0207649_10005015 | Ga0207649_100050156 | 168 |
| 63 | 3300025925 | Ga0207650_10244708 | Ga0207650_102447081 | 168 |
| 64 | 3300025926 | Ga0207659_10035258 | Ga0207659_100352582 | 168 |
| 65 | 3300025927 | Ga0207687_10609067 | Ga0207687_106090672 | 168 |
| 66 | 3300025931 | Ga0207644_10035090 | Ga0207644_100350901 | 168 |
| 67 | 3300025940 | Ga0207691_10006268 | Ga0207691_100062689 | 168 |
| 68 | 3300025944 | Ga0207661_10010949 | Ga0207661_100109493 | 168 |
| 69 | 3300025945 | Ga0207679_10000906 | Ga0207679_100009069 | 168 |
| 70 | 3300026041 | Ga0207639_10401833 | Ga0207639_104018331 | 168 |
| 71 | 3300026089 | Ga0207648_10007566 | Ga0207648_100075665 | 168 |
| 72 | 3300026095 | Ga0207676_10026026 | Ga0207676_100260266 | 168 |
| 73 | 3300026121 | Ga0207683_10008343 | Ga0207683_100083436 | 168 |
| 74 | 3300026142 | Ga0207698_10010035 | Ga0207698_100100357 | 168 |
| 75 | 3300048907 | Ga0496104_0470133 | Ga0496104_0470133_409_1008 | 168 |
| 76 | 3300048908 | Ga0496105_0636460 | Ga0496105_0636460_40_639 | 168 |
| 77 | 3300048909 | Ga0496106_0296786 | Ga0496106_0296786_359_958 | 168 |
| 78 | 3300048912 | Ga0496109_0224488 | Ga0496109_0224488_999_1598 | 168 |
| 79 | 3300048913 | Ga0496110_0022145 | Ga0496110_0022145_2862_3461 | 168 |
| 80 | 3300005343 | Ga0070687_100290079 | Ga0070687_1002900791 | 169 |
| 81 | 3300005444 | Ga0070694_100188574 | Ga0070694_1001885743 | 169 |
| 82 | 3300005467 | Ga0070706_100107619 | Ga0070706_1001076194 | 169 |
| 83 | 3300005468 | Ga0070707_100419461 | Ga0070707_1004194613 | 169 |
| 84 | 3300005536 | Ga0070697_100019678 | Ga0070697_1000196784 | 169 |
| 85 | 3300005545 | Ga0070695_100043021 | Ga0070695_1000430213 | 169 |
| 86 | 3300005546 | Ga0070696_100004761 | Ga0070696_1000047619 | 169 |
| 87 | 3300005547 | Ga0070693_100126339 | Ga0070693_1001263392 | 169 |
| 88 | 3300005549 | Ga0070704_100069165 | Ga0070704_1000691653 | 169 |
| 89 | 3300005549 | Ga0070704_100495014 | Ga0070704_1004950141 | 169 |
| 90 | 3300005549 | Ga0070704_100644614 | Ga0070704_1006446142 | 169 |
| 91 | 3300005719 | Ga0068861_101312257 | Ga0068861_1013122571 | 169 |
| 92 | 3300006173 | Ga0070716_100039011 | Ga0070716_1000390114 | 169 |
| 93 | 3300025910 | Ga0207684_10117974 | Ga0207684_101179742 | 169 |
| 94 | 3300025939 | Ga0207665_10019582 | Ga0207665_100195825 | 169 |
| 95 | 3300048913 | Ga0496110_0948959 | Ga0496110_0948959_44_628 | 169 |
| 96 | 3300049577 | Ga0501041_0320973 | Ga0501041_0320973_250_846 | 169 |
| 97 | 3300050514 | nmdc:mga08x19_71125_c1 | nmdc:mga08x19_71125_c1_488_1087 | 169 |
| 98 | iso_pu_bacteria | 2643221560 | 2643820536 | 169 |
| 99 | iso_pu_bacteria | 2643221563 | 2643836350 | 169 |
| 100 | iso_pu_bacteria | 2643221608 | 2644052826 | 169 |
| 101 | iso_pu_bacteria | 2852653556 | 2852653961 | 169 |
| 102 | iso_pu_bacteria | 2852680915 | 2852682643 | 169 |
| 103 | 3300013308 | Ga0157375_11006614 | Ga0157375_110066141 | 170 |
| 104 | 3300035695 | Ga0373927_0009397 | Ga0373927_0009397_4797_5375 | 170 |
| 105 | 3300037068 | Ga0373925_0001850 | Ga0373925_0001850_4675_5253 | 170 |
| 106 | 3300046683 | Ga0495658_0607773 | Ga0495658_0607773_112_690 | 170 |
| 107 | 3300053119 | Ga0500595_013353 | Ga0500595_013353_2105_2671 | 170 |
| 108 | 3300005459 | Ga0068867_100324926 | Ga0068867_1003249262 | 171 |
| 109 | 3300009148 | Ga0105243_10037366 | Ga0105243_100373662 | 171 |
| 110 | 3300009553 | Ga0105249_10361463 | Ga0105249_103614632 | 171 |
| 111 | 3300025935 | Ga0207709_10250607 | Ga0207709_102506071 | 171 |
| 112 | 3300025961 | Ga0207712_10697973 | Ga0207712_106979732 | 171 |
| 113 | 3300027364 | Ga0209967_1000193 | Ga0209967_10001936 | 171 |
| 114 | 3300027378 | Ga0209981_1005097 | Ga0209981_10050974 | 171 |
| 115 | 3300027395 | Ga0209996_1014881 | Ga0209996_10148812 | 171 |
| 116 | 3300027462 | Ga0210000_1000435 | Ga0210000_10004354 | 171 |
| 117 | 3300027471 | Ga0209995_1000658 | Ga0209995_10006587 | 171 |
| 118 | 3300027526 | Ga0209968_1005975 | Ga0209968_10059753 | 171 |
| 119 | 3300027543 | Ga0209999_1008603 | Ga0209999_10086033 | 171 |
| 120 | 3300027665 | Ga0209983_1021933 | Ga0209983_10219332 | 171 |
| 121 | 3300028380 | Ga0268265_10196026 | Ga0268265_101960262 | 171 |
| 122 | 3300042156 | Ga0439446_0007782 | Ga0439446_0007782_1708_2292 | 171 |
| 123 | 3300042435 | Ga0439434_0008995 | Ga0439434_0008995_1301_1885 | 171 |
| 124 | 3300042436 | Ga0439435_0016940 | Ga0439435_0016940_178_762 | 171 |
| 125 | 3300005328 | Ga0070676_10019938 | Ga0070676_100199382 | 172 |
| 126 | 3300005330 | Ga0070690_100169261 | Ga0070690_1001692611 | 172 |
| 127 | 3300005331 | Ga0070670_100000570 | Ga0070670_10000057011 | 172 |
| 128 | 3300005340 | Ga0070689_100009271 | Ga0070689_1000092717 | 172 |
| 129 | 3300005343 | Ga0070687_100247443 | Ga0070687_1002474432 | 172 |
| 130 | 3300005347 | Ga0070668_100000001 | Ga0070668_100000001158 | 172 |
| 131 | 3300005353 | Ga0070669_100022464 | Ga0070669_1000224643 | 172 |
| 132 | 3300005354 | Ga0070675_100004568 | Ga0070675_1000045686 | 172 |
| 133 | 3300005355 | Ga0070671_100000167 | Ga0070671_10000016734 | 172 |
| 134 | 3300005367 | Ga0070667_100000006 | Ga0070667_100000006135 | 172 |
| 135 | 3300005440 | Ga0070705_100243702 | Ga0070705_1002437022 | 172 |
| 136 | 3300005444 | Ga0070694_100106377 | Ga0070694_1001063772 | 172 |
| 137 | 3300005466 | Ga0070685_10360115 | Ga0070685_103601152 | 172 |
| 138 | 3300005468 | Ga0070707_100695297 | Ga0070707_1006952971 | 172 |
| 139 | 3300005545 | Ga0070695_100098510 | Ga0070695_1000985103 | 172 |
| 140 | 3300005546 | Ga0070696_100347609 | Ga0070696_1003476091 | 172 |
| 141 | 3300005617 | Ga0068859_100028919 | Ga0068859_1000289198 | 172 |
| 142 | 3300005617 | Ga0068859_100224662 | Ga0068859_1002246622 | 172 |
| 143 | 3300005618 | Ga0068864_100002091 | Ga0068864_10000209119 | 172 |
| 144 | 3300005719 | Ga0068861_100073769 | Ga0068861_1000737692 | 172 |
| 145 | 3300005841 | Ga0068863_100001776 | Ga0068863_10000177620 | 172 |
| 146 | 3300005842 | Ga0068858_100000412 | Ga0068858_10000041242 | 172 |
| 147 | 3300005843 | Ga0068860_100000120 | Ga0068860_100000120104 | 172 |
| 148 | 3300005844 | Ga0068862_100000365 | Ga0068862_10000036548 | 172 |
| 149 | 3300006844 | Ga0075428_100858405 | Ga0075428_1008584052 | 172 |
| 150 | 3300006846 | Ga0075430_100004710 | Ga0075430_1000047102 | 172 |
| 151 | 3300006846 | Ga0075430_100037762 | Ga0075430_1000377623 | 172 |
| 152 | 3300006846 | Ga0075430_100475185 | Ga0075430_1004751852 | 172 |
| 153 | 3300006847 | Ga0075431_100199942 | Ga0075431_1001999423 | 172 |
| 154 | 3300006847 | Ga0075431_100448870 | Ga0075431_1004488702 | 172 |
| 155 | 3300006880 | Ga0075429_100340084 | Ga0075429_1003400841 | 172 |
| 156 | 3300006880 | Ga0075429_100343100 | Ga0075429_1003431002 | 172 |
| 157 | 3300006931 | Ga0097620_100028919 | Ga0097620_1000289198 | 172 |
| 158 | 3300006931 | Ga0097620_100224668 | Ga0097620_1002246683 | 172 |
| 159 | 3300009147 | Ga0114129_10585700 | Ga0114129_105857002 | 172 |
| 160 | 3300025922 | Ga0207646_10479208 | Ga0207646_104792082 | 172 |
| 161 | 3300025923 | Ga0207681_10082302 | Ga0207681_100823023 | 172 |
| 162 | 3300025925 | Ga0207650_10014606 | Ga0207650_100146064 | 172 |
| 163 | 3300025926 | Ga0207659_10186644 | Ga0207659_101866442 | 172 |
| 164 | 3300025931 | Ga0207644_10000047 | Ga0207644_1000004742 | 172 |
| 165 | 3300025936 | Ga0207670_10094949 | Ga0207670_100949492 | 172 |
| 166 | 3300025940 | Ga0207691_10219991 | Ga0207691_102199912 | 172 |
| 167 | 3300025941 | Ga0207711_10214071 | Ga0207711_102140712 | 172 |
| 168 | 3300025960 | Ga0207651_10583017 | Ga0207651_105830172 | 172 |
| 169 | 3300025972 | Ga0207668_10000043 | Ga0207668_100000431 | 172 |
| 170 | 3300025986 | Ga0207658_10000010 | Ga0207658_10000010133 | 172 |
| 171 | 3300026035 | Ga0207703_10003516 | Ga0207703_100035166 | 172 |
| 172 | 3300026088 | Ga0207641_10000294 | Ga0207641_1000029428 | 172 |
| 173 | 3300026088 | Ga0207641_10012528 | Ga0207641_100125287 | 172 |
| 174 | 3300026095 | Ga0207676_10002645 | Ga0207676_100026458 | 172 |
| 175 | 3300027378 | Ga0209981_1002518 | Ga0209981_10025183 | 172 |
| 176 | 3300027543 | Ga0209999_1038090 | Ga0209999_10380901 | 172 |
| 177 | 3300027695 | Ga0209966_1002399 | Ga0209966_10023995 | 172 |
| 178 | 3300027876 | Ga0209974_10049378 | Ga0209974_100493781 | 172 |
| 179 | 3300028380 | Ga0268265_10000143 | Ga0268265_1000014347 | 172 |
| 180 | 3300028381 | Ga0268264_10000070 | Ga0268264_1000007073 | 172 |
| 181 | 3300031548 | Ga0307408_101342037 | Ga0307408_1013420371 | 172 |
| 182 | 3300032002 | Ga0307416_100122364 | Ga0307416_1001223642 | 172 |
| 183 | 3300032002 | Ga0307416_101746943 | Ga0307416_1017469431 | 172 |
| 184 | 3300032005 | Ga0307411_11221363 | Ga0307411_112213631 | 172 |
| 185 | 3300035117 | Ga0373953_0062726 | Ga0373953_0062726_493_1077 | 172 |
| 186 | 3300036401 | Ga0373937_0016620 | Ga0373937_0016620_2206_2790 | 172 |
| 187 | 3300037853 | Ga0436364_1446039 | Ga0436364_1446039_281_862 | 172 |
| 188 | 3300039450 | Ga0436363_1179848 | Ga0436363_1179848_721_1302 | 172 |
| 189 | 3300042436 | Ga0439435_0001153 | Ga0439435_0001153_3947_4543 | 172 |
| 190 | 3300046454 | Ga0495592_0000739 | Ga0495592_0000739_15373_15957 | 172 |
| 191 | 3300046463 | Ga0495653_0125097 | Ga0495653_0125097_1063_1647 | 172 |
| 192 | 3300046475 | Ga0495639_0309824 | Ga0495639_0309824_101_685 | 172 |
| 193 | 3300046511 | Ga0495608_0000167 | Ga0495608_0000167_4351_4935 | 172 |
| 194 | 3300046516 | Ga0495628_0002132 | Ga0495628_0002132_8090_8674 | 172 |
| 195 | 3300046517 | Ga0495630_0023037 | Ga0495630_0023037_2966_3550 | 172 |
| 196 | 3300046526 | Ga0495666_0002610 | Ga0495666_0002610_2531_3115 | 172 |
| 197 | 3300046529 | Ga0495652_0576694 | Ga0495652_0576694_120_704 | 172 |
| 198 | 3300046533 | Ga0495640_0003327 | Ga0495640_0003327_10092_10676 | 172 |
| 199 | 3300046535 | Ga0495586_0000552 | Ga0495586_0000552_8011_8595 | 172 |
| 200 | 3300046559 | Ga0495667_0009148 | Ga0495667_0009148_4262_4846 | 172 |
| 201 | 3300046642 | Ga0495634_0002697 | Ga0495634_0002697_289_873 | 172 |
| 202 | 3300046663 | Ga0495635_0019697 | Ga0495635_0019697_1896_2480 | 172 |
| 203 | 3300046683 | Ga0495658_0018110 | Ga0495658_0018110_420_1004 | 172 |
| 204 | 3300046689 | Ga0495613_0036492 | Ga0495613_0036492_460_1044 | 172 |
| 205 | 3300047317 | Ga0495604_0002495 | Ga0495604_0002495_10365_10949 | 172 |
| 206 | 3300047322 | Ga0495680_0002018 | Ga0495680_0002018_14291_14875 | 172 |
| 207 | 3300047673 | Ga0495593_0025368 | Ga0495593_0025368_456_1040 | 172 |
| 208 | 3300049523 | Ga0501300_032631 | Ga0501300_032631_43_639 | 172 |
| 209 | 3300049570 | Ga0501033_0158268 | Ga0501033_0158268_803_1399 | 172 |
| 210 | 3300049575 | Ga0501039_0077735 | Ga0501039_0077735_1551_2135 | 172 |
| 211 | 3300049576 | Ga0501040_0014062 | Ga0501040_0014062_1641_2225 | 172 |
| 212 | 3300049576 | Ga0501040_0018340 | Ga0501040_0018340_4027_4623 | 172 |
| 213 | 3300049578 | Ga0501042_0075207 | Ga0501042_0075207_1700_2296 | 172 |
| 214 | 3300049578 | Ga0501042_0294965 | Ga0501042_0294965_176_760 | 172 |
| 215 | 3300049580 | Ga0501046_0362659 | Ga0501046_0362659_88_672 | 172 |
| 216 | 3300049582 | Ga0501048_0348405 | Ga0501048_0348405_63_647 | 172 |
| 217 | 3300049587 | Ga0501071_0042208 | Ga0501071_0042208_764_1348 | 172 |
| 218 | 3300049588 | Ga0501072_0035972 | Ga0501072_0035972_199_783 | 172 |
| 219 | 3300049591 | Ga0501075_0035578 | Ga0501075_0035578_1817_2401 | 172 |
| 220 | 3300049592 | Ga0501076_0003038 | Ga0501076_0003038_9219_9803 | 172 |
| 221 | 3300049741 | Ga0501079_0254217 | Ga0501079_0254217_44_628 | 172 |
| 222 | 3300049742 | Ga0501080_0024662 | Ga0501080_0024662_40_624 | 172 |
| 223 | 3300049822 | Ga0501035_0363052 | Ga0501035_0363052_378_962 | 172 |
| 224 | 3300049822 | Ga0501035_0465048 | Ga0501035_0465048_424_1020 | 172 |
| 225 | 3300049824 | Ga0501045_0038895 | Ga0501045_0038895_685_1269 | 172 |
| 226 | 3300050507 | nmdc:mga05p37_466751_c1 | nmdc:mga05p37_466751_c1_670_1254 | 172 |
| 227 | 3300050508 | nmdc:mga09592_330962_c1 | nmdc:mga09592_330962_c1_429_1025 | 172 |
| 228 | 3300050509 | nmdc:mga0qj67_528938_c1 | nmdc:mga0qj67_528938_c1_254_850 | 172 |
| 229 | 3300050509 | nmdc:mga0qj67_6110_c1 | nmdc:mga0qj67_6110_c1_4220_4816 | 172 |
| 230 | 3300050510 | nmdc:mga06r32_13589_c1 | nmdc:mga06r32_13589_c1_720_1316 | 172 |
| 231 | 3300050510 | nmdc:mga06r32_595505_c1 | nmdc:mga06r32_595505_c1_187_783 | 172 |
| 232 | 3300053077 | Ga0495601_0011164 | Ga0495601_0011164_1025_1609 | 172 |
| 233 | 3300053087 | Ga0500643_000219 | Ga0500643_000219_10203_10766 | 172 |
| 234 | 3300054114 | Ga0501084_0003460 | Ga0501084_0003460_557_1141 | 172 |
| 235 | 3300060353 | Ga0501082_0006112 | Ga0501082_0006112_9773_10357 | 172 |
| 236 | 3300061734 | Ga0530510_0003204 | Ga0530510_0003204_4084_4668 | 172 |
| 237 | 3300003781 | Ga0055536_1002550 | Ga0055536_10025504 | 173 |
| 238 | 3300003781 | Ga0055536_1007994 | Ga0055536_10079943 | 173 |
| 239 | 3300003781 | Ga0055536_1013607 | Ga0055536_10136072 | 173 |
| 240 | 3300003784 | Ga0055534_1013686 | Ga0055534_10136862 | 173 |
| 241 | 3300003791 | Ga0055530_10000522 | Ga0055530_1000052220 | 173 |
| 242 | 3300003791 | Ga0055530_10073589 | Ga0055530_100735891 | 173 |
| 243 | 3300003794 | Ga0055531_10002871 | Ga0055531_100028714 | 173 |
| 244 | 3300005289 | Ga0065704_10308270 | Ga0065704_103082701 | 173 |
| 245 | 3300005329 | Ga0070683_100121420 | Ga0070683_1001214202 | 173 |
| 246 | 3300005338 | Ga0068868_100000063 | Ga0068868_10000006360 | 173 |
| 247 | 3300005339 | Ga0070660_100019823 | Ga0070660_1000198234 | 173 |
| 248 | 3300005355 | Ga0070671_100351490 | Ga0070671_1003514902 | 173 |
| 249 | 3300005366 | Ga0070659_100000034 | Ga0070659_10000003498 | 173 |
| 250 | 3300005441 | Ga0070700_100106550 | Ga0070700_1001065503 | 173 |
| 251 | 3300005444 | Ga0070694_100162686 | Ga0070694_1001626862 | 173 |
| 252 | 3300005544 | Ga0070686_100000140 | Ga0070686_10000014058 | 173 |
| 253 | 3300005546 | Ga0070696_100098839 | Ga0070696_1000988392 | 173 |
| 254 | 3300005548 | Ga0070665_100000105 | Ga0070665_10000010542 | 173 |
| 255 | 3300005548 | Ga0070665_100002184 | Ga0070665_1000021843 | 173 |
| 256 | 3300005563 | Ga0068855_100309264 | Ga0068855_1003092642 | 173 |
| 257 | 3300005841 | Ga0068863_100022271 | Ga0068863_1000222714 | 173 |
| 258 | 3300005843 | Ga0068860_100123687 | Ga0068860_1001236872 | 173 |
| 259 | 3300006871 | Ga0075434_100194328 | Ga0075434_1001943282 | 173 |
| 260 | 3300009093 | Ga0105240_10008445 | Ga0105240_100084457 | 173 |
| 261 | 3300009098 | Ga0105245_10009778 | Ga0105245_100097785 | 173 |
| 262 | 3300009148 | Ga0105243_10637569 | Ga0105243_106375692 | 173 |
| 263 | 3300009148 | Ga0105243_10820076 | Ga0105243_108200762 | 173 |
| 264 | 3300013308 | Ga0157375_10442310 | Ga0157375_104423103 | 173 |
| 265 | 3300014325 | Ga0163163_10844886 | Ga0163163_108448862 | 173 |
| 266 | 3300017792 | Ga0163161_10452167 | Ga0163161_104521672 | 173 |
| 267 | 3300025291 | Ga0209675_1003710 | Ga0209675_10037107 | 173 |
| 268 | 3300025292 | Ga0209676_1000557 | Ga0209676_100055715 | 173 |
| 269 | 3300025292 | Ga0209676_1001387 | Ga0209676_10013877 | 173 |
| 270 | 3300025292 | Ga0209676_1001888 | Ga0209676_100188815 | 173 |
| 271 | 3300025292 | Ga0209676_1062433 | Ga0209676_10624332 | 173 |
| 272 | 3300025294 | Ga0209025_1036502 | Ga0209025_10365023 | 173 |
| 273 | 3300025298 | Ga0209050_1000017 | Ga0209050_100001761 | 173 |
| 274 | 3300025298 | Ga0209050_1003770 | Ga0209050_10037705 | 173 |
| 275 | 3300025304 | Ga0209257_1001118 | Ga0209257_100111823 | 173 |
| 276 | 3300025304 | Ga0209257_1001719 | Ga0209257_100171917 | 173 |
| 277 | 3300025903 | Ga0207680_10240699 | Ga0207680_102406992 | 173 |
| 278 | 3300025907 | Ga0207645_10161383 | Ga0207645_101613832 | 173 |
| 279 | 3300025913 | Ga0207695_10152244 | Ga0207695_101522443 | 173 |
| 280 | 3300025919 | Ga0207657_10000839 | Ga0207657_100008394 | 173 |
| 281 | 3300025927 | Ga0207687_10029259 | Ga0207687_100292595 | 173 |
| 282 | 3300025931 | Ga0207644_10262625 | Ga0207644_102626252 | 173 |
| 283 | 3300025932 | Ga0207690_10000005 | Ga0207690_10000005305 | 173 |
| 284 | 3300025949 | Ga0207667_10638013 | Ga0207667_106380132 | 173 |
| 285 | 3300025981 | Ga0207640_10653420 | Ga0207640_106534202 | 173 |
| 286 | 3300026023 | Ga0207677_10000044 | Ga0207677_1000004459 | 173 |
| 287 | 3300026075 | Ga0207708_10209280 | Ga0207708_102092802 | 173 |
| 288 | 3300026088 | Ga0207641_10035171 | Ga0207641_100351713 | 173 |
| 289 | 3300026142 | Ga0207698_10811690 | Ga0207698_108116901 | 173 |
| 290 | 3300027395 | Ga0209996_1007658 | Ga0209996_10076582 | 173 |
| 291 | 3300027462 | Ga0210000_1000719 | Ga0210000_10007193 | 173 |
| 292 | 3300027526 | Ga0209968_1005366 | Ga0209968_10053663 | 173 |
| 293 | 3300028379 | Ga0268266_10000055 | Ga0268266_10000055245 | 173 |
| 294 | 3300028379 | Ga0268266_10098288 | Ga0268266_100982882 | 173 |
| 295 | 3300031901 | Ga0307406_10182713 | Ga0307406_101827132 | 173 |
| 296 | 3300031901 | Ga0307406_10375685 | Ga0307406_103756852 | 173 |
| 297 | 3300032004 | Ga0307414_10001549 | Ga0307414_100015496 | 173 |
| 298 | 3300032004 | Ga0307414_10079731 | Ga0307414_100797312 | 173 |
| 299 | 3300032004 | Ga0307414_10163229 | Ga0307414_101632293 | 173 |
| 300 | 3300032004 | Ga0307414_10369030 | Ga0307414_103690303 | 173 |
| 301 | 3300032004 | Ga0307414_10444246 | Ga0307414_104442462 | 173 |
| 302 | 3300032005 | Ga0307411_10040338 | Ga0307411_100403383 | 173 |
| 303 | 3300032005 | Ga0307411_10653775 | Ga0307411_106537751 | 173 |
| 304 | 3300037471 | Ga0395905_0673841 | Ga0395905_0673841_128_700 | 173 |
| 305 | 3300039437 | Ga0436365_1862304 | Ga0436365_1862304_16095_16676 | 173 |
| 306 | 3300042437 | Ga0439444_0010931 | Ga0439444_0010931_45_629 | 173 |
| 307 | 3300042439 | Ga0439464_0137737 | Ga0439464_0137737_148_744 | 173 |
| 308 | 3300046471 | Ga0495650_0094611 | Ga0495650_0094611_195_752 | 173 |
| 309 | 3300046512 | Ga0495610_0162692 | Ga0495610_0162692_299_871 | 173 |
| 310 | 3300046513 | Ga0495616_0000022 | Ga0495616_0000022_87492_88049 | 173 |
| 311 | 3300046519 | Ga0495632_0054694 | Ga0495632_0054694_1347_1931 | 173 |
| 312 | 3300046522 | Ga0495643_0025809 | Ga0495643_0025809_2439_3011 | 173 |
| 313 | 3300046525 | Ga0495663_0058623 | Ga0495663_0058623_497_1153 | 173 |
| 314 | 3300046616 | Ga0495668_0000004 | Ga0495668_0000004_428235_428807 | 173 |
| 315 | 3300046660 | Ga0495625_0000553 | Ga0495625_0000553_43377_43949 | 173 |
| 316 | 3300048911 | Ga0496108_0096722 | Ga0496108_0096722_1142_1714 | 173 |
| 317 | 3300048927 | Ga0496124_0382684 | Ga0496124_0382684_189_761 | 173 |
| 318 | 3300049572 | Ga0501036_0581603 | Ga0501036_0581603_243_839 | 173 |
| 319 | 3300049582 | Ga0501048_0160788 | Ga0501048_0160788_334_930 | 173 |
| 320 | 3300049589 | Ga0501073_0612673 | Ga0501073_0612673_11_607 | 173 |
| 321 | 3300049592 | Ga0501076_0385907 | Ga0501076_0385907_430_1026 | 173 |
| 322 | 3300050512 | nmdc:mga0n895_92159_c1 | nmdc:mga0n895_92159_c1_474_1055 | 173 |
| 323 | 3300053091 | Ga0500647_0078205 | Ga0500647_0078205_663_1220 | 173 |
| 324 | 3300053108 | Ga0500562_010572 | Ga0500562_010572_909_1466 | 173 |
| 325 | 3300053134 | Ga0500658_0151592 | Ga0500658_0151592_83_655 | 173 |
| 326 | 3300053139 | Ga0500568_0002510 | Ga0500568_0002510_7254_7838 | 173 |
| 327 | 3300053140 | Ga0500573_0069531 | Ga0500573_0069531_1223_1804 | 173 |
| 328 | 3300053151 | Ga0500604_0000031 | Ga0500604_0000031_25196_25780 | 173 |
| 329 | 3300053151 | Ga0500604_0002272 | Ga0500604_0002272_2740_3297 | 173 |
| 330 | 3300053153 | Ga0500616_0001465 | Ga0500616_0001465_6149_6733 | 173 |
| 331 | 3300053158 | Ga0500627_0000049 | Ga0500627_0000049_25885_26457 | 173 |
| 332 | 3300053158 | Ga0500627_0016099 | Ga0500627_0016099_1771_2343 | 173 |
| 333 | 3300053158 | Ga0500627_0036470 | Ga0500627_0036470_1519_2076 | 173 |
| 334 | 3300053739 | Ga0500587_000417 | Ga0500587_000417_608_1198 | 173 |
| 335 | 3300005290 | Ga0065712_10318943 | Ga0065712_103189431 | 174 |
| 336 | 3300005330 | Ga0070690_100060358 | Ga0070690_1000603584 | 174 |
| 337 | 3300005331 | Ga0070670_100028698 | Ga0070670_1000286986 | 174 |
| 338 | 3300005331 | Ga0070670_100645169 | Ga0070670_1006451691 | 174 |
| 339 | 3300005338 | Ga0068868_101070760 | Ga0068868_1010707601 | 174 |
| 340 | 3300005340 | Ga0070689_100121635 | Ga0070689_1001216352 | 174 |
| 341 | 3300005343 | Ga0070687_100185033 | Ga0070687_1001850331 | 174 |
| 342 | 3300005347 | Ga0070668_100074846 | Ga0070668_1000748462 | 174 |
| 343 | 3300005347 | Ga0070668_100299186 | Ga0070668_1002991862 | 174 |
| 344 | 3300005353 | Ga0070669_100345079 | Ga0070669_1003450792 | 174 |
| 345 | 3300005354 | Ga0070675_100127337 | Ga0070675_1001273372 | 174 |
| 346 | 3300005354 | Ga0070675_100264366 | Ga0070675_1002643663 | 174 |
| 347 | 3300005354 | Ga0070675_100272925 | Ga0070675_1002729252 | 174 |
| 348 | 3300005355 | Ga0070671_100136363 | Ga0070671_1001363632 | 174 |
| 349 | 3300005356 | Ga0070674_100008899 | Ga0070674_1000088994 | 174 |
| 350 | 3300005356 | Ga0070674_100202326 | Ga0070674_1002023262 | 174 |
| 351 | 3300005364 | Ga0070673_100102438 | Ga0070673_1001024382 | 174 |
| 352 | 3300005367 | Ga0070667_100171897 | Ga0070667_1001718972 | 174 |
| 353 | 3300005438 | Ga0070701_10130632 | Ga0070701_101306321 | 174 |
| 354 | 3300005440 | Ga0070705_100609465 | Ga0070705_1006094652 | 174 |
| 355 | 3300005455 | Ga0070663_100201931 | Ga0070663_1002019312 | 174 |
| 356 | 3300005457 | Ga0070662_100063538 | Ga0070662_1000635382 | 174 |
| 357 | 3300005459 | Ga0068867_100006451 | Ga0068867_1000064514 | 174 |
| 358 | 3300005459 | Ga0068867_100104461 | Ga0068867_1001044612 | 174 |
| 359 | 3300005466 | Ga0070685_10285373 | Ga0070685_102853732 | 174 |
| 360 | 3300005543 | Ga0070672_100065270 | Ga0070672_1000652702 | 174 |
| 361 | 3300005544 | Ga0070686_100318664 | Ga0070686_1003186641 | 174 |
| 362 | 3300005548 | Ga0070665_100172679 | Ga0070665_1001726792 | 174 |
| 363 | 3300005549 | Ga0070704_101018157 | Ga0070704_1010181571 | 174 |
| 364 | 3300005578 | Ga0068854_100499613 | Ga0068854_1004996132 | 174 |
| 365 | 3300005616 | Ga0068852_100214509 | Ga0068852_1002145092 | 174 |
| 366 | 3300005616 | Ga0068852_100866795 | Ga0068852_1008667951 | 174 |
| 367 | 3300005617 | Ga0068859_100027031 | Ga0068859_1000270317 | 174 |
| 368 | 3300005617 | Ga0068859_100487604 | Ga0068859_1004876042 | 174 |
| 369 | 3300005618 | Ga0068864_100582411 | Ga0068864_1005824112 | 174 |
| 370 | 3300005618 | Ga0068864_100761466 | Ga0068864_1007614662 | 174 |
| 371 | 3300005719 | Ga0068861_100031256 | Ga0068861_1000312564 | 174 |
| 372 | 3300005840 | Ga0068870_10222769 | Ga0068870_102227692 | 174 |
| 373 | 3300005840 | Ga0068870_10477842 | Ga0068870_104778422 | 174 |
| 374 | 3300005841 | Ga0068863_100220834 | Ga0068863_1002208342 | 174 |
| 375 | 3300005841 | Ga0068863_100446185 | Ga0068863_1004461852 | 174 |
| 376 | 3300005842 | Ga0068858_100049472 | Ga0068858_1000494722 | 174 |
| 377 | 3300005843 | Ga0068860_100000903 | Ga0068860_10000090328 | 174 |
| 378 | 3300005843 | Ga0068860_100333878 | Ga0068860_1003338783 | 174 |
| 379 | 3300005843 | Ga0068860_100475791 | Ga0068860_1004757912 | 174 |
| 380 | 3300005844 | Ga0068862_100033939 | Ga0068862_1000339395 | 174 |
| 381 | 3300006028 | Ga0070717_10811336 | Ga0070717_108113362 | 174 |
| 382 | 3300006177 | Ga0075362_10030142 | Ga0075362_100301422 | 174 |
| 383 | 3300006178 | Ga0075367_10070525 | Ga0075367_100705252 | 174 |
| 384 | 3300006195 | Ga0075366_10056864 | Ga0075366_100568644 | 174 |
| 385 | 3300006237 | Ga0097621_100150814 | Ga0097621_1001508142 | 174 |
| 386 | 3300006358 | Ga0068871_100182195 | Ga0068871_1001821952 | 174 |
| 387 | 3300006881 | Ga0068865_100003663 | Ga0068865_1000036637 | 174 |
| 388 | 3300006881 | Ga0068865_100321729 | Ga0068865_1003217292 | 174 |
| 389 | 3300006931 | Ga0097620_100027032 | Ga0097620_1000270327 | 174 |
| 390 | 3300006931 | Ga0097620_100487595 | Ga0097620_1004875951 | 174 |
| 391 | 3300009094 | Ga0111539_10179513 | Ga0111539_101795132 | 174 |
| 392 | 3300009098 | Ga0105245_10246709 | Ga0105245_102467092 | 174 |
| 393 | 3300009148 | Ga0105243_10162637 | Ga0105243_101626372 | 174 |
| 394 | 3300009176 | Ga0105242_10069596 | Ga0105242_100695962 | 174 |
| 395 | 3300009177 | Ga0105248_10417796 | Ga0105248_104177962 | 174 |
| 396 | 3300009177 | Ga0105248_10476008 | Ga0105248_104760082 | 174 |
| 397 | 3300009553 | Ga0105249_10442664 | Ga0105249_104426641 | 174 |
| 398 | 3300013296 | Ga0157374_10125352 | Ga0157374_101253524 | 174 |
| 399 | 3300013297 | Ga0157378_10046586 | Ga0157378_100465862 | 174 |
| 400 | 3300013297 | Ga0157378_10385566 | Ga0157378_103855662 | 174 |
| 401 | 3300013306 | Ga0163162_10040290 | Ga0163162_100402906 | 174 |
| 402 | 3300013308 | Ga0157375_10605346 | Ga0157375_106053462 | 174 |
| 403 | 3300014325 | Ga0163163_10382828 | Ga0163163_103828282 | 174 |
| 404 | 3300014326 | Ga0157380_10007364 | Ga0157380_100073648 | 174 |
| 405 | 3300014326 | Ga0157380_10231710 | Ga0157380_102317102 | 174 |
| 406 | 3300014968 | Ga0157379_10035631 | Ga0157379_100356313 | 174 |
| 407 | 3300014968 | Ga0157379_10066556 | Ga0157379_100665564 | 174 |
| 408 | 3300014968 | Ga0157379_10117893 | Ga0157379_101178932 | 174 |
| 409 | 3300017792 | Ga0163161_10065092 | Ga0163161_100650922 | 174 |
| 410 | 3300025315 | Ga0207697_10009458 | Ga0207697_100094583 | 174 |
| 411 | 3300025893 | Ga0207682_10030036 | Ga0207682_100300362 | 174 |
| 412 | 3300025901 | Ga0207688_10008762 | Ga0207688_100087623 | 174 |
| 413 | 3300025903 | Ga0207680_10153493 | Ga0207680_101534933 | 174 |
| 414 | 3300025907 | Ga0207645_10012727 | Ga0207645_100127272 | 174 |
| 415 | 3300025908 | Ga0207643_10020601 | Ga0207643_100206012 | 174 |
| 416 | 3300025918 | Ga0207662_10042493 | Ga0207662_100424932 | 174 |
| 417 | 3300025923 | Ga0207681_10150675 | Ga0207681_101506752 | 174 |
| 418 | 3300025926 | Ga0207659_10203034 | Ga0207659_102030342 | 174 |
| 419 | 3300025926 | Ga0207659_10881900 | Ga0207659_108819001 | 174 |
| 420 | 3300025927 | Ga0207687_10499813 | Ga0207687_104998132 | 174 |
| 421 | 3300025931 | Ga0207644_10342530 | Ga0207644_103425301 | 174 |
| 422 | 3300025931 | Ga0207644_10342622 | Ga0207644_103426222 | 174 |
| 423 | 3300025933 | Ga0207706_10041710 | Ga0207706_100417103 | 174 |
| 424 | 3300025934 | Ga0207686_10146154 | Ga0207686_101461542 | 174 |
| 425 | 3300025935 | Ga0207709_10041714 | Ga0207709_100417144 | 174 |
| 426 | 3300025935 | Ga0207709_10208451 | Ga0207709_102084511 | 174 |
| 427 | 3300025937 | Ga0207669_10792508 | Ga0207669_107925081 | 174 |
| 428 | 3300025938 | Ga0207704_10005537 | Ga0207704_100055377 | 174 |
| 429 | 3300025938 | Ga0207704_10115058 | Ga0207704_101150582 | 174 |
| 430 | 3300025940 | Ga0207691_10332307 | Ga0207691_103323072 | 174 |
| 431 | 3300025942 | Ga0207689_10195671 | Ga0207689_101956711 | 174 |
| 432 | 3300025960 | Ga0207651_10013310 | Ga0207651_100133102 | 174 |
| 433 | 3300025961 | Ga0207712_10050532 | Ga0207712_100505324 | 174 |
| 434 | 3300025961 | Ga0207712_10515660 | Ga0207712_105156602 | 174 |
| 435 | 3300025972 | Ga0207668_10146778 | Ga0207668_101467782 | 174 |
| 436 | 3300025972 | Ga0207668_10586643 | Ga0207668_105866432 | 174 |
| 437 | 3300025981 | Ga0207640_10163832 | Ga0207640_101638322 | 174 |
| 438 | 3300025986 | Ga0207658_10238386 | Ga0207658_102383862 | 174 |
| 439 | 3300026023 | Ga0207677_10686216 | Ga0207677_106862161 | 174 |
| 440 | 3300026035 | Ga0207703_10031316 | Ga0207703_100313164 | 174 |
| 441 | 3300026035 | Ga0207703_10273572 | Ga0207703_102735722 | 174 |
| 442 | 3300026067 | Ga0207678_10121197 | Ga0207678_101211972 | 174 |
| 443 | 3300026075 | Ga0207708_10019486 | Ga0207708_100194862 | 174 |
| 444 | 3300026088 | Ga0207641_10198953 | Ga0207641_101989532 | 174 |
| 445 | 3300026088 | Ga0207641_10302402 | Ga0207641_103024022 | 174 |
| 446 | 3300026088 | Ga0207641_10475736 | Ga0207641_104757362 | 174 |
| 447 | 3300026089 | Ga0207648_10010128 | Ga0207648_100101285 | 174 |
| 448 | 3300026095 | Ga0207676_10077980 | Ga0207676_100779804 | 174 |
| 449 | 3300026095 | Ga0207676_10561714 | Ga0207676_105617142 | 174 |
| 450 | 3300026095 | Ga0207676_10886521 | Ga0207676_108865212 | 174 |
| 451 | 3300026116 | Ga0207674_10077608 | Ga0207674_100776082 | 174 |
| 452 | 3300026118 | Ga0207675_100007331 | Ga0207675_10000733110 | 174 |
| 453 | 3300026118 | Ga0207675_100042970 | Ga0207675_1000429702 | 174 |
| 454 | 3300026142 | Ga0207698_10607701 | Ga0207698_106077011 | 174 |
| 455 | 3300026142 | Ga0207698_10728667 | Ga0207698_107286672 | 174 |
| 456 | 3300027907 | Ga0207428_10080158 | Ga0207428_100801582 | 174 |
| 457 | 3300028379 | Ga0268266_10443517 | Ga0268266_104435172 | 174 |
| 458 | 3300028380 | Ga0268265_10017185 | Ga0268265_100171852 | 174 |
| 459 | 3300028381 | Ga0268264_10016446 | Ga0268264_100164463 | 174 |
| 460 | 3300028381 | Ga0268264_10451617 | Ga0268264_104516172 | 174 |
| 461 | 3300028577 | Ga0265318_10062847 | Ga0265318_100628471 | 174 |
| 462 | 3300031235 | Ga0265330_10059375 | Ga0265330_100593752 | 174 |
| 463 | 3300031238 | Ga0265332_10004178 | Ga0265332_100041783 | 174 |
| 464 | 3300031239 | Ga0265328_10014479 | Ga0265328_100144793 | 174 |
| 465 | 3300031240 | Ga0265320_10023211 | Ga0265320_100232114 | 174 |
| 466 | 3300031242 | Ga0265329_10039391 | Ga0265329_100393912 | 174 |
| 467 | 3300031250 | Ga0265331_10001179 | Ga0265331_100011796 | 174 |
| 468 | 3300031251 | Ga0265327_10163829 | Ga0265327_101638291 | 174 |
| 469 | 3300031344 | Ga0265316_10049383 | Ga0265316_100493833 | 174 |
| 470 | 3300031595 | Ga0265313_10053687 | Ga0265313_100536871 | 174 |
| 471 | 3300031711 | Ga0265314_10000887 | Ga0265314_100008874 | 174 |
| 472 | 3300031712 | Ga0265342_10029125 | Ga0265342_100291251 | 174 |
| 473 | 3300031852 | Ga0307410_10294831 | Ga0307410_102948312 | 174 |
| 474 | 3300032005 | Ga0307411_10216370 | Ga0307411_102163702 | 174 |
| 475 | 3300035112 | Ga0373932_0113151 | Ga0373932_0113151_234_812 | 174 |
| 476 | 3300045051 | Ga0451576_0318366 | Ga0451576_0318366_159_743 | 174 |
| 477 | 3300046459 | Ga0495629_0185204 | Ga0495629_0185204_15_599 | 174 |
| 478 | 3300050489 | nmdc:mga03683_36513_c1 | nmdc:mga03683_36513_c1_552_1130 | 174 |
| 479 | 3300050493 | nmdc:mga0k408_28373_c1 | nmdc:mga0k408_28373_c1_171_749 | 174 |
| 480 | 3300050493 | nmdc:mga0k408_357172_c1 | nmdc:mga0k408_357172_c1_232_810 | 174 |
| 481 | 3300050511 | nmdc:mga08y16_125138_c1 | nmdc:mga08y16_125138_c1_1461_2045 | 174 |
| 482 | 3300006881 | Ga0068865_100109023 | Ga0068865_1001090232 | 175 |
| 483 | 3300009148 | Ga0105243_10451846 | Ga0105243_104518462 | 175 |
| 484 | 3300009545 | Ga0105237_10401355 | Ga0105237_104013552 | 175 |
| 485 | 3300014968 | Ga0157379_10232735 | Ga0157379_102327353 | 175 |
| 486 | 3300025292 | Ga0209676_1014718 | Ga0209676_10147183 | 175 |
| 487 | 3300025294 | Ga0209025_1038151 | Ga0209025_10381513 | 175 |
| 488 | 3300025304 | Ga0209257_1001176 | Ga0209257_100117636 | 175 |
| 489 | 3300025918 | Ga0207662_10149753 | Ga0207662_101497533 | 175 |
| 490 | 3300025935 | Ga0207709_10224338 | Ga0207709_102243382 | 175 |
| 491 | 3300032004 | Ga0307414_10005871 | Ga0307414_100058714 | 175 |
| 492 | 3300032004 | Ga0307414_10090859 | Ga0307414_100908592 | 175 |
| 493 | 3300032004 | Ga0307414_10433509 | Ga0307414_104335092 | 175 |
| 494 | 3300041463 | Ga0451804_0684765 | Ga0451804_0684765_75_659 | 175 |
| 495 | 3300041512 | Ga0451853_0042166 | Ga0451853_0042166_42_632 | 175 |
| 496 | 3300046557 | Ga0495622_0001538 | Ga0495622_0001538_756_1319 | 175 |
| 497 | 3300049759 | Ga0501262_025252 | Ga0501262_025252_50_637 | 175 |
| 498 | 3300053087 | Ga0500643_000465 | Ga0500643_000465_9982_10545 | 175 |
| 499 | 3300003215 | JGI25153J46596_10001493 | JGI25153J46596_100014933 | 176 |
| 500 | 3300009551 | Ga0105238_10683603 | Ga0105238_106836032 | 176 |
| 501 | 3300025272 | Ga0209455_1010168 | Ga0209455_10101682 | 176 |
| 502 | 3300025297 | Ga0209758_1000036 | Ga0209758_1000036217 | 176 |
| 503 | 3300028379 | Ga0268266_10695186 | Ga0268266_106951862 | 176 |
| 504 | 3300005719 | Ga0068861_100961631 | Ga0068861_1009616311 | 177 |
| 505 | 3300025910 | Ga0207684_10166258 | Ga0207684_101662583 | 177 |
| 506 | 3300038705 | Ga0237819_00574 | Ga0237819_00574_6649_7212 | 177 |
| 507 | 3300005295 | Ga0065707_10168593 | Ga0065707_101685932 | 178 |
| 508 | 3300005536 | Ga0070697_100495558 | Ga0070697_1004955582 | 178 |
| 509 | 3300006844 | Ga0075428_100198067 | Ga0075428_1001980674 | 178 |
| 510 | 3300006847 | Ga0075431_100054682 | Ga0075431_1000546824 | 178 |
| 511 | 3300006871 | Ga0075434_100443445 | Ga0075434_1004434452 | 178 |
| 512 | 3300007076 | Ga0075435_100130668 | Ga0075435_1001306683 | 178 |
| 513 | 3300007076 | Ga0075435_100451210 | Ga0075435_1004512102 | 178 |
| 514 | 3300009098 | Ga0105245_10412655 | Ga0105245_104126552 | 178 |
| 515 | 3300009147 | Ga0114129_10033159 | Ga0114129_100331593 | 178 |
| 516 | 3300009176 | Ga0105242_10002502 | Ga0105242_100025028 | 178 |
| 517 | 3300020080 | Ga0206350_11574848 | Ga0206350_115748481 | 178 |
| 518 | 3300025934 | Ga0207686_10046068 | Ga0207686_100460682 | 178 |
| 519 | 3300025939 | Ga0207665_10300827 | Ga0207665_103008272 | 178 |
| 520 | 3300026041 | Ga0207639_10631123 | Ga0207639_106311231 | 178 |
| 521 | 3300028786 | Ga0307517_10078802 | Ga0307517_100788022 | 178 |
| 522 | 3300031251 | Ga0265327_10002178 | Ga0265327_1000217815 | 178 |
| 523 | 3300031344 | Ga0265316_10001190 | Ga0265316_1000119012 | 178 |
| 524 | 3300031548 | Ga0307408_100707213 | Ga0307408_1007072132 | 178 |
| 525 | 3300031730 | Ga0307516_10000094 | Ga0307516_1000009496 | 178 |
| 526 | 3300031995 | Ga0307409_100409845 | Ga0307409_1004098453 | 178 |
| 527 | 3300032002 | Ga0307416_100521998 | Ga0307416_1005219982 | 178 |
| 528 | 3300041404 | Ga0439436_0074971 | Ga0439436_0074971_256_840 | 178 |
| 529 | 3300042001 | Ga0439441_001972 | Ga0439441_001972_1352_1942 | 178 |
| 530 | 3300050489 | nmdc:mga03683_248435_c1 | nmdc:mga03683_248435_c1_92_685 | 178 |
| 531 | 3300050507 | nmdc:mga05p37_27888_c1 | nmdc:mga05p37_27888_c1_5033_5617 | 178 |
| 532 | 3300050508 | nmdc:mga09592_94489_c1 | nmdc:mga09592_94489_c1_1892_2476 | 178 |
| 533 | 3300050509 | nmdc:mga0qj67_102112_c1 | nmdc:mga0qj67_102112_c1_1307_1903 | 178 |
| 534 | 3300050510 | nmdc:mga06r32_150345_c1 | nmdc:mga06r32_150345_c1_1229_1813 | 178 |
| 535 | 3300050512 | nmdc:mga0n895_20283_c1 | nmdc:mga0n895_20283_c1_3132_3731 | 178 |
| 536 | 3300050513 | nmdc:mga0rr50_213794_c1 | nmdc:mga0rr50_213794_c1_792_1391 | 178 |
| 537 | 3300050514 | nmdc:mga08x19_12629_c1 | nmdc:mga08x19_12629_c1_2371_2970 | 178 |
| 538 | 3300050514 | nmdc:mga08x19_14797_c1 | nmdc:mga08x19_14797_c1_305_904 | 178 |
| 539 | 3300050514 | nmdc:mga08x19_477428_c1 | nmdc:mga08x19_477428_c1_40_624 | 178 |
| 540 | 3300050515 | nmdc:mga0a205_156041_c1 | nmdc:mga0a205_156041_c1_1233_1832 | 178 |
| 541 | 3300053137 | Ga0500561_0044765 | Ga0500561_0044765_99_692 | 178 |
| 542 | 3300002067 | JGI24735J21928_10135463 | JGI24735J21928_101354631 | 179 |
| 543 | 3300005440 | Ga0070705_100068326 | Ga0070705_1000683262 | 179 |
| 544 | 3300005547 | Ga0070693_100279134 | Ga0070693_1002791342 | 179 |
| 545 | 3300005549 | Ga0070704_100106528 | Ga0070704_1001065283 | 179 |
| 546 | 3300005577 | Ga0068857_100027365 | Ga0068857_1000273652 | 179 |
| 547 | 3300005617 | Ga0068859_100156144 | Ga0068859_1001561443 | 179 |
| 548 | 3300005843 | Ga0068860_100046033 | Ga0068860_1000460332 | 179 |
| 549 | 3300005844 | Ga0068862_100040916 | Ga0068862_1000409164 | 179 |
| 550 | 3300006852 | Ga0075433_10629491 | Ga0075433_106294911 | 179 |
| 551 | 3300006871 | Ga0075434_100039264 | Ga0075434_1000392642 | 179 |
| 552 | 3300006931 | Ga0097620_100156131 | Ga0097620_1001561313 | 179 |
| 553 | 3300007076 | Ga0075435_100294055 | Ga0075435_1002940553 | 179 |
| 554 | 3300009147 | Ga0114129_10164186 | Ga0114129_101641863 | 179 |
| 555 | 3300009176 | Ga0105242_10078105 | Ga0105242_100781052 | 179 |
| 556 | 3300009176 | Ga0105242_10884420 | Ga0105242_108844202 | 179 |
| 557 | 3300009551 | Ga0105238_10591871 | Ga0105238_105918711 | 179 |
| 558 | 3300009553 | Ga0105249_11573734 | Ga0105249_115737341 | 179 |
| 559 | 3300013297 | Ga0157378_10797836 | Ga0157378_107978362 | 179 |
| 560 | 3300013307 | Ga0157372_10408544 | Ga0157372_104085442 | 179 |
| 561 | 3300013308 | Ga0157375_11501661 | Ga0157375_115016611 | 179 |
| 562 | 3300014326 | Ga0157380_10770998 | Ga0157380_107709982 | 179 |
| 563 | 3300014497 | Ga0182008_10552911 | Ga0182008_105529111 | 179 |
| 564 | 3300025934 | Ga0207686_10017443 | Ga0207686_100174434 | 179 |
| 565 | 3300025961 | Ga0207712_11032911 | Ga0207712_110329111 | 179 |
| 566 | 3300026116 | Ga0207674_10034895 | Ga0207674_100348955 | 179 |
| 567 | 3300028380 | Ga0268265_10059327 | Ga0268265_100593273 | 179 |
| 568 | 3300028381 | Ga0268264_10096134 | Ga0268264_100961342 | 179 |
| 569 | 3300031250 | Ga0265331_10017366 | Ga0265331_100173664 | 179 |
| 570 | 3300031911 | Ga0307412_10046703 | Ga0307412_100467032 | 179 |
| 571 | 3300037466 | Ga0395898_0402019 | Ga0395898_0402019_108_698 | 179 |
| 572 | 3300038443 | Ga0395901_0019134 | Ga0395901_0019134_2989_3579 | 179 |
| 573 | 3300048906 | Ga0496103_0184047 | Ga0496103_0184047_90_674 | 179 |
| 574 | 3300048909 | Ga0496106_0062415 | Ga0496106_0062415_879_1463 | 179 |
| 575 | 3300048910 | Ga0496107_0090125 | Ga0496107_0090125_744_1328 | 179 |
| 576 | 3300048914 | Ga0496111_0577511 | Ga0496111_0577511_31_615 | 179 |
| 577 | 3300048915 | Ga0496112_0165469 | Ga0496112_0165469_1042_1626 | 179 |
| 578 | 3300048916 | Ga0496113_0234721 | Ga0496113_0234721_668_1252 | 179 |
| 579 | 3300049583 | Ga0501067_0113761 | Ga0501067_0113761_615_1199 | 179 |
| 580 | 3300050507 | nmdc:mga05p37_45790_c1 | nmdc:mga05p37_45790_c1_3634_4218 | 179 |
| 581 | 3300050512 | nmdc:mga0n895_45914_c1 | nmdc:mga0n895_45914_c1_536_1120 | 179 |
| 582 | 3300050515 | nmdc:mga0a205_93318_c1 | nmdc:mga0a205_93318_c1_99_683 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7rpr-assembly2.cif.gz_B | borrelia miyamotoi fbpa complement inhibitory domain | 0.4945 | 35 | 173 |
| 4xev-assembly1.cif.gz_A | fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide | 0.4916 | 41 | 178 |
| 5zle-assembly1.cif.gz_A | human duodenal cytochrome b (dcytb) in substrate free form | 0.488 | 1 | 176 |
| 7ae9-assembly1.cif.gz_B | crystal structure of mono-ampylated hepn(r46e) toxin in complex with mnt antitoxin | 0.4854 | 35 | 176 |
| 5zle-assembly1.cif.gz_A | human duodenal cytochrome b (dcytb) in substrate free form | 0.4715 | 1 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A286YA76_825_961_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.6362 | 35 | 176 | 1.20.120.230 |
| af_I1KW97_209_308_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6067 | 45 | 147 | 1.20.120.550 |
| af_Q61140_738_874_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.5961 | 35 | 177 | 1.20.120.230 |
| af_A0A286YA76_825_961_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.5957 | 35 | 176 | 1.20.120.230 |
| af_I1KW97_209_308_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.5796 | 45 | 147 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383EIT8-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9784 | 35 | 141 |
GO:0016020
|
| AF-A0A7C7S3Q6-F1-model_v4 | deleted | 0.9667 | 31 | 173 |
|
| AF-A0A2S6TV52-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9621 | 30 | 178 |
GO:0016020
|
| AF-A0A1V1PRK1-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9547 | 1 | 178 |
GO:0016020
|
| AF-A0A2E7UK13-F1-model_v4 | Urate oxidase N-terminal domain-containing protein | 0.9534 | 35 | 177 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar