F466207

General Info

Members Datasets Scaffolds Average Seq Length
582 317 577 191

Family's Representative Sequence

Representative Sequence 3300046525|Ga0495663_0058623|Ga0495663_0058623_497_1153
Length 218
Sequence LSLPPVAGIAGGVRHRVALGREKEGELQMDKFFGNLHAVLGAGLVLASILMLGLNGQNFEDGAAAAGAVMRWLHTFFGVLWIGLLYYFNFVQIPTMPKIPAELKPGVSKHIAPAALFWFRWAAAATVVLGLAIAGHAKYLVPALSFQDPYKLIGVGMWLGLIMAFNVWFVIWPNQKKALGIVAADDATKAKSAKTAMIFSRTNTLLSIPMLYAMVSFS

Samples

Sample ID Description Type Environment
1 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
5 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
220 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
226 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
287 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
303 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
310 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
311 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
314 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.97
Metatranscriptomes 0.17
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 0
Rhizoplane 2.58
Rhizosphere 86.94
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10135463 3300002067 Bacteria 710
2 JGI25153J46596_10001493 3300003215 Bacteria 13955
3 Ga0055536_1002550 3300003781 Bacteria 10179
4 Ga0055536_1007994 3300003781 Bacteria 4628
5 Ga0055536_1013607 3300003781 Bacteria 2917
6 Ga0055534_1013686 3300003784 Bacteria 1550
7 Ga0055530_10000522 3300003791 Bacteria 33291
8 Ga0055530_10073589 3300003791 Bacteria 731
9 Ga0055531_10002871 3300003794 Bacteria 11231
10 Ga0065704_10308270 3300005289 Bacteria 873
11 Ga0065712_10318943 3300005290 Bacteria 832
12 Ga0065715_10530377 3300005293 Bacteria 756
13 Ga0065707_10168593 3300005295 Bacteria 1502
14 Ga0070676_10019938 3300005328 Bacteria 3736
15 Ga0070683_100053606 3300005329 Bacteria 3737
16 Ga0070683_100121420 3300005329 Bacteria 2468
17 Ga0070690_100060358 3300005330 Bacteria 2440
18 Ga0070690_100169261 3300005330 Bacteria 1503
19 Ga0070670_100000570 3300005331 Bacteria 29190
20 Ga0070670_100028698 3300005331 Bacteria 4789
21 Ga0070670_100078166 3300005331 Bacteria 2842
22 Ga0070670_100645169 3300005331 Bacteria 949
23 Ga0070677_10085856 3300005333 Bacteria 1358
24 Ga0070682_100995762 3300005337 Bacteria 695
25 Ga0068868_100000063 3300005338 Bacteria 61783
26 Ga0068868_100004436 3300005338 Bacteria 9841
27 Ga0068868_101070760 3300005338 Bacteria 741
28 Ga0070660_100019823 3300005339 Bacteria 4934
29 Ga0070689_100009271 3300005340 Bacteria 6973
30 Ga0070689_100121635 3300005340 Bacteria 2085
31 Ga0070687_100185033 3300005343 Bacteria 1251
32 Ga0070687_100247443 3300005343 Bacteria 1106
33 Ga0070687_100290079 3300005343 Bacteria 1034
34 Ga0070661_100019873 3300005344 Bacteria 4786
35 Ga0070668_100000001 3300005347 Bacteria 275905
36 Ga0070668_100074846 3300005347 Bacteria 2643
37 Ga0070668_100299186 3300005347 Bacteria 1349
38 Ga0070669_100022464 3300005353 Bacteria 4510
39 Ga0070669_100345079 3300005353 Bacteria 1207
40 Ga0070675_100004568 3300005354 Bacteria 10566
41 Ga0070675_100015141 3300005354 Bacteria 6090
42 Ga0070675_100127337 3300005354 Bacteria 2168
43 Ga0070675_100264366 3300005354 Bacteria 1508
44 Ga0070675_100272925 3300005354 Bacteria 1484
45 Ga0070671_100000167 3300005355 Bacteria 43269
46 Ga0070671_100136363 3300005355 Bacteria 2069
47 Ga0070671_100197770 3300005355 Bacteria 1704
48 Ga0070671_100351490 3300005355 Bacteria 1258
49 Ga0070674_100008899 3300005356 Bacteria 5994
50 Ga0070674_100073308 3300005356 Bacteria 2426
51 Ga0070674_100202326 3300005356 Bacteria 1534
52 Ga0070673_100102438 3300005364 Bacteria 2360
53 Ga0070659_100000034 3300005366 Bacteria 115416
54 Ga0070667_100000006 3300005367 Bacteria 336732
55 Ga0070667_100171897 3300005367 Bacteria 1913
56 Ga0070701_10130632 3300005438 Bacteria 1426
57 Ga0070705_100068326 3300005440 Bacteria 2138
58 Ga0070705_100243702 3300005440 Bacteria 1258
59 Ga0070705_100609465 3300005440 Bacteria 846
60 Ga0070700_100106550 3300005441 Bacteria 1856
61 Ga0070694_100106377 3300005444 Bacteria 1992
62 Ga0070694_100130111 3300005444 Unclassified 1817
63 Ga0070694_100162686 3300005444 Bacteria 1639
64 Ga0070694_100188574 3300005444 Bacteria 1530
65 Ga0070708_100137586 3300005445 Unclassified 2263
66 Ga0070663_100201931 3300005455 Bacteria 1552
67 Ga0070678_100019701 3300005456 Bacteria 4407
68 Ga0070678_100053499 3300005456 Bacteria 2936
69 Ga0070662_100063538 3300005457 Bacteria 2701
70 Ga0070662_100941763 3300005457 Bacteria 738
71 Ga0070681_10077083 3300005458 Bacteria 3291
72 Ga0068867_100006451 3300005459 Bacteria 8284
73 Ga0068867_100104461 3300005459 Bacteria 2168
74 Ga0068867_100229217 3300005459 Bacteria 1501
75 Ga0068867_100324926 3300005459 Bacteria 1276
76 Ga0070685_10285373 3300005466 Bacteria 1107
77 Ga0070685_10360115 3300005466 Bacteria 997
78 Ga0070706_100107619 3300005467 Bacteria 2594
79 Ga0070707_100011178 3300005468 Bacteria 8366
80 Ga0070707_100419461 3300005468 Bacteria 1299
81 Ga0070707_100695297 3300005468 Bacteria 980
82 Ga0070679_100092115 3300005530 Bacteria 3019
83 Ga0070697_100019678 3300005536 Bacteria 5332
84 Ga0070697_100495558 3300005536 Bacteria 1068
85 Ga0068853_100233628 3300005539 Bacteria 1683
86 Ga0070672_100021266 3300005543 Bacteria 4745
87 Ga0070672_100065270 3300005543 Bacteria 2879
88 Ga0070686_100000140 3300005544 Bacteria 49544
89 Ga0070686_100318664 3300005544 Bacteria 1158
90 Ga0070695_100043021 3300005545 Bacteria 2870
91 Ga0070695_100098510 3300005545 Bacteria 1965
92 Ga0070696_100004761 3300005546 Bacteria 9063
93 Ga0070696_100098839 3300005546 Bacteria 2088
94 Ga0070696_100347609 3300005546 Bacteria 1148
95 Ga0070693_100126339 3300005547 Bacteria 1593
96 Ga0070693_100279134 3300005547 Bacteria 1118
97 Ga0070665_100000105 3300005548 Bacteria 157734
98 Ga0070665_100002184 3300005548 Bacteria 21806
99 Ga0070665_100172679 3300005548 Bacteria 2162
100 Ga0070665_100462250 3300005548 Bacteria 1279
101 Ga0070704_100069165 3300005549 Bacteria 2557
102 Ga0070704_100106528 3300005549 Bacteria 2124
103 Ga0070704_100495014 3300005549 Bacteria 1060
104 Ga0070704_100644614 3300005549 Bacteria 935
105 Ga0070704_101018157 3300005549 Bacteria 750
106 Ga0068855_100309264 3300005563 Bacteria 1749
107 Ga0070664_100164957 3300005564 Bacteria 1962
108 Ga0068857_100027365 3300005577 Bacteria 5031
109 Ga0068854_100499613 3300005578 Bacteria 1024
110 Ga0068854_100521423 3300005578 Bacteria 1004
111 Ga0068852_100002785 3300005616 Bacteria 12109
112 Ga0068852_100214509 3300005616 Bacteria 1828
113 Ga0068852_100866795 3300005616 Bacteria 919
114 Ga0068859_100027031 3300005617 Bacteria 5755
115 Ga0068859_100028919 3300005617 Bacteria 5560
116 Ga0068859_100156144 3300005617 Bacteria 2359
117 Ga0068859_100224662 3300005617 Bacteria 1966
118 Ga0068859_100487604 3300005617 Bacteria 1328
119 Ga0068864_100002091 3300005618 Bacteria 16490
120 Ga0068864_100170796 3300005618 Bacteria 1982
121 Ga0068864_100582411 3300005618 Bacteria 1084
122 Ga0068864_100761466 3300005618 Bacteria 949
123 Ga0068861_100031256 3300005719 Bacteria 3910
124 Ga0068861_100073769 3300005719 Bacteria 2652
125 Ga0068861_100961631 3300005719 Bacteria 813
126 Ga0068861_101312257 3300005719 Bacteria 704
127 Ga0068851_10288278 3300005834 Bacteria 941
128 Ga0068870_10222769 3300005840 Bacteria 1155
129 Ga0068870_10477842 3300005840 Bacteria 826
130 Ga0068863_100001776 3300005841 Bacteria 21388
131 Ga0068863_100022271 3300005841 Bacteria 6050
132 Ga0068863_100220834 3300005841 Bacteria 1826
133 Ga0068863_100446185 3300005841 Bacteria 1269
134 Ga0068858_100000412 3300005842 Bacteria 44458
135 Ga0068858_100049472 3300005842 Bacteria 3893
136 Ga0068860_100000120 3300005843 Bacteria 125823
137 Ga0068860_100000903 3300005843 Bacteria 32899
138 Ga0068860_100046033 3300005843 Bacteria 4160
139 Ga0068860_100123687 3300005843 Bacteria 2479
140 Ga0068860_100333878 3300005843 Bacteria 1489
141 Ga0068860_100475791 3300005843 Bacteria 1244
142 Ga0068862_100000365 3300005844 Bacteria 49043
143 Ga0068862_100033939 3300005844 Bacteria 4316
144 Ga0068862_100040916 3300005844 Bacteria 3942
145 Ga0070717_10811336 3300006028 Bacteria 851
146 Ga0070716_100039011 3300006173 Bacteria 2633
147 Ga0075362_10030142 3300006177 Bacteria 2341
148 Ga0075367_10070525 3300006178 Bacteria 2101
149 Ga0075366_10056864 3300006195 Bacteria 2324
150 Ga0097621_100150814 3300006237 Bacteria 1993
151 Ga0075370_10268647 3300006353 Bacteria 1012
152 Ga0068871_100035672 3300006358 Bacteria 3954
153 Ga0068871_100182195 3300006358 Bacteria 1805
154 Ga0075428_100198067 3300006844 Bacteria 2172
155 Ga0075428_100858405 3300006844 Bacteria 964
156 Ga0075430_100004710 3300006846 Bacteria 11472
157 Ga0075430_100037762 3300006846 Bacteria 4093
158 Ga0075430_100475185 3300006846 Bacteria 1031
159 Ga0075431_100054682 3300006847 Bacteria 4116
160 Ga0075431_100199942 3300006847 Bacteria 2045
161 Ga0075431_100448870 3300006847 Bacteria 1285
162 Ga0075433_10629491 3300006852 Bacteria 941
163 Ga0075434_100039264 3300006871 Bacteria 4690
164 Ga0075434_100144328 3300006871 Bacteria 2401
165 Ga0075434_100194328 3300006871 Bacteria 2049
166 Ga0075434_100443445 3300006871 Bacteria 1319
167 Ga0075429_100340084 3300006880 Bacteria 1314
168 Ga0075429_100343100 3300006880 Bacteria 1307
169 Ga0068865_100003663 3300006881 Bacteria 9226
170 Ga0068865_100109023 3300006881 Bacteria 2039
171 Ga0068865_100321729 3300006881 Bacteria 1244
172 Ga0075436_100000111 3300006914 Bacteria 47863
173 Ga0097620_100027032 3300006931 Bacteria 5755
174 Ga0097620_100028919 3300006931 Bacteria 5560
175 Ga0097620_100156131 3300006931 Bacteria 2359
176 Ga0097620_100224668 3300006931 Bacteria 1966
177 Ga0097620_100487595 3300006931 Bacteria 1328
178 Ga0075435_100130668 3300007076 Bacteria 2101
179 Ga0075435_100294055 3300007076 Bacteria 1388
180 Ga0075435_100451210 3300007076 Bacteria 1109
181 Ga0105240_10008445 3300009093 Bacteria 14731
182 Ga0111539_10179513 3300009094 Bacteria 2473
183 Ga0105245_10009778 3300009098 Bacteria 8355
184 Ga0105245_10246709 3300009098 Bacteria 1733
185 Ga0105245_10309642 3300009098 Bacteria 1552
186 Ga0105245_10412655 3300009098 Bacteria 1352
187 Ga0114129_10033159 3300009147 Bacteria 7298
188 Ga0114129_10164186 3300009147 Bacteria 3032
189 Ga0114129_10585700 3300009147 Bacteria 1447
190 Ga0105243_10037366 3300009148 Bacteria 3774
191 Ga0105243_10162637 3300009148 Bacteria 1926
192 Ga0105243_10451846 3300009148 Bacteria 1206
193 Ga0105243_10637569 3300009148 Bacteria 1031
194 Ga0105243_10820076 3300009148 Bacteria 919
195 Ga0105242_10002502 3300009176 Bacteria 14410
196 Ga0105242_10069596 3300009176 Bacteria 2915
197 Ga0105242_10078105 3300009176 Bacteria 2763
198 Ga0105242_10186724 3300009176 Bacteria 1832
199 Ga0105242_10884420 3300009176 Bacteria 892
200 Ga0105248_10075044 3300009177 Bacteria 3800
201 Ga0105248_10417796 3300009177 Bacteria 1510
202 Ga0105248_10476008 3300009177 Bacteria 1408
203 Ga0105237_10401355 3300009545 Bacteria 1376
204 Ga0105238_10591871 3300009551 Bacteria 1116
205 Ga0105238_10683603 3300009551 Bacteria 1038
206 Ga0105249_10361463 3300009553 Bacteria 1473
207 Ga0105249_10442664 3300009553 Bacteria 1337
208 Ga0105249_11573734 3300009553 Bacteria 730
209 Ga0157370_10672990 3300013104 Bacteria 945
210 Ga0157374_10125352 3300013296 Bacteria 2482
211 Ga0157378_10004527 3300013297 Bacteria 12196
212 Ga0157378_10046586 3300013297 Bacteria 3854
213 Ga0157378_10385566 3300013297 Bacteria 1377
214 Ga0157378_10797836 3300013297 Bacteria 970
215 Ga0163162_10005803 3300013306 Bacteria 11947
216 Ga0163162_10040290 3300013306 Bacteria 4671
217 Ga0157372_10408544 3300013307 Bacteria 1582
218 Ga0157375_10058576 3300013308 Bacteria 3811
219 Ga0157375_10442310 3300013308 Bacteria 1466
220 Ga0157375_10605346 3300013308 Bacteria 1255
221 Ga0157375_11006614 3300013308 Bacteria 973
222 Ga0157375_11501661 3300013308 Bacteria 795
223 Ga0163163_10382828 3300014325 Bacteria 1464
224 Ga0163163_10844886 3300014325 Bacteria 979
225 Ga0157380_10007364 3300014326 Bacteria 7813
226 Ga0157380_10231710 3300014326 Bacteria 1659
227 Ga0157380_10770998 3300014326 Bacteria 975
228 Ga0182008_10552911 3300014497 Bacteria 640
229 Ga0157379_10035631 3300014968 Bacteria 4437
230 Ga0157379_10066556 3300014968 Bacteria 3221
231 Ga0157379_10117893 3300014968 Bacteria 2388
232 Ga0157379_10232735 3300014968 Bacteria 1670
233 Ga0163161_10065092 3300017792 Bacteria 2660
234 Ga0163161_10209428 3300017792 Bacteria 1506
235 Ga0163161_10452167 3300017792 Bacteria 1038
236 Ga0206350_11574848 3300020080 Bacteria 756
237 Ga0209455_1010168 3300025272 Bacteria 2410
238 Ga0209675_1003710 3300025291 Bacteria 7103
239 Ga0209676_1000557 3300025292 Bacteria 56440
240 Ga0209676_1001387 3300025292 Bacteria 23537
241 Ga0209676_1001888 3300025292 Bacteria 17095
242 Ga0209676_1014718 3300025292 Bacteria 2925
243 Ga0209676_1062433 3300025292 Bacteria 921
244 Ga0209025_1036502 3300025294 Bacteria 2200
245 Ga0209025_1038151 3300025294 Bacteria 2118
246 Ga0209758_1000036 3300025297 Bacteria 441671
247 Ga0209050_1000017 3300025298 Bacteria 728928
248 Ga0209050_1003770 3300025298 Bacteria 10850
249 Ga0209257_1001118 3300025304 Bacteria 34674
250 Ga0209257_1001176 3300025304 Bacteria 33109
251 Ga0209257_1001719 3300025304 Bacteria 24483
252 Ga0207697_10009458 3300025315 Bacteria 4210
253 Ga0207656_10358661 3300025321 Bacteria 728
254 Ga0207682_10030036 3300025893 Bacteria 2175
255 Ga0207682_10034359 3300025893 Bacteria 2044
256 Ga0207688_10008762 3300025901 Bacteria 5504
257 Ga0207680_10153493 3300025903 Bacteria 1537
258 Ga0207680_10166946 3300025903 Bacteria 1480
259 Ga0207680_10240699 3300025903 Bacteria 1247
260 Ga0207645_10012727 3300025907 Bacteria 5703
261 Ga0207645_10161383 3300025907 Bacteria 1467
262 Ga0207643_10020601 3300025908 Bacteria 3620
263 Ga0207684_10117974 3300025910 Bacteria 2274
264 Ga0207684_10166258 3300025910 Bacteria 1901
265 Ga0207707_10346502 3300025912 Unclassified 1280
266 Ga0207695_10152244 3300025913 Bacteria 2251
267 Ga0207662_10042493 3300025918 Bacteria 2679
268 Ga0207662_10149753 3300025918 Bacteria 1483
269 Ga0207657_10000839 3300025919 Bacteria 32505
270 Ga0207649_10005015 3300025920 Bacteria 7157
271 Ga0207652_10126216 3300025921 Unclassified 2279
272 Ga0207646_10046396 3300025922 Bacteria 3898
273 Ga0207646_10479208 3300025922 Bacteria 1122
274 Ga0207681_10082302 3300025923 Bacteria 2275
275 Ga0207681_10150675 3300025923 Bacteria 1742
276 Ga0207650_10014606 3300025925 Bacteria 5454
277 Ga0207650_10244708 3300025925 Bacteria 1450
278 Ga0207659_10035258 3300025926 Bacteria 3456
279 Ga0207659_10186644 3300025926 Bacteria 1647
280 Ga0207659_10203034 3300025926 Bacteria 1584
281 Ga0207659_10881900 3300025926 Bacteria 769
282 Ga0207687_10029259 3300025927 Bacteria 3705
283 Ga0207687_10499813 3300025927 Bacteria 1015
284 Ga0207687_10609067 3300025927 Bacteria 921
285 Ga0207644_10000047 3300025931 Bacteria 103158
286 Ga0207644_10035090 3300025931 Bacteria 3512
287 Ga0207644_10262625 3300025931 Bacteria 1381
288 Ga0207644_10342530 3300025931 Bacteria 1212
289 Ga0207644_10342622 3300025931 Bacteria 1212
290 Ga0207690_10000005 3300025932 Bacteria 581199
291 Ga0207706_10041710 3300025933 Bacteria 4068
292 Ga0207686_10017443 3300025934 Bacteria 4046
293 Ga0207686_10046068 3300025934 Bacteria 2687
294 Ga0207686_10146154 3300025934 Bacteria 1640
295 Ga0207709_10041714 3300025935 Bacteria 2756
296 Ga0207709_10208451 3300025935 Bacteria 1401
297 Ga0207709_10224338 3300025935 Bacteria 1357
298 Ga0207709_10250607 3300025935 Bacteria 1293
299 Ga0207670_10094949 3300025936 Bacteria 2117
300 Ga0207669_10792508 3300025937 Bacteria 785
301 Ga0207669_10927805 3300025937 Bacteria 729
302 Ga0207704_10005537 3300025938 Bacteria 5819
303 Ga0207704_10115058 3300025938 Bacteria 1827
304 Ga0207665_10019582 3300025939 Bacteria 4450
305 Ga0207665_10300827 3300025939 Bacteria 1199
306 Ga0207691_10006268 3300025940 Bacteria 11483
307 Ga0207691_10219991 3300025940 Bacteria 1647
308 Ga0207691_10332307 3300025940 Bacteria 1302
309 Ga0207711_10214071 3300025941 Bacteria 1760
310 Ga0207689_10195671 3300025942 Bacteria 1668
311 Ga0207661_10010949 3300025944 Bacteria 6549
312 Ga0207679_10000906 3300025945 Bacteria 18937
313 Ga0207667_10638013 3300025949 Bacteria 1072
314 Ga0207651_10013310 3300025960 Bacteria 4702
315 Ga0207651_10583017 3300025960 Bacteria 976
316 Ga0207712_10050532 3300025961 Bacteria 2903
317 Ga0207712_10515660 3300025961 Bacteria 1024
318 Ga0207712_10697973 3300025961 Bacteria 885
319 Ga0207712_11032911 3300025961 Bacteria 730
320 Ga0207668_10000043 3300025972 Bacteria 103738
321 Ga0207668_10146778 3300025972 Bacteria 1821
322 Ga0207668_10586643 3300025972 Bacteria 969
323 Ga0207640_10163832 3300025981 Bacteria 1648
324 Ga0207640_10653420 3300025981 Bacteria 896
325 Ga0207658_10000010 3300025986 Bacteria 240224
326 Ga0207658_10238386 3300025986 Bacteria 1539
327 Ga0207677_10000044 3300026023 Bacteria 107614
328 Ga0207677_10686216 3300026023 Bacteria 907
329 Ga0207703_10003516 3300026035 Bacteria 13106
330 Ga0207703_10031316 3300026035 Bacteria 4205
331 Ga0207703_10273572 3300026035 Bacteria 1531
332 Ga0207639_10401833 3300026041 Bacteria 1234
333 Ga0207639_10492166 3300026041 Bacteria 1119
334 Ga0207639_10631123 3300026041 Bacteria 990
335 Ga0207678_10121197 3300026067 Bacteria 2232
336 Ga0207678_11165008 3300026067 Bacteria 682
337 Ga0207708_10019486 3300026075 Bacteria 5115
338 Ga0207708_10209280 3300026075 Bacteria 1558
339 Ga0207641_10000294 3300026088 Bacteria 62469
340 Ga0207641_10012528 3300026088 Bacteria 6951
341 Ga0207641_10035171 3300026088 Bacteria 4172
342 Ga0207641_10198953 3300026088 Bacteria 1846
343 Ga0207641_10302402 3300026088 Bacteria 1511
344 Ga0207641_10475736 3300026088 Bacteria 1210
345 Ga0207648_10007566 3300026089 Bacteria 10660
346 Ga0207648_10010128 3300026089 Bacteria 8962
347 Ga0207676_10002645 3300026095 Bacteria 12750
348 Ga0207676_10026026 3300026095 Bacteria 4346
349 Ga0207676_10077980 3300026095 Bacteria 2681
350 Ga0207676_10561714 3300026095 Bacteria 1091
351 Ga0207676_10886521 3300026095 Bacteria 874
352 Ga0207674_10034895 3300026116 Bacteria 5253
353 Ga0207674_10077608 3300026116 Bacteria 3327
354 Ga0207675_100007331 3300026118 Bacteria 10423
355 Ga0207675_100042970 3300026118 Bacteria 4220
356 Ga0207683_10008343 3300026121 Bacteria 8861
357 Ga0207698_10010035 3300026142 Bacteria 6064
358 Ga0207698_10607701 3300026142 Bacteria 1079
359 Ga0207698_10728667 3300026142 Bacteria 989
360 Ga0207698_10811690 3300026142 Bacteria 938
361 Ga0209967_1000193 3300027364 Bacteria 8591
362 Ga0209981_1002518 3300027378 Bacteria 2338
363 Ga0209981_1005097 3300027378 Bacteria 1739
364 Ga0209996_1007658 3300027395 Bacteria 1409
365 Ga0209996_1014881 3300027395 Bacteria 1059
366 Ga0210000_1000435 3300027462 Bacteria 5732
367 Ga0210000_1000719 3300027462 Bacteria 4592
368 Ga0209995_1000658 3300027471 Bacteria 5325
369 Ga0209968_1005366 3300027526 Bacteria 1929
370 Ga0209968_1005975 3300027526 Bacteria 1833
371 Ga0209999_1008603 3300027543 Bacteria 1842
372 Ga0209999_1038090 3300027543 Bacteria 899
373 Ga0209983_1021933 3300027665 Bacteria 1337
374 Ga0209966_1002399 3300027695 Bacteria 3123
375 Ga0209974_10049378 3300027876 Bacteria 1411
376 Ga0207428_10080158 3300027907 Bacteria 2551
377 Ga0268266_10000055 3300028379 Bacteria 291630
378 Ga0268266_10098288 3300028379 Bacteria 2575
379 Ga0268266_10443517 3300028379 Bacteria 1233
380 Ga0268266_10695186 3300028379 Bacteria 980
381 Ga0268265_10000143 3300028380 Bacteria 90469
382 Ga0268265_10017185 3300028380 Bacteria 4986
383 Ga0268265_10059327 3300028380 Bacteria 2927
384 Ga0268265_10196026 3300028380 Bacteria 1748
385 Ga0268264_10000070 3300028381 Bacteria 268524
386 Ga0268264_10016446 3300028381 Bacteria 6057
387 Ga0268264_10096134 3300028381 Bacteria 2565
388 Ga0268264_10451617 3300028381 Bacteria 1245
389 Ga0265318_10062847 3300028577 Bacteria 1382
390 Ga0307517_10078802 3300028786 Bacteria 2844
391 Ga0265330_10059375 3300031235 Bacteria 1666
392 Ga0265332_10004178 3300031238 Bacteria 6848
393 Ga0265328_10014479 3300031239 Bacteria 3106
394 Ga0265320_10023211 3300031240 Bacteria 3306
395 Ga0265329_10039391 3300031242 Bacteria 1518
396 Ga0265331_10001179 3300031250 Bacteria 19910
397 Ga0265331_10017366 3300031250 Bacteria 3755
398 Ga0265327_10002178 3300031251 Bacteria 21530
399 Ga0265327_10163829 3300031251 Bacteria 1025
400 Ga0265316_10001190 3300031344 Bacteria 28178
401 Ga0265316_10049383 3300031344 Bacteria 3315
402 Ga0307408_100707213 3300031548 Bacteria 906
403 Ga0307408_101342037 3300031548 Bacteria 671
404 Ga0265313_10053687 3300031595 Bacteria 1917
405 Ga0265314_10000887 3300031711 Bacteria 35662
406 Ga0265342_10029125 3300031712 Bacteria 3432
407 Ga0307516_10000094 3300031730 Bacteria 100401
408 Ga0307410_10294831 3300031852 Bacteria 1278
409 Ga0307406_10041841 3300031901 Bacteria 2858
410 Ga0307406_10182713 3300031901 Bacteria 1528
411 Ga0307406_10375685 3300031901 Bacteria 1119
412 Ga0307412_10046703 3300031911 Bacteria 2839
413 Ga0307409_100409845 3300031995 Bacteria 1297
414 Ga0307416_100122364 3300032002 Bacteria 2322
415 Ga0307416_100521998 3300032002 Bacteria 1256
416 Ga0307416_101746943 3300032002 Bacteria 726
417 Ga0307414_10001549 3300032004 Bacteria 11941
418 Ga0307414_10005871 3300032004 Bacteria 6791
419 Ga0307414_10079731 3300032004 Bacteria 2391
420 Ga0307414_10090859 3300032004 Bacteria 2267
421 Ga0307414_10163229 3300032004 Bacteria 1772
422 Ga0307414_10369030 3300032004 Bacteria 1237
423 Ga0307414_10433509 3300032004 Bacteria 1149
424 Ga0307414_10444246 3300032004 Bacteria 1136
425 Ga0307411_10040338 3300032005 Bacteria 2961
426 Ga0307411_10216370 3300032005 Bacteria 1483
427 Ga0307411_10440116 3300032005 Bacteria 1088
428 Ga0307411_10653775 3300032005 Bacteria 910
429 Ga0307411_11221363 3300032005 Bacteria 682
430 Ga0373932_0113151 3300035112 Bacteria 897
431 Ga0373953_0062726 3300035117 Bacteria 1522
432 Ga0373927_0009397 3300035695 Bacteria 6558
433 Ga0373937_0016620 3300036401 Bacteria 6538
434 Ga0373925_0001850 3300037068 Bacteria 17621
435 Ga0395898_0402019 3300037466 Bacteria 1306
436 Ga0395905_0673841 3300037471 Bacteria 936
437 Ga0436364_1446039 3300037853 Bacteria 1319
438 Ga0395901_0019134 3300038443 Bacteria 7001
439 Ga0237819_00574 3300038705 Bacteria 12342
440 Ga0436365_1862304 3300039437 Bacteria 21258
441 Ga0436363_1179848 3300039450 Bacteria 1442
442 Ga0439436_0074971 3300041404 Bacteria 942
443 Ga0451798_0420236 3300041458 Bacteria 535
444 Ga0451804_0684765 3300041463 Bacteria 811
445 Ga0451853_0042166 3300041512 Bacteria 658
446 Ga0439441_001972 3300042001 Bacteria 2817
447 Ga0439446_0007782 3300042156 Bacteria 2824
448 Ga0439434_0008995 3300042435 Bacteria 2935
449 Ga0439435_0001153 3300042436 Bacteria 4737
450 Ga0439435_0016940 3300042436 Bacteria 1835
451 Ga0439444_0010931 3300042437 Bacteria 1460
452 Ga0439464_0137737 3300042439 Bacteria 759
453 Ga0451576_0318366 3300045051 Bacteria 1628
454 Ga0495592_0000739 3300046454 Bacteria 22747
455 Ga0495629_0185204 3300046459 Bacteria 1442
456 Ga0495653_0125097 3300046463 Bacteria 1827
457 Ga0495650_0094611 3300046471 Bacteria 1131
458 Ga0495639_0309824 3300046475 Bacteria 788
459 Ga0495608_0000167 3300046511 Bacteria 46550
460 Ga0495610_0162692 3300046512 Bacteria 942
461 Ga0495616_0000022 3300046513 Bacteria 149720
462 Ga0495628_0002132 3300046516 Bacteria 17926
463 Ga0495630_0023037 3300046517 Bacteria 4601
464 Ga0495632_0054694 3300046519 Bacteria 1956
465 Ga0495643_0025809 3300046522 Bacteria 3321
466 Ga0495663_0058623 3300046525 Bacteria 1207
467 Ga0495666_0002610 3300046526 Bacteria 8968
468 Ga0495652_0576694 3300046529 Bacteria 770
469 Ga0495640_0003327 3300046533 Bacteria 12939
470 Ga0495586_0000552 3300046535 Bacteria 21719
471 Ga0495622_0001538 3300046557 Bacteria 11470
472 Ga0495667_0009148 3300046559 Bacteria 6728
473 Ga0495668_0000004 3300046616 Bacteria 574236
474 Ga0495634_0002697 3300046642 Bacteria 14598
475 Ga0495625_0000553 3300046660 Bacteria 54796
476 Ga0495635_0019697 3300046663 Bacteria 4699
477 Ga0495658_0018110 3300046683 Bacteria 3654
478 Ga0495658_0607773 3300046683 Bacteria 700
479 Ga0495613_0036492 3300046689 Bacteria 3645
480 Ga0495604_0002495 3300047317 Bacteria 14695
481 Ga0495680_0002018 3300047322 Bacteria 21287
482 Ga0495593_0025368 3300047673 Bacteria 3281
483 Ga0496103_0184047 3300048906 Bacteria 1343
484 Ga0496104_0470133 3300048907 Bacteria 1169
485 Ga0496105_0636460 3300048908 Bacteria 824
486 Ga0496106_0062415 3300048909 Bacteria 2829
487 Ga0496106_0296786 3300048909 Bacteria 1296
488 Ga0496107_0090125 3300048910 Bacteria 2240
489 Ga0496108_0096722 3300048911 Bacteria 2515
490 Ga0496109_0224488 3300048912 Bacteria 1767
491 Ga0496110_0022145 3300048913 Bacteria 5392
492 Ga0496110_0948959 3300048913 Bacteria 767
493 Ga0496111_0577511 3300048914 Bacteria 824
494 Ga0496112_0165469 3300048915 Bacteria 2178
495 Ga0496113_0234721 3300048916 Bacteria 1463
496 Ga0496124_0382684 3300048927 Bacteria 983
497 Ga0496124_0522998 3300048927 Bacteria 790
498 Ga0501300_032631 3300049523 Bacteria 771
499 Ga0501033_0158268 3300049570 Bacteria 1631
500 Ga0501036_0581603 3300049572 Bacteria 930
501 Ga0501039_0077735 3300049575 Bacteria 2581
502 Ga0501040_0014062 3300049576 Bacteria 5268
503 Ga0501040_0018340 3300049576 Bacteria 4645
504 Ga0501041_0320973 3300049577 Bacteria 977
505 Ga0501042_0075207 3300049578 Bacteria 2417
506 Ga0501042_0294965 3300049578 Bacteria 1171
507 Ga0501046_0362659 3300049580 Bacteria 1051
508 Ga0501048_0160788 3300049582 Bacteria 1590
509 Ga0501048_0348405 3300049582 Bacteria 1056
510 Ga0501067_0113761 3300049583 Bacteria 1505
511 Ga0501071_0042208 3300049587 Bacteria 3267
512 Ga0501071_0079255 3300049587 Bacteria 2401
513 Ga0501072_0035972 3300049588 Bacteria 3881
514 Ga0501073_0612673 3300049589 Bacteria 752
515 Ga0501075_0035578 3300049591 Bacteria 3714
516 Ga0501075_0083029 3300049591 Bacteria 2427
517 Ga0501076_0003038 3300049592 Bacteria 11668
518 Ga0501076_0385907 3300049592 Bacteria 1151
519 Ga0501079_0254217 3300049741 Bacteria 1373
520 Ga0501080_0024662 3300049742 Bacteria 5578
521 Ga0501262_025252 3300049759 Bacteria 833
522 Ga0501283_007881 3300049779 Bacteria 1525
523 Ga0501035_0363052 3300049822 Bacteria 1210
524 Ga0501035_0465048 3300049822 Bacteria 1045
525 Ga0501045_0038895 3300049824 Bacteria 3461
526 nmdc:mga03683_248435_c1 3300050489 Bacteria 826
527 nmdc:mga03683_36513_c1 3300050489 Bacteria 1999
528 nmdc:mga0k408_28373_c1 3300050493 Bacteria 3182
529 nmdc:mga0k408_357172_c1 3300050493 Bacteria 871
530 nmdc:mga05p37_27888_c1 3300050507 Bacteria 6879
531 nmdc:mga05p37_45790_c1 3300050507 Bacteria 5379
532 nmdc:mga05p37_466751_c1 3300050507 Bacteria 1457
533 nmdc:mga05p37_96085_c1 3300050507 Bacteria 3650
534 nmdc:mga09592_330962_c1 3300050508 Bacteria 1319
535 nmdc:mga09592_94489_c1 3300050508 Bacteria 2557
536 nmdc:mga0qj67_102112_c1 3300050509 Bacteria 2312
537 nmdc:mga0qj67_528938_c1 3300050509 Bacteria 947
538 nmdc:mga0qj67_6110_c1 3300050509 Bacteria 8827
539 nmdc:mga06r32_13589_c1 3300050510 Bacteria 7380
540 nmdc:mga06r32_150345_c1 3300050510 Bacteria 2307
541 nmdc:mga06r32_595505_c1 3300050510 Bacteria 1077
542 nmdc:mga08y16_125138_c1 3300050511 Bacteria 2674
543 nmdc:mga0n895_20283_c1 3300050512 Bacteria 6196
544 nmdc:mga0n895_379976_c1 3300050512 Bacteria 1429
545 nmdc:mga0n895_45914_c1 3300050512 Bacteria 4265
546 nmdc:mga0n895_92159_c1 3300050512 Bacteria 3033
547 nmdc:mga0rr50_213794_c1 3300050513 Bacteria 1590
548 nmdc:mga0rr50_86207_c1 3300050513 Bacteria 2435
549 nmdc:mga08x19_12629_c1 3300050514 Bacteria 5093
550 nmdc:mga08x19_14797_c1 3300050514 Bacteria 4737
551 nmdc:mga08x19_401_c1 3300050514 Bacteria 30460
552 nmdc:mga08x19_477428_c1 3300050514 Bacteria 879
553 nmdc:mga08x19_71125_c1 3300050514 Bacteria 2268
554 nmdc:mga0a205_156041_c1 3300050515 Bacteria 2181
555 nmdc:mga0a205_93318_c1 3300050515 Bacteria 2908
556 Ga0495601_0011164 3300053077 Bacteria 5366
557 Ga0500643_000219 3300053087 Bacteria 53403
558 Ga0500643_000465 3300053087 Bacteria 29876
559 Ga0500643_001114 3300053087 Bacteria 16085
560 Ga0500647_0078205 3300053091 Bacteria 1587
561 Ga0500562_010572 3300053108 Bacteria 2340
562 Ga0500595_013353 3300053119 Bacteria 3148
563 Ga0500658_0151592 3300053134 Bacteria 1045
564 Ga0500561_0044765 3300053137 Bacteria 1184
565 Ga0500568_0002510 3300053139 Bacteria 10740
566 Ga0500573_0069531 3300053140 Bacteria 2009
567 Ga0500588_0077147 3300053146 Bacteria 1107
568 Ga0500604_0000031 3300053151 Bacteria 57942
569 Ga0500604_0002272 3300053151 Bacteria 5258
570 Ga0500616_0001465 3300053153 Bacteria 22527
571 Ga0500627_0000049 3300053158 Bacteria 58947
572 Ga0500627_0016099 3300053158 Bacteria 2909
573 Ga0500627_0036470 3300053158 Bacteria 2094
574 Ga0500587_000417 3300053739 Bacteria 4970
575 Ga0501084_0003460 3300054114 Bacteria 12817
576 Ga0501082_0006112 3300060353 Bacteria 10454
577 Ga0530510_0003204 3300061734 Bacteria 11234

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025937 Ga0207669_10927805 Ga0207669_109278051 147
2 3300041458 Ga0451798_0420236 Ga0451798_0420236_13_507 147
3 3300006914 Ga0075436_100000111 Ga0075436_10000011145 155
4 3300050514 nmdc:mga08x19_401_c1 nmdc:mga08x19_401_c1_19663_20259 155
5 3300048927 Ga0496124_0522998 Ga0496124_0522998_126_698 157
6 3300049587 Ga0501071_0079255 Ga0501071_0079255_618_1217 159
7 3300049591 Ga0501075_0083029 Ga0501075_0083029_1548_2147 159
8 3300005456 Ga0070678_100053499 Ga0070678_1000534993 160
9 3300026067 Ga0207678_11165008 Ga0207678_111650081 160
10 3300032005 Ga0307411_10440116 Ga0307411_104401162 160
11 3300049779 Ga0501283_007881 Ga0501283_007881_185_781 162
12 3300026041 Ga0207639_10492166 Ga0207639_104921662 164
13 3300031901 Ga0307406_10041841 Ga0307406_100418413 164
14 3300050507 nmdc:mga05p37_96085_c1 nmdc:mga05p37_96085_c1_2293_2889 165
15 3300005293 Ga0065715_10530377 Ga0065715_105303771 167
16 3300005337 Ga0070682_100995762 Ga0070682_1009957621 167
17 3300005444 Ga0070694_100130111 Ga0070694_1001301111 167
18 3300005445 Ga0070708_100137586 Ga0070708_1001375864 167
19 3300005458 Ga0070681_10077083 Ga0070681_100770833 167
20 3300005468 Ga0070707_100011178 Ga0070707_1000111783 167
21 3300005530 Ga0070679_100092115 Ga0070679_1000921153 167
22 3300006871 Ga0075434_100144328 Ga0075434_1001443281 167
23 3300025912 Ga0207707_10346502 Ga0207707_103465022 167
24 3300025921 Ga0207652_10126216 Ga0207652_101262163 167
25 3300025922 Ga0207646_10046396 Ga0207646_100463964 167
26 3300050512 nmdc:mga0n895_379976_c1 nmdc:mga0n895_379976_c1_293_892 167
27 3300050513 nmdc:mga0rr50_86207_c1 nmdc:mga0rr50_86207_c1_1537_2136 167
28 3300053087 Ga0500643_001114 Ga0500643_001114_12_545 167
29 3300053146 Ga0500588_0077147 Ga0500588_0077147_192_821 167
30 3300005329 Ga0070683_100053606 Ga0070683_1000536063 168
31 3300005331 Ga0070670_100078166 Ga0070670_1000781663 168
32 3300005333 Ga0070677_10085856 Ga0070677_100858561 168
33 3300005338 Ga0068868_100004436 Ga0068868_1000044369 168
34 3300005344 Ga0070661_100019873 Ga0070661_1000198735 168
35 3300005354 Ga0070675_100015141 Ga0070675_1000151413 168
36 3300005355 Ga0070671_100197770 Ga0070671_1001977703 168
37 3300005356 Ga0070674_100073308 Ga0070674_1000733083 168
38 3300005456 Ga0070678_100019701 Ga0070678_1000197012 168
39 3300005457 Ga0070662_100941763 Ga0070662_1009417631 168
40 3300005459 Ga0068867_100229217 Ga0068867_1002292172 168
41 3300005539 Ga0068853_100233628 Ga0068853_1002336282 168
42 3300005543 Ga0070672_100021266 Ga0070672_1000212664 168
43 3300005548 Ga0070665_100462250 Ga0070665_1004622502 168
44 3300005564 Ga0070664_100164957 Ga0070664_1001649573 168
45 3300005578 Ga0068854_100521423 Ga0068854_1005214232 168
46 3300005616 Ga0068852_100002785 Ga0068852_1000027858 168
47 3300005618 Ga0068864_100170796 Ga0068864_1001707962 168
48 3300005834 Ga0068851_10288278 Ga0068851_102882781 168
49 3300006353 Ga0075370_10268647 Ga0075370_102686472 168
50 3300006358 Ga0068871_100035672 Ga0068871_1000356723 168
51 3300009098 Ga0105245_10309642 Ga0105245_103096423 168
52 3300009176 Ga0105242_10186724 Ga0105242_101867243 168
53 3300009177 Ga0105248_10075044 Ga0105248_100750445 168
54 3300013104 Ga0157370_10672990 Ga0157370_106729902 168
55 3300013297 Ga0157378_10004527 Ga0157378_1000452711 168
56 3300013306 Ga0163162_10005803 Ga0163162_100058032 168
57 3300013308 Ga0157375_10058576 Ga0157375_100585764 168
58 3300017792 Ga0163161_10209428 Ga0163161_102094282 168
59 3300025321 Ga0207656_10358661 Ga0207656_103586611 168
60 3300025893 Ga0207682_10034359 Ga0207682_100343593 168
61 3300025903 Ga0207680_10166946 Ga0207680_101669462 168
62 3300025920 Ga0207649_10005015 Ga0207649_100050156 168
63 3300025925 Ga0207650_10244708 Ga0207650_102447081 168
64 3300025926 Ga0207659_10035258 Ga0207659_100352582 168
65 3300025927 Ga0207687_10609067 Ga0207687_106090672 168
66 3300025931 Ga0207644_10035090 Ga0207644_100350901 168
67 3300025940 Ga0207691_10006268 Ga0207691_100062689 168
68 3300025944 Ga0207661_10010949 Ga0207661_100109493 168
69 3300025945 Ga0207679_10000906 Ga0207679_100009069 168
70 3300026041 Ga0207639_10401833 Ga0207639_104018331 168
71 3300026089 Ga0207648_10007566 Ga0207648_100075665 168
72 3300026095 Ga0207676_10026026 Ga0207676_100260266 168
73 3300026121 Ga0207683_10008343 Ga0207683_100083436 168
74 3300026142 Ga0207698_10010035 Ga0207698_100100357 168
75 3300048907 Ga0496104_0470133 Ga0496104_0470133_409_1008 168
76 3300048908 Ga0496105_0636460 Ga0496105_0636460_40_639 168
77 3300048909 Ga0496106_0296786 Ga0496106_0296786_359_958 168
78 3300048912 Ga0496109_0224488 Ga0496109_0224488_999_1598 168
79 3300048913 Ga0496110_0022145 Ga0496110_0022145_2862_3461 168
80 3300005343 Ga0070687_100290079 Ga0070687_1002900791 169
81 3300005444 Ga0070694_100188574 Ga0070694_1001885743 169
82 3300005467 Ga0070706_100107619 Ga0070706_1001076194 169
83 3300005468 Ga0070707_100419461 Ga0070707_1004194613 169
84 3300005536 Ga0070697_100019678 Ga0070697_1000196784 169
85 3300005545 Ga0070695_100043021 Ga0070695_1000430213 169
86 3300005546 Ga0070696_100004761 Ga0070696_1000047619 169
87 3300005547 Ga0070693_100126339 Ga0070693_1001263392 169
88 3300005549 Ga0070704_100069165 Ga0070704_1000691653 169
89 3300005549 Ga0070704_100495014 Ga0070704_1004950141 169
90 3300005549 Ga0070704_100644614 Ga0070704_1006446142 169
91 3300005719 Ga0068861_101312257 Ga0068861_1013122571 169
92 3300006173 Ga0070716_100039011 Ga0070716_1000390114 169
93 3300025910 Ga0207684_10117974 Ga0207684_101179742 169
94 3300025939 Ga0207665_10019582 Ga0207665_100195825 169
95 3300048913 Ga0496110_0948959 Ga0496110_0948959_44_628 169
96 3300049577 Ga0501041_0320973 Ga0501041_0320973_250_846 169
97 3300050514 nmdc:mga08x19_71125_c1 nmdc:mga08x19_71125_c1_488_1087 169
98 iso_pu_bacteria 2643221560 2643820536 169
99 iso_pu_bacteria 2643221563 2643836350 169
100 iso_pu_bacteria 2643221608 2644052826 169
101 iso_pu_bacteria 2852653556 2852653961 169
102 iso_pu_bacteria 2852680915 2852682643 169
103 3300013308 Ga0157375_11006614 Ga0157375_110066141 170
104 3300035695 Ga0373927_0009397 Ga0373927_0009397_4797_5375 170
105 3300037068 Ga0373925_0001850 Ga0373925_0001850_4675_5253 170
106 3300046683 Ga0495658_0607773 Ga0495658_0607773_112_690 170
107 3300053119 Ga0500595_013353 Ga0500595_013353_2105_2671 170
108 3300005459 Ga0068867_100324926 Ga0068867_1003249262 171
109 3300009148 Ga0105243_10037366 Ga0105243_100373662 171
110 3300009553 Ga0105249_10361463 Ga0105249_103614632 171
111 3300025935 Ga0207709_10250607 Ga0207709_102506071 171
112 3300025961 Ga0207712_10697973 Ga0207712_106979732 171
113 3300027364 Ga0209967_1000193 Ga0209967_10001936 171
114 3300027378 Ga0209981_1005097 Ga0209981_10050974 171
115 3300027395 Ga0209996_1014881 Ga0209996_10148812 171
116 3300027462 Ga0210000_1000435 Ga0210000_10004354 171
117 3300027471 Ga0209995_1000658 Ga0209995_10006587 171
118 3300027526 Ga0209968_1005975 Ga0209968_10059753 171
119 3300027543 Ga0209999_1008603 Ga0209999_10086033 171
120 3300027665 Ga0209983_1021933 Ga0209983_10219332 171
121 3300028380 Ga0268265_10196026 Ga0268265_101960262 171
122 3300042156 Ga0439446_0007782 Ga0439446_0007782_1708_2292 171
123 3300042435 Ga0439434_0008995 Ga0439434_0008995_1301_1885 171
124 3300042436 Ga0439435_0016940 Ga0439435_0016940_178_762 171
125 3300005328 Ga0070676_10019938 Ga0070676_100199382 172
126 3300005330 Ga0070690_100169261 Ga0070690_1001692611 172
127 3300005331 Ga0070670_100000570 Ga0070670_10000057011 172
128 3300005340 Ga0070689_100009271 Ga0070689_1000092717 172
129 3300005343 Ga0070687_100247443 Ga0070687_1002474432 172
130 3300005347 Ga0070668_100000001 Ga0070668_100000001158 172
131 3300005353 Ga0070669_100022464 Ga0070669_1000224643 172
132 3300005354 Ga0070675_100004568 Ga0070675_1000045686 172
133 3300005355 Ga0070671_100000167 Ga0070671_10000016734 172
134 3300005367 Ga0070667_100000006 Ga0070667_100000006135 172
135 3300005440 Ga0070705_100243702 Ga0070705_1002437022 172
136 3300005444 Ga0070694_100106377 Ga0070694_1001063772 172
137 3300005466 Ga0070685_10360115 Ga0070685_103601152 172
138 3300005468 Ga0070707_100695297 Ga0070707_1006952971 172
139 3300005545 Ga0070695_100098510 Ga0070695_1000985103 172
140 3300005546 Ga0070696_100347609 Ga0070696_1003476091 172
141 3300005617 Ga0068859_100028919 Ga0068859_1000289198 172
142 3300005617 Ga0068859_100224662 Ga0068859_1002246622 172
143 3300005618 Ga0068864_100002091 Ga0068864_10000209119 172
144 3300005719 Ga0068861_100073769 Ga0068861_1000737692 172
145 3300005841 Ga0068863_100001776 Ga0068863_10000177620 172
146 3300005842 Ga0068858_100000412 Ga0068858_10000041242 172
147 3300005843 Ga0068860_100000120 Ga0068860_100000120104 172
148 3300005844 Ga0068862_100000365 Ga0068862_10000036548 172
149 3300006844 Ga0075428_100858405 Ga0075428_1008584052 172
150 3300006846 Ga0075430_100004710 Ga0075430_1000047102 172
151 3300006846 Ga0075430_100037762 Ga0075430_1000377623 172
152 3300006846 Ga0075430_100475185 Ga0075430_1004751852 172
153 3300006847 Ga0075431_100199942 Ga0075431_1001999423 172
154 3300006847 Ga0075431_100448870 Ga0075431_1004488702 172
155 3300006880 Ga0075429_100340084 Ga0075429_1003400841 172
156 3300006880 Ga0075429_100343100 Ga0075429_1003431002 172
157 3300006931 Ga0097620_100028919 Ga0097620_1000289198 172
158 3300006931 Ga0097620_100224668 Ga0097620_1002246683 172
159 3300009147 Ga0114129_10585700 Ga0114129_105857002 172
160 3300025922 Ga0207646_10479208 Ga0207646_104792082 172
161 3300025923 Ga0207681_10082302 Ga0207681_100823023 172
162 3300025925 Ga0207650_10014606 Ga0207650_100146064 172
163 3300025926 Ga0207659_10186644 Ga0207659_101866442 172
164 3300025931 Ga0207644_10000047 Ga0207644_1000004742 172
165 3300025936 Ga0207670_10094949 Ga0207670_100949492 172
166 3300025940 Ga0207691_10219991 Ga0207691_102199912 172
167 3300025941 Ga0207711_10214071 Ga0207711_102140712 172
168 3300025960 Ga0207651_10583017 Ga0207651_105830172 172
169 3300025972 Ga0207668_10000043 Ga0207668_100000431 172
170 3300025986 Ga0207658_10000010 Ga0207658_10000010133 172
171 3300026035 Ga0207703_10003516 Ga0207703_100035166 172
172 3300026088 Ga0207641_10000294 Ga0207641_1000029428 172
173 3300026088 Ga0207641_10012528 Ga0207641_100125287 172
174 3300026095 Ga0207676_10002645 Ga0207676_100026458 172
175 3300027378 Ga0209981_1002518 Ga0209981_10025183 172
176 3300027543 Ga0209999_1038090 Ga0209999_10380901 172
177 3300027695 Ga0209966_1002399 Ga0209966_10023995 172
178 3300027876 Ga0209974_10049378 Ga0209974_100493781 172
179 3300028380 Ga0268265_10000143 Ga0268265_1000014347 172
180 3300028381 Ga0268264_10000070 Ga0268264_1000007073 172
181 3300031548 Ga0307408_101342037 Ga0307408_1013420371 172
182 3300032002 Ga0307416_100122364 Ga0307416_1001223642 172
183 3300032002 Ga0307416_101746943 Ga0307416_1017469431 172
184 3300032005 Ga0307411_11221363 Ga0307411_112213631 172
185 3300035117 Ga0373953_0062726 Ga0373953_0062726_493_1077 172
186 3300036401 Ga0373937_0016620 Ga0373937_0016620_2206_2790 172
187 3300037853 Ga0436364_1446039 Ga0436364_1446039_281_862 172
188 3300039450 Ga0436363_1179848 Ga0436363_1179848_721_1302 172
189 3300042436 Ga0439435_0001153 Ga0439435_0001153_3947_4543 172
190 3300046454 Ga0495592_0000739 Ga0495592_0000739_15373_15957 172
191 3300046463 Ga0495653_0125097 Ga0495653_0125097_1063_1647 172
192 3300046475 Ga0495639_0309824 Ga0495639_0309824_101_685 172
193 3300046511 Ga0495608_0000167 Ga0495608_0000167_4351_4935 172
194 3300046516 Ga0495628_0002132 Ga0495628_0002132_8090_8674 172
195 3300046517 Ga0495630_0023037 Ga0495630_0023037_2966_3550 172
196 3300046526 Ga0495666_0002610 Ga0495666_0002610_2531_3115 172
197 3300046529 Ga0495652_0576694 Ga0495652_0576694_120_704 172
198 3300046533 Ga0495640_0003327 Ga0495640_0003327_10092_10676 172
199 3300046535 Ga0495586_0000552 Ga0495586_0000552_8011_8595 172
200 3300046559 Ga0495667_0009148 Ga0495667_0009148_4262_4846 172
201 3300046642 Ga0495634_0002697 Ga0495634_0002697_289_873 172
202 3300046663 Ga0495635_0019697 Ga0495635_0019697_1896_2480 172
203 3300046683 Ga0495658_0018110 Ga0495658_0018110_420_1004 172
204 3300046689 Ga0495613_0036492 Ga0495613_0036492_460_1044 172
205 3300047317 Ga0495604_0002495 Ga0495604_0002495_10365_10949 172
206 3300047322 Ga0495680_0002018 Ga0495680_0002018_14291_14875 172
207 3300047673 Ga0495593_0025368 Ga0495593_0025368_456_1040 172
208 3300049523 Ga0501300_032631 Ga0501300_032631_43_639 172
209 3300049570 Ga0501033_0158268 Ga0501033_0158268_803_1399 172
210 3300049575 Ga0501039_0077735 Ga0501039_0077735_1551_2135 172
211 3300049576 Ga0501040_0014062 Ga0501040_0014062_1641_2225 172
212 3300049576 Ga0501040_0018340 Ga0501040_0018340_4027_4623 172
213 3300049578 Ga0501042_0075207 Ga0501042_0075207_1700_2296 172
214 3300049578 Ga0501042_0294965 Ga0501042_0294965_176_760 172
215 3300049580 Ga0501046_0362659 Ga0501046_0362659_88_672 172
216 3300049582 Ga0501048_0348405 Ga0501048_0348405_63_647 172
217 3300049587 Ga0501071_0042208 Ga0501071_0042208_764_1348 172
218 3300049588 Ga0501072_0035972 Ga0501072_0035972_199_783 172
219 3300049591 Ga0501075_0035578 Ga0501075_0035578_1817_2401 172
220 3300049592 Ga0501076_0003038 Ga0501076_0003038_9219_9803 172
221 3300049741 Ga0501079_0254217 Ga0501079_0254217_44_628 172
222 3300049742 Ga0501080_0024662 Ga0501080_0024662_40_624 172
223 3300049822 Ga0501035_0363052 Ga0501035_0363052_378_962 172
224 3300049822 Ga0501035_0465048 Ga0501035_0465048_424_1020 172
225 3300049824 Ga0501045_0038895 Ga0501045_0038895_685_1269 172
226 3300050507 nmdc:mga05p37_466751_c1 nmdc:mga05p37_466751_c1_670_1254 172
227 3300050508 nmdc:mga09592_330962_c1 nmdc:mga09592_330962_c1_429_1025 172
228 3300050509 nmdc:mga0qj67_528938_c1 nmdc:mga0qj67_528938_c1_254_850 172
229 3300050509 nmdc:mga0qj67_6110_c1 nmdc:mga0qj67_6110_c1_4220_4816 172
230 3300050510 nmdc:mga06r32_13589_c1 nmdc:mga06r32_13589_c1_720_1316 172
231 3300050510 nmdc:mga06r32_595505_c1 nmdc:mga06r32_595505_c1_187_783 172
232 3300053077 Ga0495601_0011164 Ga0495601_0011164_1025_1609 172
233 3300053087 Ga0500643_000219 Ga0500643_000219_10203_10766 172
234 3300054114 Ga0501084_0003460 Ga0501084_0003460_557_1141 172
235 3300060353 Ga0501082_0006112 Ga0501082_0006112_9773_10357 172
236 3300061734 Ga0530510_0003204 Ga0530510_0003204_4084_4668 172
237 3300003781 Ga0055536_1002550 Ga0055536_10025504 173
238 3300003781 Ga0055536_1007994 Ga0055536_10079943 173
239 3300003781 Ga0055536_1013607 Ga0055536_10136072 173
240 3300003784 Ga0055534_1013686 Ga0055534_10136862 173
241 3300003791 Ga0055530_10000522 Ga0055530_1000052220 173
242 3300003791 Ga0055530_10073589 Ga0055530_100735891 173
243 3300003794 Ga0055531_10002871 Ga0055531_100028714 173
244 3300005289 Ga0065704_10308270 Ga0065704_103082701 173
245 3300005329 Ga0070683_100121420 Ga0070683_1001214202 173
246 3300005338 Ga0068868_100000063 Ga0068868_10000006360 173
247 3300005339 Ga0070660_100019823 Ga0070660_1000198234 173
248 3300005355 Ga0070671_100351490 Ga0070671_1003514902 173
249 3300005366 Ga0070659_100000034 Ga0070659_10000003498 173
250 3300005441 Ga0070700_100106550 Ga0070700_1001065503 173
251 3300005444 Ga0070694_100162686 Ga0070694_1001626862 173
252 3300005544 Ga0070686_100000140 Ga0070686_10000014058 173
253 3300005546 Ga0070696_100098839 Ga0070696_1000988392 173
254 3300005548 Ga0070665_100000105 Ga0070665_10000010542 173
255 3300005548 Ga0070665_100002184 Ga0070665_1000021843 173
256 3300005563 Ga0068855_100309264 Ga0068855_1003092642 173
257 3300005841 Ga0068863_100022271 Ga0068863_1000222714 173
258 3300005843 Ga0068860_100123687 Ga0068860_1001236872 173
259 3300006871 Ga0075434_100194328 Ga0075434_1001943282 173
260 3300009093 Ga0105240_10008445 Ga0105240_100084457 173
261 3300009098 Ga0105245_10009778 Ga0105245_100097785 173
262 3300009148 Ga0105243_10637569 Ga0105243_106375692 173
263 3300009148 Ga0105243_10820076 Ga0105243_108200762 173
264 3300013308 Ga0157375_10442310 Ga0157375_104423103 173
265 3300014325 Ga0163163_10844886 Ga0163163_108448862 173
266 3300017792 Ga0163161_10452167 Ga0163161_104521672 173
267 3300025291 Ga0209675_1003710 Ga0209675_10037107 173
268 3300025292 Ga0209676_1000557 Ga0209676_100055715 173
269 3300025292 Ga0209676_1001387 Ga0209676_10013877 173
270 3300025292 Ga0209676_1001888 Ga0209676_100188815 173
271 3300025292 Ga0209676_1062433 Ga0209676_10624332 173
272 3300025294 Ga0209025_1036502 Ga0209025_10365023 173
273 3300025298 Ga0209050_1000017 Ga0209050_100001761 173
274 3300025298 Ga0209050_1003770 Ga0209050_10037705 173
275 3300025304 Ga0209257_1001118 Ga0209257_100111823 173
276 3300025304 Ga0209257_1001719 Ga0209257_100171917 173
277 3300025903 Ga0207680_10240699 Ga0207680_102406992 173
278 3300025907 Ga0207645_10161383 Ga0207645_101613832 173
279 3300025913 Ga0207695_10152244 Ga0207695_101522443 173
280 3300025919 Ga0207657_10000839 Ga0207657_100008394 173
281 3300025927 Ga0207687_10029259 Ga0207687_100292595 173
282 3300025931 Ga0207644_10262625 Ga0207644_102626252 173
283 3300025932 Ga0207690_10000005 Ga0207690_10000005305 173
284 3300025949 Ga0207667_10638013 Ga0207667_106380132 173
285 3300025981 Ga0207640_10653420 Ga0207640_106534202 173
286 3300026023 Ga0207677_10000044 Ga0207677_1000004459 173
287 3300026075 Ga0207708_10209280 Ga0207708_102092802 173
288 3300026088 Ga0207641_10035171 Ga0207641_100351713 173
289 3300026142 Ga0207698_10811690 Ga0207698_108116901 173
290 3300027395 Ga0209996_1007658 Ga0209996_10076582 173
291 3300027462 Ga0210000_1000719 Ga0210000_10007193 173
292 3300027526 Ga0209968_1005366 Ga0209968_10053663 173
293 3300028379 Ga0268266_10000055 Ga0268266_10000055245 173
294 3300028379 Ga0268266_10098288 Ga0268266_100982882 173
295 3300031901 Ga0307406_10182713 Ga0307406_101827132 173
296 3300031901 Ga0307406_10375685 Ga0307406_103756852 173
297 3300032004 Ga0307414_10001549 Ga0307414_100015496 173
298 3300032004 Ga0307414_10079731 Ga0307414_100797312 173
299 3300032004 Ga0307414_10163229 Ga0307414_101632293 173
300 3300032004 Ga0307414_10369030 Ga0307414_103690303 173
301 3300032004 Ga0307414_10444246 Ga0307414_104442462 173
302 3300032005 Ga0307411_10040338 Ga0307411_100403383 173
303 3300032005 Ga0307411_10653775 Ga0307411_106537751 173
304 3300037471 Ga0395905_0673841 Ga0395905_0673841_128_700 173
305 3300039437 Ga0436365_1862304 Ga0436365_1862304_16095_16676 173
306 3300042437 Ga0439444_0010931 Ga0439444_0010931_45_629 173
307 3300042439 Ga0439464_0137737 Ga0439464_0137737_148_744 173
308 3300046471 Ga0495650_0094611 Ga0495650_0094611_195_752 173
309 3300046512 Ga0495610_0162692 Ga0495610_0162692_299_871 173
310 3300046513 Ga0495616_0000022 Ga0495616_0000022_87492_88049 173
311 3300046519 Ga0495632_0054694 Ga0495632_0054694_1347_1931 173
312 3300046522 Ga0495643_0025809 Ga0495643_0025809_2439_3011 173
313 3300046525 Ga0495663_0058623 Ga0495663_0058623_497_1153 173
314 3300046616 Ga0495668_0000004 Ga0495668_0000004_428235_428807 173
315 3300046660 Ga0495625_0000553 Ga0495625_0000553_43377_43949 173
316 3300048911 Ga0496108_0096722 Ga0496108_0096722_1142_1714 173
317 3300048927 Ga0496124_0382684 Ga0496124_0382684_189_761 173
318 3300049572 Ga0501036_0581603 Ga0501036_0581603_243_839 173
319 3300049582 Ga0501048_0160788 Ga0501048_0160788_334_930 173
320 3300049589 Ga0501073_0612673 Ga0501073_0612673_11_607 173
321 3300049592 Ga0501076_0385907 Ga0501076_0385907_430_1026 173
322 3300050512 nmdc:mga0n895_92159_c1 nmdc:mga0n895_92159_c1_474_1055 173
323 3300053091 Ga0500647_0078205 Ga0500647_0078205_663_1220 173
324 3300053108 Ga0500562_010572 Ga0500562_010572_909_1466 173
325 3300053134 Ga0500658_0151592 Ga0500658_0151592_83_655 173
326 3300053139 Ga0500568_0002510 Ga0500568_0002510_7254_7838 173
327 3300053140 Ga0500573_0069531 Ga0500573_0069531_1223_1804 173
328 3300053151 Ga0500604_0000031 Ga0500604_0000031_25196_25780 173
329 3300053151 Ga0500604_0002272 Ga0500604_0002272_2740_3297 173
330 3300053153 Ga0500616_0001465 Ga0500616_0001465_6149_6733 173
331 3300053158 Ga0500627_0000049 Ga0500627_0000049_25885_26457 173
332 3300053158 Ga0500627_0016099 Ga0500627_0016099_1771_2343 173
333 3300053158 Ga0500627_0036470 Ga0500627_0036470_1519_2076 173
334 3300053739 Ga0500587_000417 Ga0500587_000417_608_1198 173
335 3300005290 Ga0065712_10318943 Ga0065712_103189431 174
336 3300005330 Ga0070690_100060358 Ga0070690_1000603584 174
337 3300005331 Ga0070670_100028698 Ga0070670_1000286986 174
338 3300005331 Ga0070670_100645169 Ga0070670_1006451691 174
339 3300005338 Ga0068868_101070760 Ga0068868_1010707601 174
340 3300005340 Ga0070689_100121635 Ga0070689_1001216352 174
341 3300005343 Ga0070687_100185033 Ga0070687_1001850331 174
342 3300005347 Ga0070668_100074846 Ga0070668_1000748462 174
343 3300005347 Ga0070668_100299186 Ga0070668_1002991862 174
344 3300005353 Ga0070669_100345079 Ga0070669_1003450792 174
345 3300005354 Ga0070675_100127337 Ga0070675_1001273372 174
346 3300005354 Ga0070675_100264366 Ga0070675_1002643663 174
347 3300005354 Ga0070675_100272925 Ga0070675_1002729252 174
348 3300005355 Ga0070671_100136363 Ga0070671_1001363632 174
349 3300005356 Ga0070674_100008899 Ga0070674_1000088994 174
350 3300005356 Ga0070674_100202326 Ga0070674_1002023262 174
351 3300005364 Ga0070673_100102438 Ga0070673_1001024382 174
352 3300005367 Ga0070667_100171897 Ga0070667_1001718972 174
353 3300005438 Ga0070701_10130632 Ga0070701_101306321 174
354 3300005440 Ga0070705_100609465 Ga0070705_1006094652 174
355 3300005455 Ga0070663_100201931 Ga0070663_1002019312 174
356 3300005457 Ga0070662_100063538 Ga0070662_1000635382 174
357 3300005459 Ga0068867_100006451 Ga0068867_1000064514 174
358 3300005459 Ga0068867_100104461 Ga0068867_1001044612 174
359 3300005466 Ga0070685_10285373 Ga0070685_102853732 174
360 3300005543 Ga0070672_100065270 Ga0070672_1000652702 174
361 3300005544 Ga0070686_100318664 Ga0070686_1003186641 174
362 3300005548 Ga0070665_100172679 Ga0070665_1001726792 174
363 3300005549 Ga0070704_101018157 Ga0070704_1010181571 174
364 3300005578 Ga0068854_100499613 Ga0068854_1004996132 174
365 3300005616 Ga0068852_100214509 Ga0068852_1002145092 174
366 3300005616 Ga0068852_100866795 Ga0068852_1008667951 174
367 3300005617 Ga0068859_100027031 Ga0068859_1000270317 174
368 3300005617 Ga0068859_100487604 Ga0068859_1004876042 174
369 3300005618 Ga0068864_100582411 Ga0068864_1005824112 174
370 3300005618 Ga0068864_100761466 Ga0068864_1007614662 174
371 3300005719 Ga0068861_100031256 Ga0068861_1000312564 174
372 3300005840 Ga0068870_10222769 Ga0068870_102227692 174
373 3300005840 Ga0068870_10477842 Ga0068870_104778422 174
374 3300005841 Ga0068863_100220834 Ga0068863_1002208342 174
375 3300005841 Ga0068863_100446185 Ga0068863_1004461852 174
376 3300005842 Ga0068858_100049472 Ga0068858_1000494722 174
377 3300005843 Ga0068860_100000903 Ga0068860_10000090328 174
378 3300005843 Ga0068860_100333878 Ga0068860_1003338783 174
379 3300005843 Ga0068860_100475791 Ga0068860_1004757912 174
380 3300005844 Ga0068862_100033939 Ga0068862_1000339395 174
381 3300006028 Ga0070717_10811336 Ga0070717_108113362 174
382 3300006177 Ga0075362_10030142 Ga0075362_100301422 174
383 3300006178 Ga0075367_10070525 Ga0075367_100705252 174
384 3300006195 Ga0075366_10056864 Ga0075366_100568644 174
385 3300006237 Ga0097621_100150814 Ga0097621_1001508142 174
386 3300006358 Ga0068871_100182195 Ga0068871_1001821952 174
387 3300006881 Ga0068865_100003663 Ga0068865_1000036637 174
388 3300006881 Ga0068865_100321729 Ga0068865_1003217292 174
389 3300006931 Ga0097620_100027032 Ga0097620_1000270327 174
390 3300006931 Ga0097620_100487595 Ga0097620_1004875951 174
391 3300009094 Ga0111539_10179513 Ga0111539_101795132 174
392 3300009098 Ga0105245_10246709 Ga0105245_102467092 174
393 3300009148 Ga0105243_10162637 Ga0105243_101626372 174
394 3300009176 Ga0105242_10069596 Ga0105242_100695962 174
395 3300009177 Ga0105248_10417796 Ga0105248_104177962 174
396 3300009177 Ga0105248_10476008 Ga0105248_104760082 174
397 3300009553 Ga0105249_10442664 Ga0105249_104426641 174
398 3300013296 Ga0157374_10125352 Ga0157374_101253524 174
399 3300013297 Ga0157378_10046586 Ga0157378_100465862 174
400 3300013297 Ga0157378_10385566 Ga0157378_103855662 174
401 3300013306 Ga0163162_10040290 Ga0163162_100402906 174
402 3300013308 Ga0157375_10605346 Ga0157375_106053462 174
403 3300014325 Ga0163163_10382828 Ga0163163_103828282 174
404 3300014326 Ga0157380_10007364 Ga0157380_100073648 174
405 3300014326 Ga0157380_10231710 Ga0157380_102317102 174
406 3300014968 Ga0157379_10035631 Ga0157379_100356313 174
407 3300014968 Ga0157379_10066556 Ga0157379_100665564 174
408 3300014968 Ga0157379_10117893 Ga0157379_101178932 174
409 3300017792 Ga0163161_10065092 Ga0163161_100650922 174
410 3300025315 Ga0207697_10009458 Ga0207697_100094583 174
411 3300025893 Ga0207682_10030036 Ga0207682_100300362 174
412 3300025901 Ga0207688_10008762 Ga0207688_100087623 174
413 3300025903 Ga0207680_10153493 Ga0207680_101534933 174
414 3300025907 Ga0207645_10012727 Ga0207645_100127272 174
415 3300025908 Ga0207643_10020601 Ga0207643_100206012 174
416 3300025918 Ga0207662_10042493 Ga0207662_100424932 174
417 3300025923 Ga0207681_10150675 Ga0207681_101506752 174
418 3300025926 Ga0207659_10203034 Ga0207659_102030342 174
419 3300025926 Ga0207659_10881900 Ga0207659_108819001 174
420 3300025927 Ga0207687_10499813 Ga0207687_104998132 174
421 3300025931 Ga0207644_10342530 Ga0207644_103425301 174
422 3300025931 Ga0207644_10342622 Ga0207644_103426222 174
423 3300025933 Ga0207706_10041710 Ga0207706_100417103 174
424 3300025934 Ga0207686_10146154 Ga0207686_101461542 174
425 3300025935 Ga0207709_10041714 Ga0207709_100417144 174
426 3300025935 Ga0207709_10208451 Ga0207709_102084511 174
427 3300025937 Ga0207669_10792508 Ga0207669_107925081 174
428 3300025938 Ga0207704_10005537 Ga0207704_100055377 174
429 3300025938 Ga0207704_10115058 Ga0207704_101150582 174
430 3300025940 Ga0207691_10332307 Ga0207691_103323072 174
431 3300025942 Ga0207689_10195671 Ga0207689_101956711 174
432 3300025960 Ga0207651_10013310 Ga0207651_100133102 174
433 3300025961 Ga0207712_10050532 Ga0207712_100505324 174
434 3300025961 Ga0207712_10515660 Ga0207712_105156602 174
435 3300025972 Ga0207668_10146778 Ga0207668_101467782 174
436 3300025972 Ga0207668_10586643 Ga0207668_105866432 174
437 3300025981 Ga0207640_10163832 Ga0207640_101638322 174
438 3300025986 Ga0207658_10238386 Ga0207658_102383862 174
439 3300026023 Ga0207677_10686216 Ga0207677_106862161 174
440 3300026035 Ga0207703_10031316 Ga0207703_100313164 174
441 3300026035 Ga0207703_10273572 Ga0207703_102735722 174
442 3300026067 Ga0207678_10121197 Ga0207678_101211972 174
443 3300026075 Ga0207708_10019486 Ga0207708_100194862 174
444 3300026088 Ga0207641_10198953 Ga0207641_101989532 174
445 3300026088 Ga0207641_10302402 Ga0207641_103024022 174
446 3300026088 Ga0207641_10475736 Ga0207641_104757362 174
447 3300026089 Ga0207648_10010128 Ga0207648_100101285 174
448 3300026095 Ga0207676_10077980 Ga0207676_100779804 174
449 3300026095 Ga0207676_10561714 Ga0207676_105617142 174
450 3300026095 Ga0207676_10886521 Ga0207676_108865212 174
451 3300026116 Ga0207674_10077608 Ga0207674_100776082 174
452 3300026118 Ga0207675_100007331 Ga0207675_10000733110 174
453 3300026118 Ga0207675_100042970 Ga0207675_1000429702 174
454 3300026142 Ga0207698_10607701 Ga0207698_106077011 174
455 3300026142 Ga0207698_10728667 Ga0207698_107286672 174
456 3300027907 Ga0207428_10080158 Ga0207428_100801582 174
457 3300028379 Ga0268266_10443517 Ga0268266_104435172 174
458 3300028380 Ga0268265_10017185 Ga0268265_100171852 174
459 3300028381 Ga0268264_10016446 Ga0268264_100164463 174
460 3300028381 Ga0268264_10451617 Ga0268264_104516172 174
461 3300028577 Ga0265318_10062847 Ga0265318_100628471 174
462 3300031235 Ga0265330_10059375 Ga0265330_100593752 174
463 3300031238 Ga0265332_10004178 Ga0265332_100041783 174
464 3300031239 Ga0265328_10014479 Ga0265328_100144793 174
465 3300031240 Ga0265320_10023211 Ga0265320_100232114 174
466 3300031242 Ga0265329_10039391 Ga0265329_100393912 174
467 3300031250 Ga0265331_10001179 Ga0265331_100011796 174
468 3300031251 Ga0265327_10163829 Ga0265327_101638291 174
469 3300031344 Ga0265316_10049383 Ga0265316_100493833 174
470 3300031595 Ga0265313_10053687 Ga0265313_100536871 174
471 3300031711 Ga0265314_10000887 Ga0265314_100008874 174
472 3300031712 Ga0265342_10029125 Ga0265342_100291251 174
473 3300031852 Ga0307410_10294831 Ga0307410_102948312 174
474 3300032005 Ga0307411_10216370 Ga0307411_102163702 174
475 3300035112 Ga0373932_0113151 Ga0373932_0113151_234_812 174
476 3300045051 Ga0451576_0318366 Ga0451576_0318366_159_743 174
477 3300046459 Ga0495629_0185204 Ga0495629_0185204_15_599 174
478 3300050489 nmdc:mga03683_36513_c1 nmdc:mga03683_36513_c1_552_1130 174
479 3300050493 nmdc:mga0k408_28373_c1 nmdc:mga0k408_28373_c1_171_749 174
480 3300050493 nmdc:mga0k408_357172_c1 nmdc:mga0k408_357172_c1_232_810 174
481 3300050511 nmdc:mga08y16_125138_c1 nmdc:mga08y16_125138_c1_1461_2045 174
482 3300006881 Ga0068865_100109023 Ga0068865_1001090232 175
483 3300009148 Ga0105243_10451846 Ga0105243_104518462 175
484 3300009545 Ga0105237_10401355 Ga0105237_104013552 175
485 3300014968 Ga0157379_10232735 Ga0157379_102327353 175
486 3300025292 Ga0209676_1014718 Ga0209676_10147183 175
487 3300025294 Ga0209025_1038151 Ga0209025_10381513 175
488 3300025304 Ga0209257_1001176 Ga0209257_100117636 175
489 3300025918 Ga0207662_10149753 Ga0207662_101497533 175
490 3300025935 Ga0207709_10224338 Ga0207709_102243382 175
491 3300032004 Ga0307414_10005871 Ga0307414_100058714 175
492 3300032004 Ga0307414_10090859 Ga0307414_100908592 175
493 3300032004 Ga0307414_10433509 Ga0307414_104335092 175
494 3300041463 Ga0451804_0684765 Ga0451804_0684765_75_659 175
495 3300041512 Ga0451853_0042166 Ga0451853_0042166_42_632 175
496 3300046557 Ga0495622_0001538 Ga0495622_0001538_756_1319 175
497 3300049759 Ga0501262_025252 Ga0501262_025252_50_637 175
498 3300053087 Ga0500643_000465 Ga0500643_000465_9982_10545 175
499 3300003215 JGI25153J46596_10001493 JGI25153J46596_100014933 176
500 3300009551 Ga0105238_10683603 Ga0105238_106836032 176
501 3300025272 Ga0209455_1010168 Ga0209455_10101682 176
502 3300025297 Ga0209758_1000036 Ga0209758_1000036217 176
503 3300028379 Ga0268266_10695186 Ga0268266_106951862 176
504 3300005719 Ga0068861_100961631 Ga0068861_1009616311 177
505 3300025910 Ga0207684_10166258 Ga0207684_101662583 177
506 3300038705 Ga0237819_00574 Ga0237819_00574_6649_7212 177
507 3300005295 Ga0065707_10168593 Ga0065707_101685932 178
508 3300005536 Ga0070697_100495558 Ga0070697_1004955582 178
509 3300006844 Ga0075428_100198067 Ga0075428_1001980674 178
510 3300006847 Ga0075431_100054682 Ga0075431_1000546824 178
511 3300006871 Ga0075434_100443445 Ga0075434_1004434452 178
512 3300007076 Ga0075435_100130668 Ga0075435_1001306683 178
513 3300007076 Ga0075435_100451210 Ga0075435_1004512102 178
514 3300009098 Ga0105245_10412655 Ga0105245_104126552 178
515 3300009147 Ga0114129_10033159 Ga0114129_100331593 178
516 3300009176 Ga0105242_10002502 Ga0105242_100025028 178
517 3300020080 Ga0206350_11574848 Ga0206350_115748481 178
518 3300025934 Ga0207686_10046068 Ga0207686_100460682 178
519 3300025939 Ga0207665_10300827 Ga0207665_103008272 178
520 3300026041 Ga0207639_10631123 Ga0207639_106311231 178
521 3300028786 Ga0307517_10078802 Ga0307517_100788022 178
522 3300031251 Ga0265327_10002178 Ga0265327_1000217815 178
523 3300031344 Ga0265316_10001190 Ga0265316_1000119012 178
524 3300031548 Ga0307408_100707213 Ga0307408_1007072132 178
525 3300031730 Ga0307516_10000094 Ga0307516_1000009496 178
526 3300031995 Ga0307409_100409845 Ga0307409_1004098453 178
527 3300032002 Ga0307416_100521998 Ga0307416_1005219982 178
528 3300041404 Ga0439436_0074971 Ga0439436_0074971_256_840 178
529 3300042001 Ga0439441_001972 Ga0439441_001972_1352_1942 178
530 3300050489 nmdc:mga03683_248435_c1 nmdc:mga03683_248435_c1_92_685 178
531 3300050507 nmdc:mga05p37_27888_c1 nmdc:mga05p37_27888_c1_5033_5617 178
532 3300050508 nmdc:mga09592_94489_c1 nmdc:mga09592_94489_c1_1892_2476 178
533 3300050509 nmdc:mga0qj67_102112_c1 nmdc:mga0qj67_102112_c1_1307_1903 178
534 3300050510 nmdc:mga06r32_150345_c1 nmdc:mga06r32_150345_c1_1229_1813 178
535 3300050512 nmdc:mga0n895_20283_c1 nmdc:mga0n895_20283_c1_3132_3731 178
536 3300050513 nmdc:mga0rr50_213794_c1 nmdc:mga0rr50_213794_c1_792_1391 178
537 3300050514 nmdc:mga08x19_12629_c1 nmdc:mga08x19_12629_c1_2371_2970 178
538 3300050514 nmdc:mga08x19_14797_c1 nmdc:mga08x19_14797_c1_305_904 178
539 3300050514 nmdc:mga08x19_477428_c1 nmdc:mga08x19_477428_c1_40_624 178
540 3300050515 nmdc:mga0a205_156041_c1 nmdc:mga0a205_156041_c1_1233_1832 178
541 3300053137 Ga0500561_0044765 Ga0500561_0044765_99_692 178
542 3300002067 JGI24735J21928_10135463 JGI24735J21928_101354631 179
543 3300005440 Ga0070705_100068326 Ga0070705_1000683262 179
544 3300005547 Ga0070693_100279134 Ga0070693_1002791342 179
545 3300005549 Ga0070704_100106528 Ga0070704_1001065283 179
546 3300005577 Ga0068857_100027365 Ga0068857_1000273652 179
547 3300005617 Ga0068859_100156144 Ga0068859_1001561443 179
548 3300005843 Ga0068860_100046033 Ga0068860_1000460332 179
549 3300005844 Ga0068862_100040916 Ga0068862_1000409164 179
550 3300006852 Ga0075433_10629491 Ga0075433_106294911 179
551 3300006871 Ga0075434_100039264 Ga0075434_1000392642 179
552 3300006931 Ga0097620_100156131 Ga0097620_1001561313 179
553 3300007076 Ga0075435_100294055 Ga0075435_1002940553 179
554 3300009147 Ga0114129_10164186 Ga0114129_101641863 179
555 3300009176 Ga0105242_10078105 Ga0105242_100781052 179
556 3300009176 Ga0105242_10884420 Ga0105242_108844202 179
557 3300009551 Ga0105238_10591871 Ga0105238_105918711 179
558 3300009553 Ga0105249_11573734 Ga0105249_115737341 179
559 3300013297 Ga0157378_10797836 Ga0157378_107978362 179
560 3300013307 Ga0157372_10408544 Ga0157372_104085442 179
561 3300013308 Ga0157375_11501661 Ga0157375_115016611 179
562 3300014326 Ga0157380_10770998 Ga0157380_107709982 179
563 3300014497 Ga0182008_10552911 Ga0182008_105529111 179
564 3300025934 Ga0207686_10017443 Ga0207686_100174434 179
565 3300025961 Ga0207712_11032911 Ga0207712_110329111 179
566 3300026116 Ga0207674_10034895 Ga0207674_100348955 179
567 3300028380 Ga0268265_10059327 Ga0268265_100593273 179
568 3300028381 Ga0268264_10096134 Ga0268264_100961342 179
569 3300031250 Ga0265331_10017366 Ga0265331_100173664 179
570 3300031911 Ga0307412_10046703 Ga0307412_100467032 179
571 3300037466 Ga0395898_0402019 Ga0395898_0402019_108_698 179
572 3300038443 Ga0395901_0019134 Ga0395901_0019134_2989_3579 179
573 3300048906 Ga0496103_0184047 Ga0496103_0184047_90_674 179
574 3300048909 Ga0496106_0062415 Ga0496106_0062415_879_1463 179
575 3300048910 Ga0496107_0090125 Ga0496107_0090125_744_1328 179
576 3300048914 Ga0496111_0577511 Ga0496111_0577511_31_615 179
577 3300048915 Ga0496112_0165469 Ga0496112_0165469_1042_1626 179
578 3300048916 Ga0496113_0234721 Ga0496113_0234721_668_1252 179
579 3300049583 Ga0501067_0113761 Ga0501067_0113761_615_1199 179
580 3300050507 nmdc:mga05p37_45790_c1 nmdc:mga05p37_45790_c1_3634_4218 179
581 3300050512 nmdc:mga0n895_45914_c1 nmdc:mga0n895_45914_c1_536_1120 179
582 3300050515 nmdc:mga0a205_93318_c1 nmdc:mga0a205_93318_c1_99_683 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

136

217

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpr-assembly2.cif.gz_B borrelia miyamotoi fbpa complement inhibitory domain 0.4945 35 173
4xev-assembly1.cif.gz_A fusion of pyk2-fat domain with leupaxin ld1 motif, complexed with leupaxin ld4 peptide 0.4916 41 178
5zle-assembly1.cif.gz_A human duodenal cytochrome b (dcytb) in substrate free form 0.488 1 176
7ae9-assembly1.cif.gz_B crystal structure of mono-ampylated hepn(r46e) toxin in complex with mnt antitoxin 0.4854 35 176
5zle-assembly1.cif.gz_A human duodenal cytochrome b (dcytb) in substrate free form 0.4715 1 176
ID Description Score Start End Superfamily
af_A0A286YA76_825_961_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6362 35 176 1.20.120.230
af_I1KW97_209_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6067 45 147 1.20.120.550
af_Q61140_738_874_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5961 35 177 1.20.120.230
af_A0A286YA76_825_961_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5957 35 176 1.20.120.230
af_I1KW97_209_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5796 45 147 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A383EIT8-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9784 35 141 GO:0016020
AF-A0A7C7S3Q6-F1-model_v4 deleted 0.9667 31 173
AF-A0A2S6TV52-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9621 30 178 GO:0016020
AF-A0A1V1PRK1-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9547 1 178 GO:0016020
AF-A0A2E7UK13-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9534 35 177 GO:0016020

Feature Viewer

pLDDT pTM Quality
90.77 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map