F466195

General Info

Members Datasets Scaffolds Average Seq Length
582 346 1164 68

Family's Representative Sequence

Representative Sequence 3300042012|Ga0439455_0092959|Ga0439455_0092959_546_788
Length 80
Sequence MERPSASKPAVAMTNEEERALREQLARLLQEHRDLDAAIEALVISPGSDLIQVQRLKKRKLVLRDKIRRIEDQLTPDIIA

Samples

Sample ID Description Type Environment
1 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
111 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
112 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
202 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
232 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
233 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
234 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
235 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
236 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
263 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
338 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
341 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
346 2842694124 Methylopila sp. R-72369 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.34
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 0
Rhizoplane 6.01
Rhizosphere 89.18
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439455_0092959 3300042012 Bacteria 828
2 2214773013 2209111006 Bacteria 2614
3 ARcpr5oldR_c000171 3300000041 Bacteria 11247
4 ARSoilYngRDRAFT_c00211 3300000042 Bacteria 9635
5 ARcpr5yngRDRAFT_c000814 3300000043 Bacteria 3754
6 ARSoilOldRDRAFT_c000112 3300000044 Bacteria 14373
7 ARCol0oldRDRAFT_c01383 3300000045 Bacteria 1619
8 ARCol0yngRDRAFT_1000085 3300000652 Bacteria 17273
9 JGI24737J22298_10021052 3300001990 Bacteria 2079
10 rootL2_10087348 3300003322 Bacteria 1990
11 JGI26129J50193_1003047 3300003349 Bacteria 1176
12 Ga0065165_1031957 3300005262 Bacteria 1656
13 Ga0065717_1002296 3300005276 Bacteria 2228
14 Ga0065704_10078466 3300005289 Bacteria 4420
15 Ga0065712_10131439 3300005290 Bacteria 1545
16 Ga0065715_10097811 3300005293 Bacteria 3645
17 Ga0070658_10170513 3300005327 Bacteria 1828
18 Ga0070658_10255537 3300005327 Bacteria 1487
19 Ga0070676_10031589 3300005328 Bacteria 3027
20 Ga0070676_10411036 3300005328 Bacteria 944
21 Ga0070683_100099235 3300005329 Bacteria 2741
22 Ga0070683_100920153 3300005329 Bacteria 839
23 Ga0070683_101197948 3300005329 Bacteria 730
24 Ga0070690_100040116 3300005330 Bacteria 2960
25 Ga0070690_100188520 3300005330 Bacteria 1429
26 Ga0070677_10657789 3300005333 Bacteria 586
27 Ga0068869_100208199 3300005334 Bacteria 1545
28 Ga0070666_10257864 3300005335 Bacteria 1236
29 Ga0070666_10326191 3300005335 Bacteria 1096
30 Ga0070680_100063235 3300005336 Bacteria 3031
31 Ga0070680_100190586 3300005336 Bacteria 1727
32 Ga0070680_101064404 3300005336 Bacteria 699
33 Ga0070682_100099002 3300005337 Bacteria 1921
34 Ga0070682_100178170 3300005337 Bacteria 1482
35 Ga0068868_100824354 3300005338 Bacteria 839
36 Ga0070660_100065569 3300005339 Bacteria 2826
37 Ga0070689_100005831 3300005340 Bacteria 8457
38 Ga0070691_10117351 3300005341 Bacteria 1337
39 Ga0070661_100021630 3300005344 Bacteria 4597
40 Ga0070661_100880848 3300005344 Bacteria 738
41 Ga0070668_100088678 3300005347 Bacteria 2435
42 Ga0070669_100350227 3300005353 Bacteria 1199
43 Ga0070671_100199062 3300005355 Bacteria 1698
44 Ga0070671_101783662 3300005355 Unclassified 547
45 Ga0070673_100057115 3300005364 Bacteria 3083
46 Ga0070688_100001610 3300005365 Bacteria 11296
47 Ga0070659_100035422 3300005366 Bacteria 3886
48 Ga0070659_101592496 3300005366 Bacteria 583
49 Ga0070667_100060355 3300005367 Bacteria 3208
50 Ga0070667_100061378 3300005367 Bacteria 3183
51 Ga0070667_100199885 3300005367 Bacteria 1773
52 Ga0070667_102154278 3300005367 Bacteria 525
53 Ga0070703_10305507 3300005406 Unclassified 665
54 Ga0070709_10300899 3300005434 Bacteria 1171
55 Ga0070714_100017661 3300005435 Bacteria 5783
56 Ga0070714_100729336 3300005435 Bacteria 957
57 Ga0070713_100768114 3300005436 Bacteria 923
58 Ga0070713_101611628 3300005436 Bacteria 630
59 Ga0070710_10045394 3300005437 Bacteria 2442
60 Ga0070701_10102615 3300005438 Bacteria 1587
61 Ga0070711_100124668 3300005439 Bacteria 1910
62 Ga0070711_100178473 3300005439 Bacteria 1624
63 Ga0070700_100154817 3300005441 Bacteria 1571
64 Ga0070694_100008881 3300005444 Bacteria 6157
65 Ga0070708_100209889 3300005445 Bacteria 1825
66 Ga0070663_100051430 3300005455 Bacteria 2935
67 Ga0070663_100169488 3300005455 Bacteria 1686
68 Ga0070678_100062498 3300005456 Bacteria 2750
69 Ga0070678_101480486 3300005456 Bacteria 635
70 Ga0070662_100039749 3300005457 Bacteria 3346
71 Ga0070681_10148173 3300005458 Bacteria 2274
72 Ga0070681_10163567 3300005458 Bacteria 2149
73 Ga0068867_100058171 3300005459 Bacteria 2864
74 Ga0068867_100162337 3300005459 Bacteria 1763
75 Ga0070685_10933265 3300005466 Bacteria 648
76 Ga0074259_10613507 3300005507 Bacteria 553
77 Ga0070679_100107363 3300005530 Bacteria 2777
78 Ga0070679_100127395 3300005530 Bacteria 2527
79 Ga0070679_100264061 3300005530 Bacteria 1676
80 Ga0070684_101006270 3300005535 Bacteria 782
81 Ga0068853_100293280 3300005539 Bacteria 1502
82 Ga0068853_101118506 3300005539 Bacteria 760
83 Ga0070672_100179920 3300005543 Bacteria 1762
84 Ga0070672_100217239 3300005543 Bacteria 1602
85 Ga0070686_100061512 3300005544 Bacteria 2427
86 Ga0070686_100208704 3300005544 Bacteria 1405
87 Ga0070686_100344441 3300005544 Bacteria 1118
88 Ga0070695_100066079 3300005545 Bacteria 2356
89 Ga0070695_100222113 3300005545 Bacteria 1361
90 Ga0070695_101235292 3300005545 Bacteria 615
91 Ga0070696_100078781 3300005546 Bacteria 2330
92 Ga0070696_100124424 3300005546 Bacteria 1869
93 Ga0070693_100077708 3300005547 Bacteria 1971
94 Ga0070665_100041354 3300005548 Bacteria 4633
95 Ga0070665_100364649 3300005548 Bacteria 1451
96 Ga0070665_101370281 3300005548 Bacteria 717
97 Ga0070704_100018235 3300005549 Bacteria 4482
98 Ga0068855_101933881 3300005563 Bacteria 597
99 Ga0068857_100070306 3300005577 Bacteria 3117
100 Ga0068857_100074126 3300005577 Bacteria 3033
101 Ga0068854_100120557 3300005578 Bacteria 1991
102 Ga0068856_100046761 3300005614 Bacteria 4262
103 Ga0068856_101254721 3300005614 Bacteria 757
104 Ga0068852_100065257 3300005616 Bacteria 3175
105 Ga0068852_100178850 3300005616 Bacteria 1993
106 Ga0068852_100865519 3300005616 Bacteria 920
107 Ga0068859_101726036 3300005617 Bacteria 691
108 Ga0068861_100000005 3300005719 Bacteria 101677
109 Ga0068861_100040717 3300005719 Bacteria 3476
110 Ga0068861_102532136 3300005719 Bacteria 517
111 Ga0068863_100689691 3300005841 Bacteria 1015
112 Ga0068863_101896829 3300005841 Bacteria 606
113 Ga0068858_100177288 3300005842 Bacteria 2011
114 Ga0068858_100257402 3300005842 Bacteria 1658
115 Ga0068858_100319941 3300005842 Bacteria 1482
116 Ga0068860_100052798 3300005843 Bacteria 3865
117 Ga0068860_100144431 3300005843 Bacteria 2289
118 Ga0068862_100014295 3300005844 Bacteria 6585
119 Ga0068862_102362734 3300005844 Bacteria 543
120 Ga0081455_10000402 3300005937 Bacteria 57123
121 Ga0070717_10228373 3300006028 Bacteria 1638
122 Ga0075365_10596481 3300006038 Archaea 781
123 Ga0075364_10645996 3300006051 Bacteria 722
124 Ga0075432_10256946 3300006058 Bacteria 711
125 Ga0070715_10064253 3300006163 Bacteria 1620
126 Ga0070716_100041247 3300006173 Bacteria 2571
127 Ga0070712_100161850 3300006175 Bacteria 1729
128 Ga0070712_100549835 3300006175 Bacteria 973
129 Ga0070712_100567465 3300006175 Bacteria 958
130 Ga0075362_10284603 3300006177 Bacteria 818
131 Ga0075366_10341856 3300006195 Bacteria 918
132 Ga0097621_100059443 3300006237 Bacteria 3130
133 Ga0068871_100700863 3300006358 Bacteria 927
134 Ga0075428_100017415 3300006844 Bacteria 7941
135 Ga0075430_100079159 3300006846 Bacteria 2755
136 Ga0075431_100001907 3300006847 Bacteria 19804
137 Ga0075433_10297186 3300006852 Bacteria 1430
138 Ga0075429_100005227 3300006880 Bacteria 11166
139 Ga0068865_100025384 3300006881 Bacteria 3898
140 Ga0068865_100039636 3300006881 Bacteria 3196
141 Ga0068865_100686865 3300006881 Bacteria 873
142 Ga0075436_100015037 3300006914 Bacteria 5304
143 Ga0097620_101726011 3300006931 Bacteria 691
144 Ga0105240_10049938 3300009093 Bacteria 5276
145 Ga0105240_10067085 3300009093 Bacteria 4448
146 Ga0105240_11179316 3300009093 Bacteria 812
147 Ga0111539_10000178 3300009094 Bacteria 73928
148 Ga0111539_10301817 3300009094 Bacteria 1864
149 Ga0105245_10060390 3300009098 Bacteria 3414
150 Ga0105245_10089408 3300009098 Bacteria 2831
151 Ga0105247_10736560 3300009101 Bacteria 746
152 Ga0114129_10001129 3300009147 Bacteria 35251
153 Ga0105243_10218351 3300009148 Bacteria 1683
154 Ga0105243_10226173 3300009148 Bacteria 1657
155 Ga0105243_10575139 3300009148 Bacteria 1080
156 Ga0105241_10207847 3300009174 Bacteria 1639
157 Ga0105241_10636223 3300009174 Bacteria 967
158 Ga0105242_10225370 3300009176 Bacteria 1677
159 Ga0105248_10027318 3300009177 Bacteria 6351
160 Ga0105248_10196268 3300009177 Bacteria 2274
161 Ga0105248_10301432 3300009177 Bacteria 1804
162 Ga0105237_10253508 3300009545 Bacteria 1762
163 Ga0105237_10409577 3300009545 Unclassified 1361
164 Ga0105237_11354458 3300009545 Bacteria 718
165 Ga0105238_10045055 3300009551 Bacteria 4456
166 Ga0105238_10514280 3300009551 Bacteria 1199
167 Ga0105238_12003596 3300009551 Bacteria 613
168 Ga0105238_12423291 3300009551 Bacteria 560
169 Ga0105249_10080022 3300009553 Bacteria 3035
170 Ga0105249_12436889 3300009553 Bacteria 596
171 Ga0105239_10331800 3300010375 Bacteria 1716
172 Ga0105239_13059369 3300010375 Bacteria 545
173 Ga0105246_10237409 3300011119 Bacteria 1439
174 Ga0105246_10815102 3300011119 Bacteria 829
175 Ga0157317_1026832 3300012475 Bacteria 543
176 Ga0157335_1020068 3300012492 Bacteria 627
177 Ga0157319_1026072 3300012497 Bacteria 602
178 Ga0157373_10273605 3300013100 Bacteria 1196
179 Ga0157370_10168577 3300013104 Bacteria 2036
180 Ga0157370_10384026 3300013104 Bacteria 1293
181 Ga0157374_10222449 3300013296 Bacteria 1853
182 Ga0157374_11436233 3300013296 Bacteria 713
183 Ga0157374_11446845 3300013296 Bacteria 710
184 Ga0157378_10062209 3300013297 Bacteria 3333
185 Ga0157378_10106188 3300013297 Bacteria 2568
186 Ga0157378_10239381 3300013297 Bacteria 1733
187 Ga0163162_10972859 3300013306 Bacteria 959
188 Ga0157372_10653559 3300013307 Bacteria 1224
189 Ga0157372_11047487 3300013307 Bacteria 944
190 Ga0157375_10439688 3300013308 Bacteria 1470
191 Ga0157375_10844040 3300013308 Bacteria 1063
192 Ga0163163_10006271 3300014325 Bacteria 10379
193 Ga0163163_11139609 3300014325 Bacteria 843
194 Ga0157380_10591893 3300014326 Bacteria 1096
195 Ga0157380_11053681 3300014326 Bacteria 850
196 Ga0157379_10033583 3300014968 Bacteria 4575
197 Ga0157379_10036586 3300014968 Bacteria 4376
198 Ga0157379_10683260 3300014968 Bacteria 963
199 Ga0157379_11676891 3300014968 Bacteria 622
200 Ga0157376_10046644 3300014969 Bacteria 3574
201 Ga0206356_11696749 3300020070 Bacteria 878
202 Ga0206354_10654248 3300020081 Bacteria 1517
203 Ga0213872_10030244 3300021361 Bacteria 2483
204 Ga0213872_10135206 3300021361 Bacteria 1084
205 Ga0213872_10406142 3300021361 Bacteria 552
206 Ga0213874_10309465 3300021377 Bacteria 596
207 Ga0213876_10000891 3300021384 Bacteria 19945
208 Ga0213876_10032844 3300021384 Bacteria 2736
209 Ga0207666_1001648 3300025271 Bacteria 2650
210 Ga0207697_10024807 3300025315 Bacteria 2453
211 Ga0207692_10003250 3300025898 Bacteria 6323
212 Ga0207692_10078229 3300025898 Bacteria 1762
213 Ga0207642_10993770 3300025899 Unclassified 540
214 Ga0207688_10151522 3300025901 Bacteria 1370
215 Ga0207680_10557334 3300025903 Bacteria 818
216 Ga0207680_10563803 3300025903 Bacteria 813
217 Ga0207647_10339497 3300025904 Bacteria 851
218 Ga0207699_10017650 3300025906 Bacteria 3763
219 Ga0207699_10106329 3300025906 Bacteria 1791
220 Ga0207645_10060131 3300025907 Bacteria 2426
221 Ga0207645_10066619 3300025907 Bacteria 2302
222 Ga0207645_10413333 3300025907 Bacteria 908
223 Ga0207705_10561464 3300025909 Bacteria 887
224 Ga0207705_10633388 3300025909 Bacteria 831
225 Ga0207654_10819398 3300025911 Bacteria 673
226 Ga0207707_10067659 3300025912 Bacteria 3111
227 Ga0207707_10227636 3300025912 Bacteria 1622
228 Ga0207695_10949630 3300025913 Bacteria 739
229 Ga0207695_11233323 3300025913 Bacteria 628
230 Ga0207671_10530198 3300025914 Bacteria 939
231 Ga0207671_10772377 3300025914 Bacteria 763
232 Ga0207693_10013584 3300025915 Bacteria 6563
233 Ga0207663_10040652 3300025916 Bacteria 2828
234 Ga0207660_10129298 3300025917 Bacteria 1921
235 Ga0207660_10994550 3300025917 Bacteria 684
236 Ga0207662_10011583 3300025918 Bacteria 4897
237 Ga0207662_10224299 3300025918 Bacteria 1225
238 Ga0207657_10020994 3300025919 Bacteria 6157
239 Ga0207657_10036666 3300025919 Bacteria 4387
240 Ga0207649_10736143 3300025920 Bacteria 766
241 Ga0207652_10048783 3300025921 Bacteria 3621
242 Ga0207652_10739342 3300025921 Bacteria 876
243 Ga0207652_11092554 3300025921 Bacteria 698
244 Ga0207646_10133652 3300025922 Bacteria 2233
245 Ga0207681_11273071 3300025923 Bacteria 618
246 Ga0207694_10163412 3300025924 Bacteria 1799
247 Ga0207694_10280162 3300025924 Bacteria 1369
248 Ga0207687_10029819 3300025927 Bacteria 3672
249 Ga0207700_10040659 3300025928 Bacteria 3395
250 Ga0207664_10441703 3300025929 Bacteria 1160
251 Ga0207644_10366195 3300025931 Bacteria 1173
252 Ga0207690_10277569 3300025932 Bacteria 1304
253 Ga0207690_11325387 3300025932 Bacteria 602
254 Ga0207706_10002762 3300025933 Bacteria 17068
255 Ga0207706_10041895 3300025933 Bacteria 4058
256 Ga0207706_10080377 3300025933 Bacteria 2866
257 Ga0207686_10159514 3300025934 Bacteria 1579
258 Ga0207686_10751537 3300025934 Bacteria 778
259 Ga0207709_10008740 3300025935 Bacteria 5587
260 Ga0207709_10709872 3300025935 Bacteria 805
261 Ga0207670_10196079 3300025936 Bacteria 1531
262 Ga0207670_10284406 3300025936 Bacteria 1290
263 Ga0207669_10285484 3300025937 Bacteria 1247
264 Ga0207704_10277400 3300025938 Bacteria 1272
265 Ga0207704_10445808 3300025938 Bacteria 1032
266 Ga0207665_10748584 3300025939 Bacteria 770
267 Ga0207691_10059043 3300025940 Bacteria 3489
268 Ga0207711_10433409 3300025941 Bacteria 1223
269 Ga0207689_10195272 3300025942 Bacteria 1670
270 Ga0207689_10381068 3300025942 Bacteria 1174
271 Ga0207689_11080240 3300025942 Bacteria 677
272 Ga0207661_10072711 3300025944 Bacteria 2814
273 Ga0207651_10524041 3300025960 Bacteria 1027
274 Ga0207651_10599737 3300025960 Bacteria 962
275 Ga0207712_10042804 3300025961 Bacteria 3121
276 Ga0207668_10011565 3300025972 Bacteria 5369
277 Ga0207668_10036535 3300025972 Bacteria 3279
278 Ga0207640_10188605 3300025981 Bacteria 1552
279 Ga0207658_10019630 3300025986 Bacteria 4675
280 Ga0207658_10133499 3300025986 Bacteria 1998
281 Ga0207658_10520601 3300025986 Bacteria 1061
282 Ga0207677_10679247 3300026023 Bacteria 912
283 Ga0207703_10312000 3300026035 Bacteria 1438
284 Ga0207639_10059578 3300026041 Bacteria 2941
285 Ga0207639_10310459 3300026041 Bacteria 1397
286 Ga0207639_10428115 3300026041 Bacteria 1198
287 Ga0207639_11378831 3300026041 Unclassified 662
288 Ga0207678_10043845 3300026067 Bacteria 3870
289 Ga0207678_10062080 3300026067 Bacteria 3213
290 Ga0207708_10034264 3300026075 Bacteria 3862
291 Ga0207702_11348938 3300026078 Bacteria 707
292 Ga0207648_10029019 3300026089 Bacteria 4905
293 Ga0207648_10555964 3300026089 Bacteria 1054
294 Ga0207648_11302005 3300026089 Bacteria 683
295 Ga0207676_10758153 3300026095 Bacteria 944
296 Ga0207674_10025758 3300026116 Bacteria 6264
297 Ga0207674_10075488 3300026116 Bacteria 3380
298 Ga0207675_100007883 3300026118 Bacteria 10044
299 Ga0207675_100153895 3300026118 Bacteria 2190
300 Ga0207683_10023832 3300026121 Bacteria 5266
301 Ga0207683_11445164 3300026121 Bacteria 635
302 Ga0207698_10068221 3300026142 Bacteria 2807
303 Ga0207698_10364546 3300026142 Bacteria 1369
304 Ga0209983_1111799 3300027665 Bacteria 621
305 Ga0209966_1007342 3300027695 Bacteria 1931
306 Ga0209998_10002125 3300027717 Bacteria 4615
307 Ga0209974_10147440 3300027876 Bacteria 847
308 Ga0207428_10002929 3300027907 Bacteria 16912
309 Ga0207428_10013419 3300027907 Bacteria 7158
310 Ga0207428_10366672 3300027907 Bacteria 1058
311 Ga0268266_10340649 3300028379 Bacteria 1407
312 Ga0268265_10321502 3300028380 Bacteria 1401
313 Ga0268264_10092906 3300028381 Bacteria 2605
314 Ga0268264_10130276 3300028381 Bacteria 2228
315 Ga0265334_10127562 3300028573 Bacteria 907
316 Ga0265325_10000111 3300031241 Bacteria 56612
317 Ga0265340_10109320 3300031247 Bacteria 1279
318 Ga0265313_10014841 3300031595 Bacteria 4578
319 Ga0265342_10110313 3300031712 Bacteria 1558
320 Ga0326468_10024782 3300031889 Bacteria 749
321 Ga0307411_10885634 3300032005 Unclassified 792
322 Ga0316583_10015600 3300032133 Bacteria 2734
323 Ga0373959_0079348 3300034820 Bacteria 754
324 Ga0373934_0024883 3300035086 Bacteria 2316
325 Ga0373934_0162144 3300035086 Bacteria 917
326 Ga0373940_0066972 3300035088 Bacteria 1038
327 Ga0373949_0015866 3300035090 Bacteria 1686
328 Ga0373923_0053279 3300035111 Bacteria 1701
329 Ga0373923_0544991 3300035111 Bacteria 568
330 Ga0373932_0411249 3300035112 Bacteria 525
331 Ga0373936_0563199 3300035113 Bacteria 533
332 Ga0373939_0137759 3300035114 Bacteria 877
333 Ga0373939_0251471 3300035114 Bacteria 688
334 Ga0373953_0000515 3300035117 Bacteria 10752
335 Ga0373953_0080761 3300035117 Bacteria 1351
336 Ga0373954_0156638 3300035118 Bacteria 1114
337 Ga0373956_0212587 3300035119 Bacteria 917
338 Ga0373957_0017341 3300035120 Bacteria 2505
339 Ga0373957_0417031 3300035120 Bacteria 579
340 Ga0373960_0000567 3300035121 Bacteria 7495
341 Ga0373960_0138486 3300035121 Bacteria 822
342 Ga0373946_0614350 3300035171 Bacteria 564
343 Ga0373955_0000935 3300035172 Bacteria 12494
344 Ga0373955_0002497 3300035172 Bacteria 8035
345 Ga0373955_0127713 3300035172 Bacteria 1482
346 Ga0373962_0124422 3300035242 Bacteria 825
347 Ga0373924_0029038 3300035410 Bacteria 2208
348 Ga0373924_0194193 3300035410 Bacteria 894
349 Ga0373924_0379463 3300035410 Bacteria 631
350 Ga0373935_0225458 3300035692 Bacteria 1303
351 Ga0373927_0914494 3300035695 Bacteria 579
352 Ga0373933_0003834 3300035724 Bacteria 8312
353 Ga0373933_0004321 3300035724 Bacteria 7800
354 Ga0373933_0157697 3300035724 Bacteria 1440
355 Ga0373947_0188910 3300035725 Bacteria 1343
356 Ga0373947_0612159 3300035725 Bacteria 742
357 Ga0373937_0002549 3300036401 Bacteria 15130
358 Ga0373937_0006733 3300036401 Bacteria 9913
359 Ga0373937_0040813 3300036401 Bacteria 4231
360 Ga0373937_2071431 3300036401 Bacteria 515
361 Ga0373925_0009863 3300037068 Bacteria 6938
362 Ga0373925_0233103 3300037068 Bacteria 1472
363 Ga0242420_033569 3300038996 Bacteria 960
364 Ga0436365_0715727 3300039437 Bacteria 19952
365 Ga0436365_1454646 3300039437 Bacteria 3447
366 Ga0436360_0387310 3300039438 Bacteria 572
367 Ga0436360_0484691 3300039438 Bacteria 959
368 Ga0436360_1158457 3300039438 Bacteria 3132
369 Ga0436361_0125515 3300039447 Bacteria 958
370 Ga0436361_0611230 3300039447 Bacteria 662
371 Ga0436361_0712226 3300039447 Bacteria 3438
372 Ga0436361_0739197 3300039447 Bacteria 2131
373 Ga0436363_0256476 3300039450 Bacteria 879
374 Ga0436363_1465233 3300039450 Bacteria 2663
375 Ga0436362_0738590 3300039453 Bacteria 2311
376 Ga0451798_0825395 3300041458 Bacteria 654
377 Ga0439448_0104384 3300042005 Bacteria 965
378 Ga0439450_205290 3300042008 Bacteria 528
379 Ga0439463_004637 3300042016 Bacteria 3438
380 Ga0439464_0216626 3300042439 Unclassified 613
381 Ga0450893_0107243 3300042532 Bacteria 574
382 Ga0466966_0138789 3300044684 Bacteria 1486
383 Ga0466961_0127474 3300044693 Bacteria 1596
384 Ga0466961_0175734 3300044693 Bacteria 1331
385 Ga0466961_0549580 3300044693 Bacteria 695
386 Ga0466963_0180345 3300044694 Bacteria 1474
387 Ga0466963_0224108 3300044694 Bacteria 1317
388 Ga0466963_0303331 3300044694 Bacteria 1123
389 Ga0466963_0395441 3300044694 Bacteria 974
390 Ga0466964_0247261 3300044706 Bacteria 878
391 Ga0466971_0029401 3300044719 Bacteria 2458
392 Ga0466971_0325936 3300044719 Bacteria 741
393 Ga0466957_0083977 3300044842 Bacteria 1987
394 Ga0466957_0733159 3300044842 Bacteria 699
395 Ga0466959_0049956 3300045049 Bacteria 3072
396 Ga0466959_0295957 3300045049 Bacteria 1109
397 Ga0466959_0601829 3300045049 Bacteria 739
398 Ga0466958_0208274 3300045836 Bacteria 1245
399 Ga0466958_0675533 3300045836 Bacteria 672
400 Ga0495592_0005373 3300046454 Bacteria 9457
401 Ga0495592_0107047 3300046454 Bacteria 1984
402 Ga0495629_0400674 3300046459 Bacteria 932
403 Ga0495641_0050481 3300046461 Bacteria 1901
404 Ga0495651_0009019 3300046462 Bacteria 7658
405 Ga0495651_0080773 3300046462 Bacteria 2455
406 Ga0495651_0089418 3300046462 Bacteria 2312
407 Ga0495653_0059687 3300046463 Bacteria 2893
408 Ga0495582_0154172 3300046473 Bacteria 1305
409 Ga0495605_0188186 3300046474 Bacteria 905
410 Ga0495639_0309688 3300046475 Bacteria 788
411 Ga0495639_0515043 3300046475 Bacteria 611
412 Ga0495664_0005483 3300046477 Bacteria 6966
413 Ga0495664_0315113 3300046477 Bacteria 944
414 Ga0495608_0002389 3300046511 Bacteria 13497
415 Ga0495608_0134109 3300046511 Bacteria 1583
416 Ga0495618_0008897 3300046514 Bacteria 6058
417 Ga0495618_0078608 3300046514 Bacteria 2103
418 Ga0495618_0554829 3300046514 Bacteria 687
419 Ga0495628_0004506 3300046516 Bacteria 12343
420 Ga0495628_0017653 3300046516 Bacteria 5932
421 Ga0495628_0261457 3300046516 Bacteria 1290
422 Ga0495630_0033154 3300046517 Bacteria 3851
423 Ga0495648_0023867 3300046524 Bacteria 4178
424 Ga0495652_0032767 3300046529 Bacteria 4541
425 Ga0495652_0486397 3300046529 Bacteria 858
426 Ga0495654_0001285 3300046530 Bacteria 17616
427 Ga0495640_0095375 3300046533 Bacteria 1958
428 Ga0495640_0368675 3300046533 Bacteria 884
429 Ga0495640_0484547 3300046533 Bacteria 753
430 Ga0495586_0095242 3300046535 Bacteria 1647
431 Ga0495587_0001017 3300046536 Bacteria 18435
432 Ga0495587_0013961 3300046536 Bacteria 5044
433 Ga0495587_0378746 3300046536 Bacteria 787
434 Ga0495645_0000932 3300046543 Bacteria 19924
435 Ga0495645_0242927 3300046543 Bacteria 1200
436 Ga0495633_0218891 3300046558 Bacteria 872
437 Ga0495667_0001113 3300046559 Bacteria 17493
438 Ga0495667_0001520 3300046559 Bacteria 15331
439 Ga0495667_0729147 3300046559 Bacteria 613
440 Ga0495668_0001806 3300046616 Bacteria 19490
441 Ga0495668_0019378 3300046616 Bacteria 3923
442 Ga0495634_0154067 3300046642 Bacteria 1451
443 Ga0495635_0037065 3300046663 Bacteria 3376
444 Ga0495635_0092805 3300046663 Bacteria 2064
445 Ga0495635_0144256 3300046663 Bacteria 1621
446 Ga0495635_0420048 3300046663 Bacteria 887
447 Ga0495659_0348753 3300046664 Bacteria 632
448 Ga0495657_0012985 3300046675 Bacteria 6164
449 Ga0495657_0107208 3300046675 Bacteria 1773
450 Ga0495657_0483034 3300046675 Bacteria 723
451 Ga0495599_0003792 3300046678 Bacteria 8874
452 Ga0495599_0027606 3300046678 Bacteria 3557
453 Ga0495623_0003669 3300046679 Bacteria 10140
454 Ga0495623_0063436 3300046679 Bacteria 2313
455 Ga0495646_0001795 3300046680 Bacteria 12885
456 Ga0495647_0013168 3300046681 Bacteria 2861
457 Ga0495613_0108352 3300046689 Bacteria 2003
458 Ga0495589_0016208 3300046794 Bacteria 3830
459 Ga0495600_0286081 3300046809 Bacteria 1042
460 Ga0495600_0296149 3300046809 Bacteria 1021
461 Ga0495600_0303223 3300046809 Bacteria 1007
462 Ga0495581_0166522 3300047315 Bacteria 1289
463 Ga0495604_0004240 3300047317 Bacteria 11352
464 Ga0495604_0008164 3300047317 Bacteria 8287
465 Ga0495604_0015159 3300047317 Bacteria 6151
466 Ga0495674_0020799 3300047319 Bacteria 6075
467 Ga0495674_0120687 3300047319 Bacteria 2214
468 Ga0495674_0365981 3300047319 Bacteria 1168
469 Ga0495672_0118439 3300047320 Bacteria 1411
470 Ga0495680_0004269 3300047322 Bacteria 13712
471 Ga0495680_0028252 3300047322 Bacteria 4600
472 Ga0495680_0359431 3300047322 Bacteria 1012
473 Ga0495683_0402474 3300047323 Unclassified 569
474 Ga0495675_0009360 3300047444 Bacteria 6091
475 Ga0495675_0288462 3300047444 Bacteria 977
476 Ga0495685_129129 3300047447 Bacteria 827
477 Ga0495684_0260715 3300047471 Bacteria 1257
478 Ga0495684_0320399 3300047471 Bacteria 1108
479 Ga0495686_0000191 3300047472 Bacteria 114738
480 Ga0495593_0087737 3300047673 Bacteria 1604
481 Ga0495593_0098375 3300047673 Bacteria 1502
482 Ga0495602_0030171 3300048088 Bacteria 5149
483 Ga0495602_0129334 3300048088 Bacteria 2017
484 Ga0495602_0155867 3300048088 Bacteria 1788
485 Ga0495626_0147761 3300048091 Bacteria 993
486 Ga0496101_0039745 3300048904 Bacteria 3347
487 Ga0496102_1380686 3300048905 Bacteria 623
488 Ga0496103_0138696 3300048906 Bacteria 1554
489 Ga0496104_0000082 3300048907 Bacteria 93223
490 Ga0496104_0003695 3300048907 Bacteria 13203
491 Ga0496104_1447577 3300048907 Bacteria 590
492 Ga0496105_0000523 3300048908 Bacteria 25375
493 Ga0496105_0008319 3300048908 Bacteria 8064
494 Ga0496105_0351079 3300048908 Bacteria 1178
495 Ga0496106_0785997 3300048909 Bacteria 755
496 Ga0496107_0183106 3300048910 Bacteria 1555
497 Ga0496107_0200254 3300048910 Bacteria 1484
498 Ga0496107_0552851 3300048910 Bacteria 852
499 Ga0496108_0014474 3300048911 Bacteria 6441
500 Ga0496108_0040499 3300048911 Bacteria 3884
501 Ga0496108_1394297 3300048911 Unclassified 586
502 Ga0496109_0291871 3300048912 Bacteria 1537
503 Ga0496109_0606872 3300048912 Bacteria 1031
504 Ga0496109_1330281 3300048912 Bacteria 654
505 Ga0496110_0598465 3300048913 Bacteria 1000
506 Ga0496111_0154271 3300048914 Bacteria 1704
507 Ga0496111_0371310 3300048914 Bacteria 1058
508 Ga0496111_1083737 3300048914 Bacteria 571
509 Ga0496112_0039469 3300048915 Bacteria 4614
510 Ga0496112_0090900 3300048915 Bacteria 3022
511 Ga0496112_1552558 3300048915 Bacteria 575
512 Ga0496113_0091884 3300048916 Bacteria 2340
513 Ga0496113_0164989 3300048916 Bacteria 1752
514 Ga0496113_1314759 3300048916 Bacteria 562
515 Ga0496114_0013116 3300048917 Bacteria 6640
516 Ga0496114_0211024 3300048917 Bacteria 1703
517 Ga0496115_0043852 3300048918 Bacteria 3566
518 Ga0496115_0681091 3300048918 Bacteria 810
519 Ga0496115_1176071 3300048918 Bacteria 577
520 Ga0496126_0097680 3300048929 Bacteria 2574
521 Ga0496126_0182362 3300048929 Bacteria 1782
522 Ga0495678_044855 3300049459 Bacteria 1747
523 Ga0495678_192648 3300049459 Bacteria 633
524 Ga0501034_0184857 3300049571 Bacteria 2048
525 Ga0501034_1032195 3300049571 Bacteria 705
526 Ga0501036_0807392 3300049572 Bacteria 772
527 Ga0501042_1191870 3300049578 Bacteria 555
528 Ga0501048_0399950 3300049582 Bacteria 982
529 Ga0501048_1238404 3300049582 Bacteria 537
530 Ga0501067_0089936 3300049583 Bacteria 1704
531 Ga0501067_0608657 3300049583 Bacteria 613
532 Ga0501067_0707708 3300049583 Bacteria 566
533 Ga0501070_0550640 3300049586 Bacteria 923
534 Ga0501070_1268902 3300049586 Unclassified 563
535 Ga0501073_0012330 3300049589 Bacteria 6237
536 Ga0501074_0059998 3300049590 Bacteria 2740
537 Ga0501075_0991017 3300049591 Bacteria 639
538 Ga0501076_1120608 3300049592 Bacteria 648
539 Ga0501079_0328675 3300049741 Bacteria 1197
540 Ga0501080_0077568 3300049742 Bacteria 3090
541 Ga0501267_040700 3300049764 Bacteria 578
542 nmdc:mga0yw44_937246_c1 3300050492 Archaea 587
543 nmdc:mga06z11_361804_c1 3300050494 Unclassified 870
544 nmdc:mga06z11_985433_c1 3300050494 Unclassified 514
545 nmdc:mga05p37_743_c1 3300050507 Bacteria 36122
546 nmdc:mga09592_781_c1 3300050508 Bacteria 24612
547 nmdc:mga0qj67_72223_c1 3300050509 Bacteria 2755
548 nmdc:mga06r32_19037_c1 3300050510 Bacteria 6295
549 nmdc:mga08y16_121_c1 3300050511 Bacteria 67325
550 nmdc:mga08y16_231593_c1 3300050511 Bacteria 1911
551 nmdc:mga0rr50_1336407_c1 3300050513 Bacteria 607
552 nmdc:mga08x19_7066_c1 3300050514 Bacteria 6664
553 nmdc:mga08x19_835191_c1 3300050514 Bacteria 654
554 Ga0495601_0000093 3300053077 Bacteria 48759
555 Ga0495601_0002865 3300053077 Bacteria 9804
556 Ga0495601_0005661 3300053077 Bacteria 7287
557 Ga0495601_0076887 3300053077 Bacteria 2138
558 Ga0495612_0003613 3300053078 Bacteria 6416
559 Ga0495612_0007797 3300053078 Bacteria 4369
560 Ga0495612_0206933 3300053078 Bacteria 866
561 Ga0495595_0001871 3300053084 Bacteria 8168
562 Ga0495595_0003671 3300053084 Bacteria 6100
563 Ga0495595_0043949 3300053084 Bacteria 2051
564 Ga0495619_0000560 3300053085 Bacteria 24582
565 Ga0495619_0003604 3300053085 Bacteria 9975
566 Ga0495619_0004844 3300053085 Bacteria 8542
567 Ga0495619_0428707 3300053085 Bacteria 912
568 Ga0495619_0743924 3300053085 Bacteria 665
569 Ga0500641_0015101 3300053096 Bacteria 2859
570 Ga0500559_0128898 3300053136 Bacteria 1181
571 Ga0500573_0519667 3300053140 Bacteria 534
572 Ga0500604_0054613 3300053151 Bacteria 1240
573 Ga0500604_0100894 3300053151 Bacteria 951
574 Ga0500616_0000048 3300053153 Bacteria 313108
575 Ga0500616_0011949 3300053153 Bacteria 5103
576 Ga0500627_0000173 3300053158 Bacteria 19050
577 Ga0500645_131636 3300053730 Unclassified 695
578 Ga0501084_0152107 3300054114 Bacteria 1951
579 Ga0501082_0961314 3300060353 Bacteria 747
580 Ga0466962_0193196 3300061719 Bacteria 993
581 Ga0530510_1306418 3300061734 Unclassified 556
582 2842696060 2842694124 Bacteria 4063419
583 Ga0439455_0092959
584 2214773013
585 ARcpr5oldR_c000171
586 ARSoilYngRDRAFT_c00211
587 ARcpr5yngRDRAFT_c000814
588 ARSoilOldRDRAFT_c000112
589 ARCol0oldRDRAFT_c01383
590 ARCol0yngRDRAFT_1000085
591 JGI24737J22298_10021052
592 rootL2_10087348
593 JGI26129J50193_1003047
594 Ga0065165_1031957
595 Ga0065717_1002296
596 Ga0065704_10078466
597 Ga0065712_10131439
598 Ga0065715_10097811
599 Ga0070658_10170513
600 Ga0070658_10255537
601 Ga0070676_10031589
602 Ga0070676_10411036
603 Ga0070683_100099235
604 Ga0070683_100920153
605 Ga0070683_101197948
606 Ga0070690_100040116
607 Ga0070690_100188520
608 Ga0070677_10657789
609 Ga0068869_100208199
610 Ga0070666_10257864
611 Ga0070666_10326191
612 Ga0070680_100063235
613 Ga0070680_100190586
614 Ga0070680_101064404
615 Ga0070682_100099002
616 Ga0070682_100178170
617 Ga0068868_100824354
618 Ga0070660_100065569
619 Ga0070689_100005831
620 Ga0070691_10117351
621 Ga0070661_100021630
622 Ga0070661_100880848
623 Ga0070668_100088678
624 Ga0070669_100350227
625 Ga0070671_100199062
626 Ga0070671_101783662
627 Ga0070673_100057115
628 Ga0070688_100001610
629 Ga0070659_100035422
630 Ga0070659_101592496
631 Ga0070667_100060355
632 Ga0070667_100061378
633 Ga0070667_100199885
634 Ga0070667_102154278
635 Ga0070703_10305507
636 Ga0070709_10300899
637 Ga0070714_100017661
638 Ga0070714_100729336
639 Ga0070713_100768114
640 Ga0070713_101611628
641 Ga0070710_10045394
642 Ga0070701_10102615
643 Ga0070711_100124668
644 Ga0070711_100178473
645 Ga0070700_100154817
646 Ga0070694_100008881
647 Ga0070708_100209889
648 Ga0070663_100051430
649 Ga0070663_100169488
650 Ga0070678_100062498
651 Ga0070678_101480486
652 Ga0070662_100039749
653 Ga0070681_10148173
654 Ga0070681_10163567
655 Ga0068867_100058171
656 Ga0068867_100162337
657 Ga0070685_10933265
658 Ga0074259_10613507
659 Ga0070679_100107363
660 Ga0070679_100127395
661 Ga0070679_100264061
662 Ga0070684_101006270
663 Ga0068853_100293280
664 Ga0068853_101118506
665 Ga0070672_100179920
666 Ga0070672_100217239
667 Ga0070686_100061512
668 Ga0070686_100208704
669 Ga0070686_100344441
670 Ga0070695_100066079
671 Ga0070695_100222113
672 Ga0070695_101235292
673 Ga0070696_100078781
674 Ga0070696_100124424
675 Ga0070693_100077708
676 Ga0070665_100041354
677 Ga0070665_100364649
678 Ga0070665_101370281
679 Ga0070704_100018235
680 Ga0068855_101933881
681 Ga0068857_100070306
682 Ga0068857_100074126
683 Ga0068854_100120557
684 Ga0068856_100046761
685 Ga0068856_101254721
686 Ga0068852_100065257
687 Ga0068852_100178850
688 Ga0068852_100865519
689 Ga0068859_101726036
690 Ga0068861_100000005
691 Ga0068861_100040717
692 Ga0068861_102532136
693 Ga0068863_100689691
694 Ga0068863_101896829
695 Ga0068858_100177288
696 Ga0068858_100257402
697 Ga0068858_100319941
698 Ga0068860_100052798
699 Ga0068860_100144431
700 Ga0068862_100014295
701 Ga0068862_102362734
702 Ga0081455_10000402
703 Ga0070717_10228373
704 Ga0075365_10596481
705 Ga0075364_10645996
706 Ga0075432_10256946
707 Ga0070715_10064253
708 Ga0070716_100041247
709 Ga0070712_100161850
710 Ga0070712_100549835
711 Ga0070712_100567465
712 Ga0075362_10284603
713 Ga0075366_10341856
714 Ga0097621_100059443
715 Ga0068871_100700863
716 Ga0075428_100017415
717 Ga0075430_100079159
718 Ga0075431_100001907
719 Ga0075433_10297186
720 Ga0075429_100005227
721 Ga0068865_100025384
722 Ga0068865_100039636
723 Ga0068865_100686865
724 Ga0075436_100015037
725 Ga0097620_101726011
726 Ga0105240_10049938
727 Ga0105240_10067085
728 Ga0105240_11179316
729 Ga0111539_10000178
730 Ga0111539_10301817
731 Ga0105245_10060390
732 Ga0105245_10089408
733 Ga0105247_10736560
734 Ga0114129_10001129
735 Ga0105243_10218351
736 Ga0105243_10226173
737 Ga0105243_10575139
738 Ga0105241_10207847
739 Ga0105241_10636223
740 Ga0105242_10225370
741 Ga0105248_10027318
742 Ga0105248_10196268
743 Ga0105248_10301432
744 Ga0105237_10253508
745 Ga0105237_10409577
746 Ga0105237_11354458
747 Ga0105238_10045055
748 Ga0105238_10514280
749 Ga0105238_12003596
750 Ga0105238_12423291
751 Ga0105249_10080022
752 Ga0105249_12436889
753 Ga0105239_10331800
754 Ga0105239_13059369
755 Ga0105246_10237409
756 Ga0105246_10815102
757 Ga0157317_1026832
758 Ga0157335_1020068
759 Ga0157319_1026072
760 Ga0157373_10273605
761 Ga0157370_10168577
762 Ga0157370_10384026
763 Ga0157374_10222449
764 Ga0157374_11436233
765 Ga0157374_11446845
766 Ga0157378_10062209
767 Ga0157378_10106188
768 Ga0157378_10239381
769 Ga0163162_10972859
770 Ga0157372_10653559
771 Ga0157372_11047487
772 Ga0157375_10439688
773 Ga0157375_10844040
774 Ga0163163_10006271
775 Ga0163163_11139609
776 Ga0157380_10591893
777 Ga0157380_11053681
778 Ga0157379_10033583
779 Ga0157379_10036586
780 Ga0157379_10683260
781 Ga0157379_11676891
782 Ga0157376_10046644
783 Ga0206356_11696749
784 Ga0206354_10654248
785 Ga0213872_10030244
786 Ga0213872_10135206
787 Ga0213872_10406142
788 Ga0213874_10309465
789 Ga0213876_10000891
790 Ga0213876_10032844
791 Ga0207666_1001648
792 Ga0207697_10024807
793 Ga0207692_10003250
794 Ga0207692_10078229
795 Ga0207642_10993770
796 Ga0207688_10151522
797 Ga0207680_10557334
798 Ga0207680_10563803
799 Ga0207647_10339497
800 Ga0207699_10017650
801 Ga0207699_10106329
802 Ga0207645_10060131
803 Ga0207645_10066619
804 Ga0207645_10413333
805 Ga0207705_10561464
806 Ga0207705_10633388
807 Ga0207654_10819398
808 Ga0207707_10067659
809 Ga0207707_10227636
810 Ga0207695_10949630
811 Ga0207695_11233323
812 Ga0207671_10530198
813 Ga0207671_10772377
814 Ga0207693_10013584
815 Ga0207663_10040652
816 Ga0207660_10129298
817 Ga0207660_10994550
818 Ga0207662_10011583
819 Ga0207662_10224299
820 Ga0207657_10020994
821 Ga0207657_10036666
822 Ga0207649_10736143
823 Ga0207652_10048783
824 Ga0207652_10739342
825 Ga0207652_11092554
826 Ga0207646_10133652
827 Ga0207681_11273071
828 Ga0207694_10163412
829 Ga0207694_10280162
830 Ga0207687_10029819
831 Ga0207700_10040659
832 Ga0207664_10441703
833 Ga0207644_10366195
834 Ga0207690_10277569
835 Ga0207690_11325387
836 Ga0207706_10002762
837 Ga0207706_10041895
838 Ga0207706_10080377
839 Ga0207686_10159514
840 Ga0207686_10751537
841 Ga0207709_10008740
842 Ga0207709_10709872
843 Ga0207670_10196079
844 Ga0207670_10284406
845 Ga0207669_10285484
846 Ga0207704_10277400
847 Ga0207704_10445808
848 Ga0207665_10748584
849 Ga0207691_10059043
850 Ga0207711_10433409
851 Ga0207689_10195272
852 Ga0207689_10381068
853 Ga0207689_11080240
854 Ga0207661_10072711
855 Ga0207651_10524041
856 Ga0207651_10599737
857 Ga0207712_10042804
858 Ga0207668_10011565
859 Ga0207668_10036535
860 Ga0207640_10188605
861 Ga0207658_10019630
862 Ga0207658_10133499
863 Ga0207658_10520601
864 Ga0207677_10679247
865 Ga0207703_10312000
866 Ga0207639_10059578
867 Ga0207639_10310459
868 Ga0207639_10428115
869 Ga0207639_11378831
870 Ga0207678_10043845
871 Ga0207678_10062080
872 Ga0207708_10034264
873 Ga0207702_11348938
874 Ga0207648_10029019
875 Ga0207648_10555964
876 Ga0207648_11302005
877 Ga0207676_10758153
878 Ga0207674_10025758
879 Ga0207674_10075488
880 Ga0207675_100007883
881 Ga0207675_100153895
882 Ga0207683_10023832
883 Ga0207683_11445164
884 Ga0207698_10068221
885 Ga0207698_10364546
886 Ga0209983_1111799
887 Ga0209966_1007342
888 Ga0209998_10002125
889 Ga0209974_10147440
890 Ga0207428_10002929
891 Ga0207428_10013419
892 Ga0207428_10366672
893 Ga0268266_10340649
894 Ga0268265_10321502
895 Ga0268264_10092906
896 Ga0268264_10130276
897 Ga0265334_10127562
898 Ga0265325_10000111
899 Ga0265340_10109320
900 Ga0265313_10014841
901 Ga0265342_10110313
902 Ga0326468_10024782
903 Ga0307411_10885634
904 Ga0316583_10015600
905 Ga0373959_0079348
906 Ga0373934_0024883
907 Ga0373934_0162144
908 Ga0373940_0066972
909 Ga0373949_0015866
910 Ga0373923_0053279
911 Ga0373923_0544991
912 Ga0373932_0411249
913 Ga0373936_0563199
914 Ga0373939_0137759
915 Ga0373939_0251471
916 Ga0373953_0000515
917 Ga0373953_0080761
918 Ga0373954_0156638
919 Ga0373956_0212587
920 Ga0373957_0017341
921 Ga0373957_0417031
922 Ga0373960_0000567
923 Ga0373960_0138486
924 Ga0373946_0614350
925 Ga0373955_0000935
926 Ga0373955_0002497
927 Ga0373955_0127713
928 Ga0373962_0124422
929 Ga0373924_0029038
930 Ga0373924_0194193
931 Ga0373924_0379463
932 Ga0373935_0225458
933 Ga0373927_0914494
934 Ga0373933_0003834
935 Ga0373933_0004321
936 Ga0373933_0157697
937 Ga0373947_0188910
938 Ga0373947_0612159
939 Ga0373937_0002549
940 Ga0373937_0006733
941 Ga0373937_0040813
942 Ga0373937_2071431
943 Ga0373925_0009863
944 Ga0373925_0233103
945 Ga0242420_033569
946 Ga0436365_0715727
947 Ga0436365_1454646
948 Ga0436360_0387310
949 Ga0436360_0484691
950 Ga0436360_1158457
951 Ga0436361_0125515
952 Ga0436361_0611230
953 Ga0436361_0712226
954 Ga0436361_0739197
955 Ga0436363_0256476
956 Ga0436363_1465233
957 Ga0436362_0738590
958 Ga0451798_0825395
959 Ga0439448_0104384
960 Ga0439450_205290
961 Ga0439463_004637
962 Ga0439464_0216626
963 Ga0450893_0107243
964 Ga0466966_0138789
965 Ga0466961_0127474
966 Ga0466961_0175734
967 Ga0466961_0549580
968 Ga0466963_0180345
969 Ga0466963_0224108
970 Ga0466963_0303331
971 Ga0466963_0395441
972 Ga0466964_0247261
973 Ga0466971_0029401
974 Ga0466971_0325936
975 Ga0466957_0083977
976 Ga0466957_0733159
977 Ga0466959_0049956
978 Ga0466959_0295957
979 Ga0466959_0601829
980 Ga0466958_0208274
981 Ga0466958_0675533
982 Ga0495592_0005373
983 Ga0495592_0107047
984 Ga0495629_0400674
985 Ga0495641_0050481
986 Ga0495651_0009019
987 Ga0495651_0080773
988 Ga0495651_0089418
989 Ga0495653_0059687
990 Ga0495582_0154172
991 Ga0495605_0188186
992 Ga0495639_0309688
993 Ga0495639_0515043
994 Ga0495664_0005483
995 Ga0495664_0315113
996 Ga0495608_0002389
997 Ga0495608_0134109
998 Ga0495618_0008897
999 Ga0495618_0078608
1000 Ga0495618_0554829
1001 Ga0495628_0004506
1002 Ga0495628_0017653
1003 Ga0495628_0261457
1004 Ga0495630_0033154
1005 Ga0495648_0023867
1006 Ga0495652_0032767
1007 Ga0495652_0486397
1008 Ga0495654_0001285
1009 Ga0495640_0095375
1010 Ga0495640_0368675
1011 Ga0495640_0484547
1012 Ga0495586_0095242
1013 Ga0495587_0001017
1014 Ga0495587_0013961
1015 Ga0495587_0378746
1016 Ga0495645_0000932
1017 Ga0495645_0242927
1018 Ga0495633_0218891
1019 Ga0495667_0001113
1020 Ga0495667_0001520
1021 Ga0495667_0729147
1022 Ga0495668_0001806
1023 Ga0495668_0019378
1024 Ga0495634_0154067
1025 Ga0495635_0037065
1026 Ga0495635_0092805
1027 Ga0495635_0144256
1028 Ga0495635_0420048
1029 Ga0495659_0348753
1030 Ga0495657_0012985
1031 Ga0495657_0107208
1032 Ga0495657_0483034
1033 Ga0495599_0003792
1034 Ga0495599_0027606
1035 Ga0495623_0003669
1036 Ga0495623_0063436
1037 Ga0495646_0001795
1038 Ga0495647_0013168
1039 Ga0495613_0108352
1040 Ga0495589_0016208
1041 Ga0495600_0286081
1042 Ga0495600_0296149
1043 Ga0495600_0303223
1044 Ga0495581_0166522
1045 Ga0495604_0004240
1046 Ga0495604_0008164
1047 Ga0495604_0015159
1048 Ga0495674_0020799
1049 Ga0495674_0120687
1050 Ga0495674_0365981
1051 Ga0495672_0118439
1052 Ga0495680_0004269
1053 Ga0495680_0028252
1054 Ga0495680_0359431
1055 Ga0495683_0402474
1056 Ga0495675_0009360
1057 Ga0495675_0288462
1058 Ga0495685_129129
1059 Ga0495684_0260715
1060 Ga0495684_0320399
1061 Ga0495686_0000191
1062 Ga0495593_0087737
1063 Ga0495593_0098375
1064 Ga0495602_0030171
1065 Ga0495602_0129334
1066 Ga0495602_0155867
1067 Ga0495626_0147761
1068 Ga0496101_0039745
1069 Ga0496102_1380686
1070 Ga0496103_0138696
1071 Ga0496104_0000082
1072 Ga0496104_0003695
1073 Ga0496104_1447577
1074 Ga0496105_0000523
1075 Ga0496105_0008319
1076 Ga0496105_0351079
1077 Ga0496106_0785997
1078 Ga0496107_0183106
1079 Ga0496107_0200254
1080 Ga0496107_0552851
1081 Ga0496108_0014474
1082 Ga0496108_0040499
1083 Ga0496108_1394297
1084 Ga0496109_0291871
1085 Ga0496109_0606872
1086 Ga0496109_1330281
1087 Ga0496110_0598465
1088 Ga0496111_0154271
1089 Ga0496111_0371310
1090 Ga0496111_1083737
1091 Ga0496112_0039469
1092 Ga0496112_0090900
1093 Ga0496112_1552558
1094 Ga0496113_0091884
1095 Ga0496113_0164989
1096 Ga0496113_1314759
1097 Ga0496114_0013116
1098 Ga0496114_0211024
1099 Ga0496115_0043852
1100 Ga0496115_0681091
1101 Ga0496115_1176071
1102 Ga0496126_0097680
1103 Ga0496126_0182362
1104 Ga0495678_044855
1105 Ga0495678_192648
1106 Ga0501034_0184857
1107 Ga0501034_1032195
1108 Ga0501036_0807392
1109 Ga0501042_1191870
1110 Ga0501048_0399950
1111 Ga0501048_1238404
1112 Ga0501067_0089936
1113 Ga0501067_0608657
1114 Ga0501067_0707708
1115 Ga0501070_0550640
1116 Ga0501070_1268902
1117 Ga0501073_0012330
1118 Ga0501074_0059998
1119 Ga0501075_0991017
1120 Ga0501076_1120608
1121 Ga0501079_0328675
1122 Ga0501080_0077568
1123 Ga0501267_040700
1124 nmdc:mga0yw44_937246_c1
1125 nmdc:mga06z11_361804_c1
1126 nmdc:mga06z11_985433_c1
1127 nmdc:mga05p37_743_c1
1128 nmdc:mga09592_781_c1
1129 nmdc:mga0qj67_72223_c1
1130 nmdc:mga06r32_19037_c1
1131 nmdc:mga08y16_121_c1
1132 nmdc:mga08y16_231593_c1
1133 nmdc:mga0rr50_1336407_c1
1134 nmdc:mga08x19_7066_c1
1135 nmdc:mga08x19_835191_c1
1136 Ga0495601_0000093
1137 Ga0495601_0002865
1138 Ga0495601_0005661
1139 Ga0495601_0076887
1140 Ga0495612_0003613
1141 Ga0495612_0007797
1142 Ga0495612_0206933
1143 Ga0495595_0001871
1144 Ga0495595_0003671
1145 Ga0495595_0043949
1146 Ga0495619_0000560
1147 Ga0495619_0003604
1148 Ga0495619_0004844
1149 Ga0495619_0428707
1150 Ga0495619_0743924
1151 Ga0500641_0015101
1152 Ga0500559_0128898
1153 Ga0500573_0519667
1154 Ga0500604_0054613
1155 Ga0500604_0100894
1156 Ga0500616_0000048
1157 Ga0500616_0011949
1158 Ga0500627_0000173
1159 Ga0500645_131636
1160 Ga0501084_0152107
1161 Ga0501082_0961314
1162 Ga0466962_0193196
1163 Ga0530510_1306418
1164 2842696060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04325

DUF465

Protein of unknown function (DUF465)

25

71

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dmp-assembly1.cif.gz_A de novo design of a protein heterodimer with specificity mediated by hydrogen bond networks 0.9453 4 61
5iea-assembly1.cif.gz_B trim5 b-box2 and coiled-coil chimera 0.9427 4 63
5nfd-assembly2.cif.gz_B antiparallel monomeric coiled coil of kif21a 0.9291 3 64
6dkm-assembly3.cif.gz_F dhd131 0.9259 3 62
6v1v-assembly1.cif.gz_C vip3b (vip3b_2160) adapted for crystallization 0.9206 6 62
ID Description Score Start End Superfamily
af_O13816_119_876_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9898 9 64 1.25.10.10
af_P76235_3_421_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.977 14 58 3.40.50.410
af_Q2G2S2_1_125_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9759 9 64 1.10.287.1490
af_P40541_155_1063_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9723 9 62 1.25.10.10
af_Q58358_1_191_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9647 4 62 1.10.287.1490
ID Description Score Start End GO Terms
AF-A0A3E0PNV3-F1-model_v4 DUF4349 domain-containing protein 1.004 4 62 GO:0016020
AF-A0A6B0YTX4-F1-model_v4 DUF4349 domain-containing protein 1 3 62 GO:0016020
AF-A0A6B1FZU1-F1-model_v4 DUF4349 domain-containing protein 0.9998 3 62 GO:0016020
AF-A0A523EYQ2-F1-model_v4 deleted 0.9997 4 62
AF-A0A1G8HKZ1-F1-model_v4 DUF465 domain-containing protein 0.9996 4 62

Map