F466072

General Info

Members Datasets Scaffolds Average Seq Length
581 259 1162 116

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10187249|Ga0105249_101872494
Length 132
Sequence MRQMTPPHRQRTKGSSMSEQAVHDWIRKAVASNDVVLFMKGTKSFPQCGFSAQVGQILGHMGVDYKDVNVLEDMGIREGIKSFSQWPTIPQLYVKGEFVGGCDIIREMFQQGELQQLFDDKGVAYDRAKMTA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
91 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
92 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
93 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
94 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
152 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
153 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
154 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 1.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.79
Nodule 0
Rhizoplane 7.92
Rhizosphere 87.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10187249 3300009553 Bacteria 2018
2 ARSoilOldRDRAFT_c024625 3300000044 Bacteria 542
3 JGI25404J52841_10035903 3300003659 Bacteria 1055
4 JGI25405J52794_10062122 3300003911 Bacteria 809
5 Ga0058859_11730514 3300004798 Bacteria 500
6 Ga0058860_12127454 3300004801 Bacteria 658
7 Ga0070676_10206185 3300005328 Bacteria 1291
8 Ga0070690_101559172 3300005330 Bacteria 535
9 Ga0070677_10231850 3300005333 Bacteria 907
10 Ga0068869_100304545 3300005334 Bacteria 1288
11 Ga0068869_100875147 3300005334 Bacteria 776
12 Ga0070680_100005357 3300005336 Bacteria 9705
13 Ga0070680_100612636 3300005336 Bacteria 935
14 Ga0070682_100885626 3300005337 Bacteria 732
15 Ga0070689_100495601 3300005340 Bacteria 1046
16 Ga0070689_100575658 3300005340 Bacteria 973
17 Ga0070691_10011721 3300005341 Bacteria 4010
18 Ga0070687_100135784 3300005343 Bacteria 1426
19 Ga0070661_100934835 3300005344 Bacteria 717
20 Ga0070692_10956293 3300005345 Bacteria 596
21 Ga0070668_100366703 3300005347 Bacteria 1222
22 Ga0070669_100550375 3300005353 Bacteria 962
23 Ga0070669_101043242 3300005353 Bacteria 703
24 Ga0070669_101251950 3300005353 Bacteria 642
25 Ga0070669_101923422 3300005353 Bacteria 517
26 Ga0070675_100182317 3300005354 Bacteria 1816
27 Ga0070671_101189806 3300005355 Bacteria 671
28 Ga0070674_101158652 3300005356 Bacteria 685
29 Ga0070688_100850012 3300005365 Bacteria 717
30 Ga0070667_100320517 3300005367 Bacteria 1398
31 Ga0070703_10003770 3300005406 Bacteria 4290
32 Ga0070703_10482079 3300005406 Bacteria 555
33 Ga0070701_10015576 3300005438 Bacteria 3515
34 Ga0070705_100000057 3300005440 Bacteria 58275
35 Ga0070700_100002470 3300005441 Bacteria 9399
36 Ga0070700_100027631 3300005441 Bacteria 3366
37 Ga0070700_100793388 3300005441 Bacteria 762
38 Ga0070700_101150710 3300005441 Bacteria 646
39 Ga0070700_101361112 3300005441 Bacteria 599
40 Ga0070694_100002273 3300005444 Bacteria 11355
41 Ga0070694_100097640 3300005444 Bacteria 2073
42 Ga0070694_100171258 3300005444 Bacteria 1600
43 Ga0070694_101340155 3300005444 Bacteria 603
44 Ga0070708_100125826 3300005445 Bacteria 2369
45 Ga0070708_100282071 3300005445 Bacteria 1563
46 Ga0070708_101522969 3300005445 Bacteria 623
47 Ga0070708_101913366 3300005445 Bacteria 550
48 Ga0070663_100012775 3300005455 Bacteria 5326
49 Ga0070663_100881652 3300005455 Bacteria 772
50 Ga0070678_101938379 3300005456 Bacteria 557
51 Ga0070681_10096710 3300005458 Bacteria 2901
52 Ga0070706_100091438 3300005467 Bacteria 2822
53 Ga0070706_100457831 3300005467 Bacteria 1187
54 Ga0070707_100324269 3300005468 Bacteria 1497
55 Ga0070698_100155582 3300005471 Bacteria 2231
56 Ga0070698_100197477 3300005471 Bacteria 1948
57 Ga0070699_100003065 3300005518 Bacteria 14821
58 Ga0070697_100014553 3300005536 Bacteria 6179
59 Ga0068853_102036012 3300005539 Bacteria 557
60 Ga0070695_100006256 3300005545 Bacteria 7031
61 Ga0070695_100034406 3300005545 Bacteria 3176
62 Ga0070695_100065339 3300005545 Bacteria 2369
63 Ga0070696_100000250 3300005546 Bacteria 32363
64 Ga0070696_100703904 3300005546 Bacteria 824
65 Ga0070693_100226483 3300005547 Bacteria 1228
66 Ga0070665_102196021 3300005548 Bacteria 556
67 Ga0070704_100003249 3300005549 Bacteria 9289
68 Ga0070704_100072808 3300005549 Bacteria 2501
69 Ga0070704_100113334 3300005549 Bacteria 2067
70 Ga0070704_100183282 3300005549 Bacteria 1677
71 Ga0070664_101218825 3300005564 Bacteria 710
72 Ga0070664_101291498 3300005564 Bacteria 689
73 Ga0068857_100048952 3300005577 Bacteria 3750
74 Ga0068854_100122396 3300005578 Bacteria 1977
75 Ga0068854_100581478 3300005578 Bacteria 954
76 Ga0070702_100054132 3300005615 Bacteria 2307
77 Ga0070702_100081105 3300005615 Bacteria 1943
78 Ga0068859_100072659 3300005617 Bacteria 3477
79 Ga0068859_100496886 3300005617 Bacteria 1315
80 Ga0068859_100910727 3300005617 Bacteria 964
81 Ga0068864_100057255 3300005618 Bacteria 3367
82 Ga0068861_100037645 3300005719 Bacteria 3596
83 Ga0068861_100058898 3300005719 Bacteria 2939
84 Ga0068861_100290678 3300005719 Bacteria 1411
85 Ga0068861_100571388 3300005719 Bacteria 1033
86 Ga0068861_101441495 3300005719 Bacteria 674
87 Ga0068870_10166139 3300005840 Bacteria 1313
88 Ga0068863_100685457 3300005841 Bacteria 1018
89 Ga0068858_100106570 3300005842 Bacteria 2616
90 Ga0068860_100001351 3300005843 Bacteria 26648
91 Ga0068860_100307635 3300005843 Bacteria 1554
92 Ga0068860_100446289 3300005843 Bacteria 1286
93 Ga0068860_101569956 3300005843 Bacteria 680
94 Ga0068862_100003675 3300005844 Bacteria 13119
95 Ga0068862_100039031 3300005844 Bacteria 4031
96 Ga0068862_100929022 3300005844 Bacteria 857
97 Ga0081455_10000206 3300005937 Bacteria 75450
98 Ga0081455_10008046 3300005937 Bacteria 11013
99 Ga0081455_10459961 3300005937 Bacteria 867
100 Ga0081540_1000056 3300005983 Bacteria 122552
101 Ga0081539_10258001 3300005985 Bacteria 771
102 Ga0081539_10270425 3300005985 Bacteria 745
103 Ga0070717_10389486 3300006028 Bacteria 1250
104 Ga0075365_10038559 3300006038 Bacteria 3107
105 Ga0075368_10000337 3300006042 Bacteria 13784
106 Ga0075368_10006002 3300006042 Bacteria 4214
107 Ga0075363_100026204 3300006048 Bacteria 2980
108 Ga0075363_100039888 3300006048 Bacteria 2474
109 Ga0075364_10007379 3300006051 Bacteria 6525
110 Ga0075432_10038045 3300006058 Bacteria 1676
111 Ga0075362_10198056 3300006177 Bacteria 977
112 Ga0075367_10000532 3300006178 Bacteria 14389
113 Ga0075427_10019394 3300006194 Bacteria 1072
114 Ga0068871_100667489 3300006358 Bacteria 950
115 Ga0068871_101891409 3300006358 Bacteria 567
116 Ga0075428_100023618 3300006844 Bacteria 6806
117 Ga0075428_100040783 3300006844 Bacteria 5106
118 Ga0075428_100134358 3300006844 Bacteria 2690
119 Ga0075428_100214944 3300006844 Bacteria 2077
120 Ga0075428_100350066 3300006844 Bacteria 1585
121 Ga0075428_100399542 3300006844 Bacteria 1473
122 Ga0075428_101267430 3300006844 Bacteria 776
123 Ga0075430_100058810 3300006846 Bacteria 3231
124 Ga0075430_100221426 3300006846 Bacteria 1570
125 Ga0075430_100293032 3300006846 Bacteria 1346
126 Ga0075430_100981559 3300006846 Bacteria 696
127 Ga0075431_100001516 3300006847 Bacteria 21529
128 Ga0075431_100036574 3300006847 Bacteria 5057
129 Ga0075431_100102189 3300006847 Bacteria 2958
130 Ga0075431_100140639 3300006847 Bacteria 2488
131 Ga0075431_100158030 3300006847 Bacteria 2332
132 Ga0075431_100188648 3300006847 Bacteria 2113
133 Ga0075431_100765589 3300006847 Bacteria 940
134 Ga0075431_100854903 3300006847 Bacteria 881
135 Ga0075431_101001579 3300006847 Bacteria 802
136 Ga0075433_10005400 3300006852 Bacteria 10043
137 Ga0075433_11714619 3300006852 Bacteria 541
138 Ga0075434_100028601 3300006871 Bacteria 5479
139 Ga0075434_100124950 3300006871 Bacteria 2590
140 Ga0075434_100419260 3300006871 Bacteria 1360
141 Ga0075434_101553289 3300006871 Bacteria 671
142 Ga0075434_101939277 3300006871 Bacteria 595
143 Ga0075434_101955447 3300006871 Bacteria 592
144 Ga0075429_100014311 3300006880 Bacteria 6881
145 Ga0075429_100037548 3300006880 Bacteria 4216
146 Ga0075429_100065346 3300006880 Bacteria 3167
147 Ga0075429_100087244 3300006880 Bacteria 2719
148 Ga0075429_100380753 3300006880 Bacteria 1235
149 Ga0075429_100631232 3300006880 Bacteria 938
150 Ga0068865_101663872 3300006881 Bacteria 575
151 Ga0075436_100596250 3300006914 Bacteria 814
152 Ga0097620_100072657 3300006931 Bacteria 3477
153 Ga0097620_100496857 3300006931 Bacteria 1315
154 Ga0097620_100910818 3300006931 Bacteria 964
155 Ga0075435_100619922 3300007076 Bacteria 938
156 Ga0099795_10014280 3300007788 Bacteria 2459
157 Ga0111539_10017956 3300009094 Bacteria 8762
158 Ga0111539_10154825 3300009094 Bacteria 2682
159 Ga0111539_10158307 3300009094 Bacteria 2650
160 Ga0111539_10293353 3300009094 Bacteria 1892
161 Ga0111539_10519324 3300009094 Bacteria 1387
162 Ga0111539_10668920 3300009094 Bacteria 1209
163 Ga0111539_10862606 3300009094 Bacteria 1053
164 Ga0111539_11015707 3300009094 Bacteria 964
165 Ga0105245_10666563 3300009098 Bacteria 1071
166 Ga0114129_10051143 3300009147 Bacteria 5802
167 Ga0114129_10132408 3300009147 Bacteria 3423
168 Ga0114129_10134520 3300009147 Bacteria 3393
169 Ga0114129_10373284 3300009147 Bacteria 1885
170 Ga0114129_10406549 3300009147 Bacteria 1793
171 Ga0114129_10586687 3300009147 Bacteria 1446
172 Ga0114129_10780578 3300009147 Bacteria 1221
173 Ga0114129_11246331 3300009147 Bacteria 924
174 Ga0114129_13077024 3300009147 Bacteria 546
175 Ga0105243_11095901 3300009148 Bacteria 804
176 Ga0105241_10002335 3300009174 Bacteria 14254
177 Ga0105241_10207559 3300009174 Bacteria 1640
178 Ga0105242_11812250 3300009176 Bacteria 649
179 Ga0105248_10458194 3300009177 Bacteria 1437
180 Ga0105248_11859359 3300009177 Bacteria 683
181 Ga0105249_10024372 3300009553 Bacteria 5438
182 Ga0105249_10589418 3300009553 Bacteria 1165
183 Ga0105249_11329799 3300009553 Bacteria 790
184 Ga0105239_10168067 3300010375 Bacteria 2452
185 Ga0105239_10484221 3300010375 Bacteria 1406
186 Ga0105246_10217141 3300011119 Bacteria 1496
187 Ga0105246_12086898 3300011119 Bacteria 549
188 Ga0157344_1031309 3300012476 Bacteria 511
189 Ga0157336_1018510 3300012477 Bacteria 610
190 Ga0157318_1037429 3300012482 Bacteria 505
191 Ga0157326_1022061 3300012513 Bacteria 793
192 Ga0157338_1037622 3300012515 Bacteria 646
193 Ga0157374_11918953 3300013296 Bacteria 618
194 Ga0157378_10340413 3300013297 Bacteria 1462
195 Ga0157378_11694567 3300013297 Bacteria 679
196 Ga0163162_10944651 3300013306 Bacteria 974
197 Ga0163162_11547672 3300013306 Bacteria 756
198 Ga0157375_10143231 3300013308 Bacteria 2519
199 Ga0157375_10973548 3300013308 Bacteria 989
200 Ga0157375_11575240 3300013308 Bacteria 776
201 Ga0163163_10202897 3300014325 Bacteria 2031
202 Ga0163163_13237366 3300014325 Bacteria 508
203 Ga0157380_10235224 3300014326 Bacteria 1648
204 Ga0157380_10751841 3300014326 Bacteria 986
205 Ga0157380_11413457 3300014326 Bacteria 746
206 Ga0157380_11467099 3300014326 Bacteria 734
207 Ga0157377_10648667 3300014745 Bacteria 759
208 Ga0163161_10075476 3300017792 Bacteria 2474
209 Ga0163161_11452813 3300017792 Bacteria 600
210 Ga0206353_10290400 3300020082 Bacteria 540
211 Ga0207653_10000431 3300025885 Bacteria 17351
212 Ga0207682_10205632 3300025893 Bacteria 907
213 Ga0207642_10363605 3300025899 Bacteria 857
214 Ga0207647_10132004 3300025904 Bacteria 1467
215 Ga0207685_10044365 3300025905 Bacteria 1680
216 Ga0207645_10304269 3300025907 Bacteria 1062
217 Ga0207643_10156873 3300025908 Bacteria 1367
218 Ga0207643_10165737 3300025908 Bacteria 1331
219 Ga0207684_10179347 3300025910 Bacteria 1826
220 Ga0207707_10077051 3300025912 Bacteria 2910
221 Ga0207660_10021796 3300025917 Bacteria 4312
222 Ga0207662_10164085 3300025918 Bacteria 1421
223 Ga0207662_10168987 3300025918 Bacteria 1401
224 Ga0207646_10361730 3300025922 Bacteria 1311
225 Ga0207681_10760609 3300025923 Bacteria 808
226 Ga0207659_10378426 3300025926 Bacteria 1180
227 Ga0207687_11098215 3300025927 Bacteria 683
228 Ga0207644_11405896 3300025931 Bacteria 586
229 Ga0207706_10023201 3300025933 Bacteria 5573
230 Ga0207706_10101659 3300025933 Bacteria 2529
231 Ga0207706_10691545 3300025933 Bacteria 872
232 Ga0207709_10677061 3300025935 Bacteria 823
233 Ga0207670_10439170 3300025936 Bacteria 1050
234 Ga0207670_10519851 3300025936 Bacteria 969
235 Ga0207670_11411233 3300025936 Bacteria 591
236 Ga0207704_10568259 3300025938 Bacteria 924
237 Ga0207665_10149070 3300025939 Bacteria 1674
238 Ga0207711_11251515 3300025941 Bacteria 684
239 Ga0207711_11273396 3300025941 Bacteria 677
240 Ga0207689_10073035 3300025942 Bacteria 2818
241 Ga0207689_10357163 3300025942 Bacteria 1215
242 Ga0207712_10026744 3300025961 Bacteria 3847
243 Ga0207712_10108912 3300025961 Bacteria 2074
244 Ga0207668_10051519 3300025972 Bacteria 2844
245 Ga0207668_10230094 3300025972 Bacteria 1494
246 Ga0207668_10270559 3300025972 Bacteria 1389
247 Ga0207640_10400784 3300025981 Bacteria 1117
248 Ga0207640_10552565 3300025981 Bacteria 968
249 Ga0207678_10001732 3300026067 Bacteria 19963
250 Ga0207708_10002199 3300026075 Bacteria 14405
251 Ga0207708_10070709 3300026075 Bacteria 2672
252 Ga0207708_10109343 3300026075 Bacteria 2145
253 Ga0207708_10147072 3300026075 Bacteria 1852
254 Ga0207708_10645970 3300026075 Bacteria 900
255 Ga0207708_11001354 3300026075 Bacteria 726
256 Ga0207641_10602221 3300026088 Bacteria 1076
257 Ga0207648_11301275 3300026089 Bacteria 683
258 Ga0207676_10019974 3300026095 Bacteria 4894
259 Ga0207674_10005623 3300026116 Bacteria 14860
260 Ga0207674_10828785 3300026116 Bacteria 892
261 Ga0207675_100038669 3300026118 Bacteria 4452
262 Ga0207675_100263096 3300026118 Bacteria 1672
263 Ga0207675_100364611 3300026118 Bacteria 1418
264 Ga0207683_10169014 3300026121 Bacteria 1980
265 Ga0207683_11040445 3300026121 Bacteria 760
266 Ga0210000_1086075 3300027462 Bacteria 517
267 Ga0209966_1054997 3300027695 Bacteria 852
268 Ga0209813_10000760 3300027866 Bacteria 7378
269 Ga0209813_10132001 3300027866 Bacteria 879
270 Ga0209974_10299780 3300027876 Bacteria 615
271 Ga0207428_10008033 3300027907 Bacteria 9573
272 Ga0207428_10022938 3300027907 Bacteria 5257
273 Ga0207428_10114024 3300027907 Bacteria 2077
274 Ga0268266_11075221 3300028379 Bacteria 778
275 Ga0268266_11780133 3300028379 Bacteria 591
276 Ga0268265_10277267 3300028380 Bacteria 1498
277 Ga0268264_10001592 3300028381 Bacteria 21033
278 Ga0268264_10316793 3300028381 Bacteria 1473
279 Ga0268264_10813393 3300028381 Bacteria 934
280 Ga0268264_10978497 3300028381 Bacteria 852
281 Ga0316575_10036404 3300031665 Bacteria 1935
282 Ga0316579_10092775 3300031691 Bacteria 1442
283 Ga0316578_10177817 3300031728 Bacteria 1282
284 Ga0307413_10486450 3300031824 Bacteria 988
285 Ga0307409_101454203 3300031995 Bacteria 712
286 Ga0316583_10025586 3300032133 Bacteria 2107
287 Ga0316585_10038624 3300032137 Bacteria 1517
288 Ga0316580_10016757 3300032139 Bacteria 2249
289 Ga0316593_10038640 3300032168 Bacteria 1581
290 Ga0316592_1022506 3300033524 Bacteria 1348
291 Ga0316588_1141949 3300033528 Bacteria 614
292 Ga0316596_1056292 3300033541 Bacteria 1045
293 Ga0373930_0039895 3300034816 Bacteria 997
294 Ga0373948_0022251 3300034817 Bacteria 1221
295 Ga0373958_0005770 3300034819 Bacteria 1898
296 Ga0373928_0046405 3300035084 Bacteria 1014
297 Ga0373929_0058231 3300035085 Bacteria 899
298 Ga0373940_0140996 3300035088 Bacteria 762
299 Ga0373949_0015312 3300035090 Bacteria 1712
300 Ga0373952_0169611 3300035092 Bacteria 623
301 Ga0373932_0126075 3300035112 Bacteria 858
302 Ga0373939_0013244 3300035114 Bacteria 2119
303 Ga0373941_0003342 3300035115 Bacteria 3626
304 Ga0373942_0247927 3300035207 Bacteria 604
305 Ga0373961_0011434 3300035241 Bacteria 2202
306 Ga0373961_0369717 3300035241 Bacteria 544
307 Ga0373962_0001511 3300035242 Bacteria 5502
308 Ga0373962_0171966 3300035242 Bacteria 720
309 Ga0316574_0213554 3300035398 Bacteria 1237
310 Ga0316574_0347634 3300035398 Bacteria 938
311 Ga0373931_0005581 3300035691 Bacteria 5834
312 Ga0373931_0020752 3300035691 Bacteria 3290
313 Ga0373931_0121215 3300035691 Bacteria 1495
314 Ga0316582_0273213 3300036647 Bacteria 1159
315 Ga0316584_0204276 3300036712 Bacteria 1456
316 Ga0395899_0653948 3300037312 Bacteria 664
317 Ga0395900_0043669 3300037418 Bacteria 4620
318 Ga0395898_0048630 3300037466 Bacteria 4158
319 Ga0395905_0003237 3300037471 Bacteria 17510
320 Ga0316581_0021471 3300037588 Bacteria 1897
321 Ga0395901_0482341 3300038443 Bacteria 1264
322 Ga0436360_0723934 3300039438 Bacteria 653
323 Ga0439459_0185586 3300042438 Bacteria 561
324 Ga0453684_1604945 3300044712 Bacteria 668
325 Ga0451576_2759108 3300045051 Bacteria 500
326 Ga0495584_0341225 3300046491 Bacteria 761
327 Ga0495594_0837036 3300046499 Bacteria 518
328 Ga0495637_0196004 3300046520 Bacteria 744
329 Ga0495625_0322020 3300046660 Bacteria 984
330 Ga0495680_1067012 3300047322 Bacteria 512
331 Ga0496100_0058554 3300048903 Bacteria 2529
332 Ga0496100_0247276 3300048903 Bacteria 1318
333 Ga0496100_0793204 3300048903 Bacteria 742
334 Ga0496101_0029155 3300048904 Bacteria 3860
335 Ga0496101_0052487 3300048904 Bacteria 2940
336 Ga0496101_1037553 3300048904 Bacteria 644
337 Ga0496102_0022170 3300048905 Bacteria 5626
338 Ga0496102_0022644 3300048905 Bacteria 5568
339 Ga0496102_0032247 3300048905 Bacteria 4707
340 Ga0496102_0051129 3300048905 Bacteria 3765
341 Ga0496102_1257065 3300048905 Bacteria 660
342 Ga0496103_0004267 3300048906 Bacteria 8686
343 Ga0496103_0018424 3300048906 Bacteria 4188
344 Ga0496104_0001679 3300048907 Bacteria 19112
345 Ga0496104_0009311 3300048907 Bacteria 8734
346 Ga0496104_0139330 3300048907 Bacteria 2331
347 Ga0496105_0006016 3300048908 Bacteria 9272
348 Ga0496105_0144853 3300048908 Bacteria 1954
349 Ga0496105_0629834 3300048908 Bacteria 830
350 Ga0496106_0107199 3300048909 Bacteria 2172
351 Ga0496106_0166740 3300048909 Bacteria 1744
352 Ga0496106_0381616 3300048909 Bacteria 1132
353 Ga0496106_0408728 3300048909 Bacteria 1091
354 Ga0496107_0011004 3300048910 Bacteria 6293
355 Ga0496108_0005144 3300048911 Bacteria 10573
356 Ga0496108_1227724 3300048911 Bacteria 633
357 Ga0496109_0026092 3300048912 Bacteria 5208
358 Ga0496109_0071965 3300048912 Bacteria 3175
359 Ga0496109_0445548 3300048912 Bacteria 1223
360 Ga0496109_0898401 3300048912 Bacteria 824
361 Ga0496110_0000763 3300048913 Bacteria 22286
362 Ga0496110_0094138 3300048913 Bacteria 2682
363 Ga0496110_0103000 3300048913 Bacteria 2560
364 Ga0496110_1113555 3300048913 Bacteria 698
365 Ga0496111_0016063 3300048914 Bacteria 5153
366 Ga0496111_1118591 3300048914 Bacteria 561
367 Ga0496112_0012075 3300048915 Bacteria 7925
368 Ga0496112_0110363 3300048915 Bacteria 2721
369 Ga0496112_0346297 3300048915 Bacteria 1429
370 Ga0496113_0006867 3300048916 Bacteria 7262
371 Ga0496113_0043296 3300048916 Bacteria 3331
372 Ga0496113_0353358 3300048916 Bacteria 1179
373 Ga0496114_0482794 3300048917 Bacteria 1096
374 Ga0496115_0510445 3300048918 Bacteria 965
375 Ga0496115_0654572 3300048918 Bacteria 830
376 Ga0496115_0978519 3300048918 Bacteria 648
377 Ga0501031_0150441 3300049568 Bacteria 1521
378 Ga0501031_0562028 3300049568 Bacteria 735
379 Ga0501031_1069092 3300049568 Bacteria 515
380 Ga0501032_0116481 3300049569 Bacteria 1767
381 Ga0501033_0103265 3300049570 Bacteria 2079
382 Ga0501033_0550691 3300049570 Bacteria 795
383 Ga0501033_0602925 3300049570 Bacteria 753
384 Ga0501036_0071242 3300049572 Bacteria 2939
385 Ga0501036_0093188 3300049572 Bacteria 2545
386 Ga0501036_0329590 3300049572 Bacteria 1275
387 Ga0501036_0499245 3300049572 Bacteria 1012
388 Ga0501036_1361229 3300049572 Bacteria 576
389 Ga0501037_0147807 3300049573 Bacteria 1680
390 Ga0501038_0022940 3300049574 Bacteria 5587
391 Ga0501038_0299484 3300049574 Bacteria 1262
392 Ga0501039_0057172 3300049575 Bacteria 3021
393 Ga0501039_0256646 3300049575 Bacteria 1374
394 Ga0501039_0261346 3300049575 Bacteria 1361
395 Ga0501039_0299864 3300049575 Bacteria 1263
396 Ga0501039_1108204 3300049575 Bacteria 613
397 Ga0501040_0003550 3300049576 Bacteria 10081
398 Ga0501040_0029407 3300049576 Bacteria 3708
399 Ga0501040_0104610 3300049576 Bacteria 1977
400 Ga0501040_0312362 3300049576 Bacteria 1124
401 Ga0501040_0347165 3300049576 Bacteria 1063
402 Ga0501040_0541359 3300049576 Bacteria 840
403 Ga0501040_1090493 3300049576 Bacteria 579
404 Ga0501041_0038143 3300049577 Bacteria 2913
405 Ga0501041_0085071 3300049577 Bacteria 1949
406 Ga0501041_0187878 3300049577 Bacteria 1294
407 Ga0501041_0216319 3300049577 Bacteria 1202
408 Ga0501041_0311932 3300049577 Bacteria 992
409 Ga0501041_0337675 3300049577 Bacteria 951
410 Ga0501042_0021632 3300049578 Bacteria 4485
411 Ga0501042_0060180 3300049578 Bacteria 2712
412 Ga0501042_0372567 3300049578 Bacteria 1033
413 Ga0501042_0436687 3300049578 Bacteria 949
414 Ga0501042_1076698 3300049578 Bacteria 586
415 Ga0501043_0171233 3300049579 Bacteria 1694
416 Ga0501043_0382009 3300049579 Bacteria 1066
417 Ga0501046_0049801 3300049580 Bacteria 3312
418 Ga0501046_0088395 3300049580 Bacteria 2386
419 Ga0501046_0129509 3300049580 Bacteria 1914
420 Ga0501046_0440343 3300049580 Bacteria 938
421 Ga0501048_0025905 3300049582 Bacteria 4273
422 Ga0501048_0078941 3300049582 Bacteria 2323
423 Ga0501048_1021113 3300049582 Bacteria 595
424 Ga0501067_0110313 3300049583 Bacteria 1530
425 Ga0501067_0268939 3300049583 Bacteria 949
426 Ga0501068_0042359 3300049584 Bacteria 2738
427 Ga0501068_0150033 3300049584 Bacteria 1465
428 Ga0501068_0755891 3300049584 Bacteria 637
429 Ga0501068_0962749 3300049584 Bacteria 562
430 Ga0501069_0258626 3300049585 Bacteria 1016
431 Ga0501070_0155452 3300049586 Bacteria 1886
432 Ga0501070_0196005 3300049586 Bacteria 1659
433 Ga0501071_0011944 3300049587 Bacteria 5868
434 Ga0501071_0017737 3300049587 Bacteria 4916
435 Ga0501071_0074854 3300049587 Bacteria 2471
436 Ga0501071_0158937 3300049587 Bacteria 1688
437 Ga0501071_0390569 3300049587 Bacteria 1062
438 Ga0501071_1099920 3300049587 Bacteria 614
439 Ga0501072_0027808 3300049588 Bacteria 4412
440 Ga0501072_0059271 3300049588 Bacteria 3018
441 Ga0501072_0236847 3300049588 Bacteria 1454
442 Ga0501072_0395185 3300049588 Bacteria 1097
443 Ga0501072_0513448 3300049588 Bacteria 948
444 Ga0501073_0133318 3300049589 Bacteria 1722
445 Ga0501073_0346875 3300049589 Bacteria 1025
446 Ga0501073_0605003 3300049589 Bacteria 757
447 Ga0501074_0012897 3300049590 Bacteria 6077
448 Ga0501074_0021326 3300049590 Bacteria 4704
449 Ga0501074_0210743 3300049590 Bacteria 1384
450 Ga0501075_0033269 3300049591 Bacteria 3835
451 Ga0501075_0035766 3300049591 Bacteria 3705
452 Ga0501075_0059524 3300049591 Bacteria 2877
453 Ga0501075_0131055 3300049591 Bacteria 1910
454 Ga0501075_1025013 3300049591 Bacteria 627
455 Ga0501076_0024471 3300049592 Bacteria 4667
456 Ga0501076_0026034 3300049592 Bacteria 4527
457 Ga0501076_0027098 3300049592 Bacteria 4445
458 Ga0501076_0071880 3300049592 Bacteria 2768
459 Ga0501076_0148242 3300049592 Bacteria 1908
460 Ga0501076_0516626 3300049592 Bacteria 984
461 Ga0501077_0023378 3300049593 Bacteria 3919
462 Ga0501077_0029123 3300049593 Bacteria 3510
463 Ga0501077_0042890 3300049593 Bacteria 2875
464 Ga0501077_0088663 3300049593 Bacteria 1960
465 Ga0501077_0291572 3300049593 Bacteria 1039
466 Ga0501077_0541172 3300049593 Bacteria 747
467 Ga0501077_0754108 3300049593 Bacteria 626
468 Ga0501077_1020216 3300049593 Bacteria 532
469 Ga0501079_0000935 3300049741 Bacteria 20089
470 Ga0501079_0096955 3300049741 Bacteria 2286
471 Ga0501079_0173078 3300049741 Bacteria 1683
472 Ga0501079_0417595 3300049741 Bacteria 1053
473 Ga0501079_0444777 3300049741 Bacteria 1018
474 Ga0501079_0576543 3300049741 Bacteria 885
475 Ga0501079_0890856 3300049741 Bacteria 701
476 Ga0501079_0994735 3300049741 Bacteria 661
477 Ga0501080_0013615 3300049742 Bacteria 7489
478 Ga0501080_0492916 3300049742 Bacteria 1096
479 Ga0501080_0999744 3300049742 Bacteria 725
480 Ga0501080_1286623 3300049742 Bacteria 627
481 Ga0501080_1286733 3300049742 Bacteria 627
482 Ga0501081_0074206 3300049743 Bacteria 2373
483 Ga0501081_0342355 3300049743 Bacteria 1101
484 Ga0501081_0387453 3300049743 Bacteria 1033
485 Ga0501083_0068320 3300049744 Bacteria 2365
486 Ga0501083_0390378 3300049744 Bacteria 905
487 Ga0501035_0356090 3300049822 Bacteria 1224
488 Ga0501045_0100304 3300049824 Bacteria 2143
489 Ga0501045_0232270 3300049824 Bacteria 1373
490 Ga0501045_0488011 3300049824 Bacteria 915
491 Ga0501045_0564990 3300049824 Bacteria 843
492 Ga0501045_0576149 3300049824 Bacteria 834
493 nmdc:mga03683_103644_c2 3300050489 Bacteria 949
494 nmdc:mga03n38_136264_c1 3300050490 Bacteria 1222
495 nmdc:mga03n38_166437_c1 3300050490 Bacteria 1120
496 nmdc:mga00v17_12815_c1 3300050491 Bacteria 4635
497 nmdc:mga0yw44_114206_c1 3300050492 Bacteria 1733
498 nmdc:mga0yw44_43732_c1 3300050492 Bacteria 2676
499 nmdc:mga06z11_147739_c1 3300050494 Bacteria 1334
500 nmdc:mga06z11_4177_c1 3300050494 Bacteria 5653
501 nmdc:mga06z11_705_c1 3300050494 Bacteria 12155
502 nmdc:mga04h51_155003_c1 3300050495 Bacteria 878
503 nmdc:mga04h51_694_c1 3300050495 Bacteria 7837
504 nmdc:mga05p37_1255435_c1 3300050507 Bacteria 760
505 nmdc:mga05p37_136208_c1 3300050507 Bacteria 3011
506 nmdc:mga05p37_2006559_c1 3300050507 Bacteria 547
507 nmdc:mga05p37_205275_c1 3300050507 Bacteria 2384
508 nmdc:mga05p37_360159_c1 3300050507 Bacteria 1710
509 nmdc:mga05p37_656882_c1 3300050507 Bacteria 1173
510 nmdc:mga05p37_792895_c1 3300050507 Bacteria 1038
511 nmdc:mga05p37_962969_c1 3300050507 Bacteria 912
512 nmdc:mga09592_108975_c1 3300050508 Bacteria 2375
513 nmdc:mga09592_1609860_c1 3300050508 Bacteria 526
514 nmdc:mga09592_22512_c1 3300050508 Bacteria 5201
515 nmdc:mga09592_378857_c1 3300050508 Bacteria 1223
516 nmdc:mga09592_574062_c1 3300050508 Bacteria 968
517 nmdc:mga09592_81984_c1 3300050508 Bacteria 2749
518 nmdc:mga09592_8984_c1 3300050508 Bacteria 8127
519 nmdc:mga0qj67_1176660_c1 3300050509 Bacteria 597
520 nmdc:mga0qj67_212992_c1 3300050509 Bacteria 1569
521 nmdc:mga0qj67_519414_c1 3300050509 Bacteria 957
522 nmdc:mga0qj67_648263_c1 3300050509 Bacteria 843
523 nmdc:mga06r32_1112924_c1 3300050510 Bacteria 739
524 nmdc:mga06r32_1564629_c1 3300050510 Bacteria 598
525 nmdc:mga06r32_20635_c1 3300050510 Bacteria 6069
526 nmdc:mga06r32_299547_c1 3300050510 Bacteria 1594
527 nmdc:mga06r32_32011_c1 3300050510 Bacteria 4943
528 nmdc:mga06r32_36538_c1 3300050510 Bacteria 4642
529 nmdc:mga06r32_644216_c1 3300050510 Bacteria 1028
530 nmdc:mga06r32_733359_c1 3300050510 Bacteria 952
531 nmdc:mga06r32_784771_c1 3300050510 Bacteria 914
532 nmdc:mga06r32_78720_c1 3300050510 Bacteria 3205
533 nmdc:mga06r32_80556_c1 3300050510 Bacteria 3169
534 nmdc:mga08y16_123158_c1 3300050511 Bacteria 2698
535 nmdc:mga08y16_155881_c1 3300050511 Bacteria 2373
536 nmdc:mga08y16_468668_c1 3300050511 Bacteria 1283
537 nmdc:mga08y16_5359_c1 3300050511 Bacteria 13416
538 nmdc:mga08y16_630046_c1 3300050511 Bacteria 1078
539 nmdc:mga08y16_63289_c1 3300050511 Bacteria 3863
540 nmdc:mga08y16_823601_c1 3300050511 Bacteria 919
541 nmdc:mga0n895_1273217_c1 3300050512 Bacteria 707
542 nmdc:mga0n895_15896_c1 3300050512 Bacteria 6884
543 nmdc:mga0n895_2115512_c1 3300050512 Bacteria 519
544 nmdc:mga0n895_30612_c1 3300050512 Bacteria 5146
545 nmdc:mga0n895_423333_c1 3300050512 Bacteria 1346
546 nmdc:mga0n895_959649_c1 3300050512 Bacteria 838
547 nmdc:mga0rr50_63784_c1 3300050513 Bacteria 2784
548 nmdc:mga0rr50_778803_c1 3300050513 Bacteria 816
549 nmdc:mga08x19_92697_c1 3300050514 Bacteria 1996
550 nmdc:mga0a205_1080936_c1 3300050515 Bacteria 649
551 nmdc:mga0a205_380963_c1 3300050515 Bacteria 1276
552 nmdc:mga0a205_92467_c1 3300050515 Bacteria 2923
553 Ga0495595_0254438 3300053084 Bacteria 880
554 Ga0500611_140849 3300053727 Bacteria 656
555 Ga0501084_0009681 3300054114 Bacteria 7970
556 Ga0501084_0057707 3300054114 Bacteria 3248
557 Ga0501084_0166467 3300054114 Bacteria 1860
558 Ga0501084_0186839 3300054114 Bacteria 1749
559 Ga0501084_0348437 3300054114 Bacteria 1251
560 Ga0501084_0376089 3300054114 Bacteria 1200
561 Ga0501084_0879318 3300054114 Bacteria 754
562 Ga0501084_1002635 3300054114 Bacteria 702
563 Ga0587088_180438 3300059508 Bacteria 529
564 Ga0587094_118015 3300059513 Bacteria 529
565 Ga0587067_034213 3300059640 Bacteria 955
566 Ga0501082_0087184 3300060353 Bacteria 2693
567 Ga0501082_0104763 3300060353 Bacteria 2447
568 Ga0501082_0137074 3300060353 Bacteria 2123
569 Ga0501082_0149455 3300060353 Bacteria 2029
570 Ga0501082_0201711 3300060353 Bacteria 1730
571 Ga0501082_0306852 3300060353 Bacteria 1382
572 Ga0501082_0607779 3300060353 Bacteria 957
573 Ga0501082_0990523 3300060353 Bacteria 735
574 Ga0530510_0022182 3300061734 Bacteria 4522
575 Ga0530510_0053318 3300061734 Bacteria 2923
576 Ga0530510_0065528 3300061734 Bacteria 2632
577 Ga0530510_0106488 3300061734 Bacteria 2052
578 Ga0530510_0317878 3300061734 Bacteria 1167
579 Ga0530510_1047732 3300061734 Bacteria 624
580 Ga0530510_1411978 3300061734 Bacteria 534
581 Ga0530510_1503523 3300061734 Bacteria 517
582 Ga0105249_10187249
583 ARSoilOldRDRAFT_c024625
584 JGI25404J52841_10035903
585 JGI25405J52794_10062122
586 Ga0058859_11730514
587 Ga0058860_12127454
588 Ga0070676_10206185
589 Ga0070690_101559172
590 Ga0070677_10231850
591 Ga0068869_100304545
592 Ga0068869_100875147
593 Ga0070680_100005357
594 Ga0070680_100612636
595 Ga0070682_100885626
596 Ga0070689_100495601
597 Ga0070689_100575658
598 Ga0070691_10011721
599 Ga0070687_100135784
600 Ga0070661_100934835
601 Ga0070692_10956293
602 Ga0070668_100366703
603 Ga0070669_100550375
604 Ga0070669_101043242
605 Ga0070669_101251950
606 Ga0070669_101923422
607 Ga0070675_100182317
608 Ga0070671_101189806
609 Ga0070674_101158652
610 Ga0070688_100850012
611 Ga0070667_100320517
612 Ga0070703_10003770
613 Ga0070703_10482079
614 Ga0070701_10015576
615 Ga0070705_100000057
616 Ga0070700_100002470
617 Ga0070700_100027631
618 Ga0070700_100793388
619 Ga0070700_101150710
620 Ga0070700_101361112
621 Ga0070694_100002273
622 Ga0070694_100097640
623 Ga0070694_100171258
624 Ga0070694_101340155
625 Ga0070708_100125826
626 Ga0070708_100282071
627 Ga0070708_101522969
628 Ga0070708_101913366
629 Ga0070663_100012775
630 Ga0070663_100881652
631 Ga0070678_101938379
632 Ga0070681_10096710
633 Ga0070706_100091438
634 Ga0070706_100457831
635 Ga0070707_100324269
636 Ga0070698_100155582
637 Ga0070698_100197477
638 Ga0070699_100003065
639 Ga0070697_100014553
640 Ga0068853_102036012
641 Ga0070695_100006256
642 Ga0070695_100034406
643 Ga0070695_100065339
644 Ga0070696_100000250
645 Ga0070696_100703904
646 Ga0070693_100226483
647 Ga0070665_102196021
648 Ga0070704_100003249
649 Ga0070704_100072808
650 Ga0070704_100113334
651 Ga0070704_100183282
652 Ga0070664_101218825
653 Ga0070664_101291498
654 Ga0068857_100048952
655 Ga0068854_100122396
656 Ga0068854_100581478
657 Ga0070702_100054132
658 Ga0070702_100081105
659 Ga0068859_100072659
660 Ga0068859_100496886
661 Ga0068859_100910727
662 Ga0068864_100057255
663 Ga0068861_100037645
664 Ga0068861_100058898
665 Ga0068861_100290678
666 Ga0068861_100571388
667 Ga0068861_101441495
668 Ga0068870_10166139
669 Ga0068863_100685457
670 Ga0068858_100106570
671 Ga0068860_100001351
672 Ga0068860_100307635
673 Ga0068860_100446289
674 Ga0068860_101569956
675 Ga0068862_100003675
676 Ga0068862_100039031
677 Ga0068862_100929022
678 Ga0081455_10000206
679 Ga0081455_10008046
680 Ga0081455_10459961
681 Ga0081540_1000056
682 Ga0081539_10258001
683 Ga0081539_10270425
684 Ga0070717_10389486
685 Ga0075365_10038559
686 Ga0075368_10000337
687 Ga0075368_10006002
688 Ga0075363_100026204
689 Ga0075363_100039888
690 Ga0075364_10007379
691 Ga0075432_10038045
692 Ga0075362_10198056
693 Ga0075367_10000532
694 Ga0075427_10019394
695 Ga0068871_100667489
696 Ga0068871_101891409
697 Ga0075428_100023618
698 Ga0075428_100040783
699 Ga0075428_100134358
700 Ga0075428_100214944
701 Ga0075428_100350066
702 Ga0075428_100399542
703 Ga0075428_101267430
704 Ga0075430_100058810
705 Ga0075430_100221426
706 Ga0075430_100293032
707 Ga0075430_100981559
708 Ga0075431_100001516
709 Ga0075431_100036574
710 Ga0075431_100102189
711 Ga0075431_100140639
712 Ga0075431_100158030
713 Ga0075431_100188648
714 Ga0075431_100765589
715 Ga0075431_100854903
716 Ga0075431_101001579
717 Ga0075433_10005400
718 Ga0075433_11714619
719 Ga0075434_100028601
720 Ga0075434_100124950
721 Ga0075434_100419260
722 Ga0075434_101553289
723 Ga0075434_101939277
724 Ga0075434_101955447
725 Ga0075429_100014311
726 Ga0075429_100037548
727 Ga0075429_100065346
728 Ga0075429_100087244
729 Ga0075429_100380753
730 Ga0075429_100631232
731 Ga0068865_101663872
732 Ga0075436_100596250
733 Ga0097620_100072657
734 Ga0097620_100496857
735 Ga0097620_100910818
736 Ga0075435_100619922
737 Ga0099795_10014280
738 Ga0111539_10017956
739 Ga0111539_10154825
740 Ga0111539_10158307
741 Ga0111539_10293353
742 Ga0111539_10519324
743 Ga0111539_10668920
744 Ga0111539_10862606
745 Ga0111539_11015707
746 Ga0105245_10666563
747 Ga0114129_10051143
748 Ga0114129_10132408
749 Ga0114129_10134520
750 Ga0114129_10373284
751 Ga0114129_10406549
752 Ga0114129_10586687
753 Ga0114129_10780578
754 Ga0114129_11246331
755 Ga0114129_13077024
756 Ga0105243_11095901
757 Ga0105241_10002335
758 Ga0105241_10207559
759 Ga0105242_11812250
760 Ga0105248_10458194
761 Ga0105248_11859359
762 Ga0105249_10024372
763 Ga0105249_10589418
764 Ga0105249_11329799
765 Ga0105239_10168067
766 Ga0105239_10484221
767 Ga0105246_10217141
768 Ga0105246_12086898
769 Ga0157344_1031309
770 Ga0157336_1018510
771 Ga0157318_1037429
772 Ga0157326_1022061
773 Ga0157338_1037622
774 Ga0157374_11918953
775 Ga0157378_10340413
776 Ga0157378_11694567
777 Ga0163162_10944651
778 Ga0163162_11547672
779 Ga0157375_10143231
780 Ga0157375_10973548
781 Ga0157375_11575240
782 Ga0163163_10202897
783 Ga0163163_13237366
784 Ga0157380_10235224
785 Ga0157380_10751841
786 Ga0157380_11413457
787 Ga0157380_11467099
788 Ga0157377_10648667
789 Ga0163161_10075476
790 Ga0163161_11452813
791 Ga0206353_10290400
792 Ga0207653_10000431
793 Ga0207682_10205632
794 Ga0207642_10363605
795 Ga0207647_10132004
796 Ga0207685_10044365
797 Ga0207645_10304269
798 Ga0207643_10156873
799 Ga0207643_10165737
800 Ga0207684_10179347
801 Ga0207707_10077051
802 Ga0207660_10021796
803 Ga0207662_10164085
804 Ga0207662_10168987
805 Ga0207646_10361730
806 Ga0207681_10760609
807 Ga0207659_10378426
808 Ga0207687_11098215
809 Ga0207644_11405896
810 Ga0207706_10023201
811 Ga0207706_10101659
812 Ga0207706_10691545
813 Ga0207709_10677061
814 Ga0207670_10439170
815 Ga0207670_10519851
816 Ga0207670_11411233
817 Ga0207704_10568259
818 Ga0207665_10149070
819 Ga0207711_11251515
820 Ga0207711_11273396
821 Ga0207689_10073035
822 Ga0207689_10357163
823 Ga0207712_10026744
824 Ga0207712_10108912
825 Ga0207668_10051519
826 Ga0207668_10230094
827 Ga0207668_10270559
828 Ga0207640_10400784
829 Ga0207640_10552565
830 Ga0207678_10001732
831 Ga0207708_10002199
832 Ga0207708_10070709
833 Ga0207708_10109343
834 Ga0207708_10147072
835 Ga0207708_10645970
836 Ga0207708_11001354
837 Ga0207641_10602221
838 Ga0207648_11301275
839 Ga0207676_10019974
840 Ga0207674_10005623
841 Ga0207674_10828785
842 Ga0207675_100038669
843 Ga0207675_100263096
844 Ga0207675_100364611
845 Ga0207683_10169014
846 Ga0207683_11040445
847 Ga0210000_1086075
848 Ga0209966_1054997
849 Ga0209813_10000760
850 Ga0209813_10132001
851 Ga0209974_10299780
852 Ga0207428_10008033
853 Ga0207428_10022938
854 Ga0207428_10114024
855 Ga0268266_11075221
856 Ga0268266_11780133
857 Ga0268265_10277267
858 Ga0268264_10001592
859 Ga0268264_10316793
860 Ga0268264_10813393
861 Ga0268264_10978497
862 Ga0316575_10036404
863 Ga0316579_10092775
864 Ga0316578_10177817
865 Ga0307413_10486450
866 Ga0307409_101454203
867 Ga0316583_10025586
868 Ga0316585_10038624
869 Ga0316580_10016757
870 Ga0316593_10038640
871 Ga0316592_1022506
872 Ga0316588_1141949
873 Ga0316596_1056292
874 Ga0373930_0039895
875 Ga0373948_0022251
876 Ga0373958_0005770
877 Ga0373928_0046405
878 Ga0373929_0058231
879 Ga0373940_0140996
880 Ga0373949_0015312
881 Ga0373952_0169611
882 Ga0373932_0126075
883 Ga0373939_0013244
884 Ga0373941_0003342
885 Ga0373942_0247927
886 Ga0373961_0011434
887 Ga0373961_0369717
888 Ga0373962_0001511
889 Ga0373962_0171966
890 Ga0316574_0213554
891 Ga0316574_0347634
892 Ga0373931_0005581
893 Ga0373931_0020752
894 Ga0373931_0121215
895 Ga0316582_0273213
896 Ga0316584_0204276
897 Ga0395899_0653948
898 Ga0395900_0043669
899 Ga0395898_0048630
900 Ga0395905_0003237
901 Ga0316581_0021471
902 Ga0395901_0482341
903 Ga0436360_0723934
904 Ga0439459_0185586
905 Ga0453684_1604945
906 Ga0451576_2759108
907 Ga0495584_0341225
908 Ga0495594_0837036
909 Ga0495637_0196004
910 Ga0495625_0322020
911 Ga0495680_1067012
912 Ga0496100_0058554
913 Ga0496100_0247276
914 Ga0496100_0793204
915 Ga0496101_0029155
916 Ga0496101_0052487
917 Ga0496101_1037553
918 Ga0496102_0022170
919 Ga0496102_0022644
920 Ga0496102_0032247
921 Ga0496102_0051129
922 Ga0496102_1257065
923 Ga0496103_0004267
924 Ga0496103_0018424
925 Ga0496104_0001679
926 Ga0496104_0009311
927 Ga0496104_0139330
928 Ga0496105_0006016
929 Ga0496105_0144853
930 Ga0496105_0629834
931 Ga0496106_0107199
932 Ga0496106_0166740
933 Ga0496106_0381616
934 Ga0496106_0408728
935 Ga0496107_0011004
936 Ga0496108_0005144
937 Ga0496108_1227724
938 Ga0496109_0026092
939 Ga0496109_0071965
940 Ga0496109_0445548
941 Ga0496109_0898401
942 Ga0496110_0000763
943 Ga0496110_0094138
944 Ga0496110_0103000
945 Ga0496110_1113555
946 Ga0496111_0016063
947 Ga0496111_1118591
948 Ga0496112_0012075
949 Ga0496112_0110363
950 Ga0496112_0346297
951 Ga0496113_0006867
952 Ga0496113_0043296
953 Ga0496113_0353358
954 Ga0496114_0482794
955 Ga0496115_0510445
956 Ga0496115_0654572
957 Ga0496115_0978519
958 Ga0501031_0150441
959 Ga0501031_0562028
960 Ga0501031_1069092
961 Ga0501032_0116481
962 Ga0501033_0103265
963 Ga0501033_0550691
964 Ga0501033_0602925
965 Ga0501036_0071242
966 Ga0501036_0093188
967 Ga0501036_0329590
968 Ga0501036_0499245
969 Ga0501036_1361229
970 Ga0501037_0147807
971 Ga0501038_0022940
972 Ga0501038_0299484
973 Ga0501039_0057172
974 Ga0501039_0256646
975 Ga0501039_0261346
976 Ga0501039_0299864
977 Ga0501039_1108204
978 Ga0501040_0003550
979 Ga0501040_0029407
980 Ga0501040_0104610
981 Ga0501040_0312362
982 Ga0501040_0347165
983 Ga0501040_0541359
984 Ga0501040_1090493
985 Ga0501041_0038143
986 Ga0501041_0085071
987 Ga0501041_0187878
988 Ga0501041_0216319
989 Ga0501041_0311932
990 Ga0501041_0337675
991 Ga0501042_0021632
992 Ga0501042_0060180
993 Ga0501042_0372567
994 Ga0501042_0436687
995 Ga0501042_1076698
996 Ga0501043_0171233
997 Ga0501043_0382009
998 Ga0501046_0049801
999 Ga0501046_0088395
1000 Ga0501046_0129509
1001 Ga0501046_0440343
1002 Ga0501048_0025905
1003 Ga0501048_0078941
1004 Ga0501048_1021113
1005 Ga0501067_0110313
1006 Ga0501067_0268939
1007 Ga0501068_0042359
1008 Ga0501068_0150033
1009 Ga0501068_0755891
1010 Ga0501068_0962749
1011 Ga0501069_0258626
1012 Ga0501070_0155452
1013 Ga0501070_0196005
1014 Ga0501071_0011944
1015 Ga0501071_0017737
1016 Ga0501071_0074854
1017 Ga0501071_0158937
1018 Ga0501071_0390569
1019 Ga0501071_1099920
1020 Ga0501072_0027808
1021 Ga0501072_0059271
1022 Ga0501072_0236847
1023 Ga0501072_0395185
1024 Ga0501072_0513448
1025 Ga0501073_0133318
1026 Ga0501073_0346875
1027 Ga0501073_0605003
1028 Ga0501074_0012897
1029 Ga0501074_0021326
1030 Ga0501074_0210743
1031 Ga0501075_0033269
1032 Ga0501075_0035766
1033 Ga0501075_0059524
1034 Ga0501075_0131055
1035 Ga0501075_1025013
1036 Ga0501076_0024471
1037 Ga0501076_0026034
1038 Ga0501076_0027098
1039 Ga0501076_0071880
1040 Ga0501076_0148242
1041 Ga0501076_0516626
1042 Ga0501077_0023378
1043 Ga0501077_0029123
1044 Ga0501077_0042890
1045 Ga0501077_0088663
1046 Ga0501077_0291572
1047 Ga0501077_0541172
1048 Ga0501077_0754108
1049 Ga0501077_1020216
1050 Ga0501079_0000935
1051 Ga0501079_0096955
1052 Ga0501079_0173078
1053 Ga0501079_0417595
1054 Ga0501079_0444777
1055 Ga0501079_0576543
1056 Ga0501079_0890856
1057 Ga0501079_0994735
1058 Ga0501080_0013615
1059 Ga0501080_0492916
1060 Ga0501080_0999744
1061 Ga0501080_1286623
1062 Ga0501080_1286733
1063 Ga0501081_0074206
1064 Ga0501081_0342355
1065 Ga0501081_0387453
1066 Ga0501083_0068320
1067 Ga0501083_0390378
1068 Ga0501035_0356090
1069 Ga0501045_0100304
1070 Ga0501045_0232270
1071 Ga0501045_0488011
1072 Ga0501045_0564990
1073 Ga0501045_0576149
1074 nmdc:mga03683_103644_c2
1075 nmdc:mga03n38_136264_c1
1076 nmdc:mga03n38_166437_c1
1077 nmdc:mga00v17_12815_c1
1078 nmdc:mga0yw44_114206_c1
1079 nmdc:mga0yw44_43732_c1
1080 nmdc:mga06z11_147739_c1
1081 nmdc:mga06z11_4177_c1
1082 nmdc:mga06z11_705_c1
1083 nmdc:mga04h51_155003_c1
1084 nmdc:mga04h51_694_c1
1085 nmdc:mga05p37_1255435_c1
1086 nmdc:mga05p37_136208_c1
1087 nmdc:mga05p37_2006559_c1
1088 nmdc:mga05p37_205275_c1
1089 nmdc:mga05p37_360159_c1
1090 nmdc:mga05p37_656882_c1
1091 nmdc:mga05p37_792895_c1
1092 nmdc:mga05p37_962969_c1
1093 nmdc:mga09592_108975_c1
1094 nmdc:mga09592_1609860_c1
1095 nmdc:mga09592_22512_c1
1096 nmdc:mga09592_378857_c1
1097 nmdc:mga09592_574062_c1
1098 nmdc:mga09592_81984_c1
1099 nmdc:mga09592_8984_c1
1100 nmdc:mga0qj67_1176660_c1
1101 nmdc:mga0qj67_212992_c1
1102 nmdc:mga0qj67_519414_c1
1103 nmdc:mga0qj67_648263_c1
1104 nmdc:mga06r32_1112924_c1
1105 nmdc:mga06r32_1564629_c1
1106 nmdc:mga06r32_20635_c1
1107 nmdc:mga06r32_299547_c1
1108 nmdc:mga06r32_32011_c1
1109 nmdc:mga06r32_36538_c1
1110 nmdc:mga06r32_644216_c1
1111 nmdc:mga06r32_733359_c1
1112 nmdc:mga06r32_784771_c1
1113 nmdc:mga06r32_78720_c1
1114 nmdc:mga06r32_80556_c1
1115 nmdc:mga08y16_123158_c1
1116 nmdc:mga08y16_155881_c1
1117 nmdc:mga08y16_468668_c1
1118 nmdc:mga08y16_5359_c1
1119 nmdc:mga08y16_630046_c1
1120 nmdc:mga08y16_63289_c1
1121 nmdc:mga08y16_823601_c1
1122 nmdc:mga0n895_1273217_c1
1123 nmdc:mga0n895_15896_c1
1124 nmdc:mga0n895_2115512_c1
1125 nmdc:mga0n895_30612_c1
1126 nmdc:mga0n895_423333_c1
1127 nmdc:mga0n895_959649_c1
1128 nmdc:mga0rr50_63784_c1
1129 nmdc:mga0rr50_778803_c1
1130 nmdc:mga08x19_92697_c1
1131 nmdc:mga0a205_1080936_c1
1132 nmdc:mga0a205_380963_c1
1133 nmdc:mga0a205_92467_c1
1134 Ga0495595_0254438
1135 Ga0500611_140849
1136 Ga0501084_0009681
1137 Ga0501084_0057707
1138 Ga0501084_0166467
1139 Ga0501084_0186839
1140 Ga0501084_0348437
1141 Ga0501084_0376089
1142 Ga0501084_0879318
1143 Ga0501084_1002635
1144 Ga0587088_180438
1145 Ga0587094_118015
1146 Ga0587067_034213
1147 Ga0501082_0087184
1148 Ga0501082_0104763
1149 Ga0501082_0137074
1150 Ga0501082_0149455
1151 Ga0501082_0201711
1152 Ga0501082_0306852
1153 Ga0501082_0607779
1154 Ga0501082_0990523
1155 Ga0530510_0022182
1156 Ga0530510_0053318
1157 Ga0530510_0065528
1158 Ga0530510_0106488
1159 Ga0530510_0317878
1160 Ga0530510_1047732
1161 Ga0530510_1411978
1162 Ga0530510_1503523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

35

99

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9722 7 109
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9633 4 106
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9608 4 107
5y4u-assembly1.cif.gz_A crystal structure of grx domain of grx3 from saccharomyces cerevisiae 0.9355 9 102
4tr1-assembly1.cif.gz_A crystal structure of gsh-bound cgrx2/c15s 0.9276 17 102
ID Description Score Start End Superfamily
af_O97232_76_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9878 10 100 3.40.30.10
af_K7UQQ8_80_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9849 11 96 3.40.30.10
af_Q555C8_40_141_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9813 10 108 3.40.30.10
af_Q8IBZ7_179_272_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9785 14 100 3.40.30.10
af_A0A1D6H817_56_131_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9769 34 108 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A812M9D7-F1-model_v4 deleted 1.004 3 109
AF-A0A3D4E5J8-F1-model_v4 Glutaredoxin 1.004 5 107 GO:0015036
GO:0046872
GO:0051537
AF-A0A529M835-F1-model_v4 Grx4 family monothiol glutaredoxin 1.004 6 92 GO:0015036
GO:0046872
GO:0051537
AF-A0A1Q7WS79-F1-model_v4 Glutaredoxin 1.003 6 111 GO:0015036
GO:0046872
GO:0051537
AF-A0A1Y5I925-F1-model_v4 Angiotensin-converting enzyme (EC 3.4.-.-) 1.003 4 109 GO:0004180
GO:0006508
GO:0008237
GO:0008241
GO:0016020
GO:0046872
GO:0051536

Map