F466041

General Info

Members Datasets Scaffolds Average Seq Length
581 313 536 403

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100039671|Ga0070670_1000396712
Length 388
Sequence VQALQGLKVIELGQLIAGPFAGKTLADFGADVIKIESHDVGDPLRKWRMLRDGTSVWWQVQSRNKRSVCLDLRKHEGQETVRALAKEADVLIENFKPGTLEKWGLGWERLHAENRGLIMLRISGYGQTGPYREKPGFGALGEAMGGLRHLTGEPDRVPVRVGVSIGDTLAALHGVIGVLMALHHRNAHGGEGQFIDVGLYEAVFNVMESLVPEYDAFGAVRGAAGSALPGIAPTNAYLCNDGQYVLVAGNGDSIFKRLMTAIGRDDLGNAPDLKHNDGRVKRAEELDAAIGEWTKTRSRENVLAILDAADVPAGKIYSIADIMSDPQYLARDMIVEVECADGSKLRVPGIVPKLSATPGRIRRAAPRLGQDDADLQRGGGWPSAHSEA

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
6 2643221556 Massilia sp. Root1485 Isolate Unclassified
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221652 Acidovorax sp. Root402 Isolate Unclassified
12 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
13 2643221684 Massilia sp. Root133 Isolate Unclassified
14 2643221717 Acidovorax sp. Root267 Isolate Unclassified
15 2721755523 Delftia sp. HK171 Isolate Unclassified
16 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
17 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
18 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
21 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543013 Variovorax sp. BT01 Isolate Unclassified
24 2831864461 Roseateles noduli HZ7 Isolate Nodule
25 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
26 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
27 2842733646 Variovorax sp. R-72446 Isolate Unclassified
28 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
29 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
30 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
31 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
32 2919476304 Duganella sp. 3397 Isolate Unclassified
33 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
34 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
35 2928058823 Ralstonia sp. 1138 Isolate Unclassified
36 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
37 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
38 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
39 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
40 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
41 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
42 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
45 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
51 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
56 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
57 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
157 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
183 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
260 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
261 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
281 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
293 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
301 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
306 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
309 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
311 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
312 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
313 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.25
Metatranscriptomes 0
Isolates 7.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.02
Nodule 0.86
Rhizoplane 2.75
Rhizosphere 76.76
Stem 0
Stem Tuber 0
Unclassified 8.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10001616 3300002067 Bacteria 7972
2 JGI25156J39149_1010707 3300002705 Bacteria 2134
3 JGI25154J39366_1002814 3300002738 Bacteria 4136
4 JGI25159J45721_1017784 3300002987 Bacteria 1456
5 JGI25151J46595_10001832 3300003187 Bacteria 13696
6 JGI25151J46595_10015996 3300003187 Bacteria 3291
7 JGI25153J46596_10001224 3300003215 Bacteria 15474
8 rootL2_10019572 3300003322 Bacteria 12270
9 Ga0055533_1003302 3300003756 Bacteria 3290
10 Ga0055525_1000018 3300003759 Bacteria 393974
11 Ga0055542_1004599 3300003762 Bacteria 3306
12 Ga0055526_1006558 3300003771 Bacteria 6279
13 Ga0055524_1000942 3300003775 Bacteria 18555
14 Ga0055530_10025047 3300003791 Bacteria 1676
15 Ga0055541_1000116 3300003841 Bacteria 54823
16 Ga0055541_1000548 3300003841 Bacteria 10201
17 Ga0055543_1005844 3300004625 Bacteria 3077
18 Ga0065165_1000177 3300005262 Bacteria 113446
19 Ga0065165_1021119 3300005262 Bacteria 2269
20 Ga0065704_10001178 3300005289 Bacteria 10911
21 Ga0070658_10014881 3300005327 Bacteria 6232
22 Ga0070658_10018437 3300005327 Bacteria 5587
23 Ga0070658_10269204 3300005327 Bacteria 1448
24 Ga0070670_100039671 3300005331 Bacteria 4049
25 Ga0070670_100084589 3300005331 Bacteria 2726
26 Ga0070677_10013670 3300005333 Bacteria 2844
27 Ga0068868_100027724 3300005338 Bacteria 4323
28 Ga0070660_100000821 3300005339 Bacteria 20615
29 Ga0070660_100031603 3300005339 Bacteria 3977
30 Ga0070660_100116698 3300005339 Bacteria 2128
31 Ga0070661_100058236 3300005344 Bacteria 2831
32 Ga0070668_100038935 3300005347 Bacteria 3636
33 Ga0070671_100019581 3300005355 Bacteria 5511
34 Ga0070674_100050915 3300005356 Bacteria 2852
35 Ga0070673_100085680 3300005364 Bacteria 2566
36 Ga0070659_100043072 3300005366 Bacteria 3530
37 Ga0070659_100061573 3300005366 Bacteria 2965
38 Ga0070667_100011958 3300005367 Bacteria 7180
39 Ga0070667_100041650 3300005367 Bacteria 3853
40 Ga0070678_100095625 3300005456 Bacteria 2290
41 Ga0070678_100192030 3300005456 Bacteria 1679
42 Ga0068867_100007440 3300005459 Bacteria 7746
43 Ga0068867_100013767 3300005459 Bacteria 5727
44 Ga0068867_100098952 3300005459 Bacteria 2224
45 Ga0068853_100011494 3300005539 Bacteria 7196
46 Ga0068853_100099505 3300005539 Bacteria 2569
47 Ga0070672_100035259 3300005543 Bacteria 3803
48 Ga0068855_100005337 3300005563 Bacteria 15685
49 Ga0068857_100253837 3300005577 Bacteria 1613
50 Ga0068854_100215456 3300005578 Bacteria 1517
51 Ga0068864_100094615 3300005618 Bacteria 2641
52 Ga0068863_100075784 3300005841 Bacteria 3183
53 Ga0068858_100178987 3300005842 Bacteria 2001
54 Ga0068860_100022654 3300005843 Bacteria 6072
55 Ga0068862_100179210 3300005844 Bacteria 1901
56 Ga0075363_100000307 3300006048 Bacteria 14382
57 Ga0075364_10045012 3300006051 Bacteria 2872
58 Ga0075362_10011570 3300006177 Bacteria 3481
59 Ga0075366_10000159 3300006195 Bacteria 28617
60 Ga0075366_10014591 3300006195 Bacteria 4488
61 Ga0075366_10031803 3300006195 Bacteria 3106
62 Ga0075370_10000785 3300006353 Bacteria 12689
63 Ga0075429_100005204 3300006880 Bacteria 11186
64 Ga0099823_1000238 3300006944 Bacteria 31780
65 Ga0079104_1000004 3300006946 Bacteria 444549
66 Ga0105240_10000982 3300009093 Bacteria 50884
67 Ga0105240_10002604 3300009093 Bacteria 28864
68 Ga0105243_10000547 3300009148 Bacteria 37977
69 Ga0105243_10031409 3300009148 Bacteria 4095
70 Ga0105242_10001479 3300009176 Bacteria 18502
71 Ga0105242_10056097 3300009176 Bacteria 3223
72 Ga0105248_10017940 3300009177 Bacteria 7811
73 Ga0105237_10015736 3300009545 Bacteria 7865
74 Ga0105238_10064586 3300009551 Bacteria 3660
75 Ga0157319_1000016 3300012497 Bacteria 127256
76 Ga0157373_10011816 3300013100 Bacteria 6414
77 Ga0157371_10000078 3300013102 Bacteria 154095
78 Ga0157370_10008096 3300013104 Bacteria 11381
79 Ga0157369_10002205 3300013105 Bacteria 23461
80 Ga0157374_10000053 3300013296 Bacteria 123609
81 Ga0182008_10010034 3300014497 Bacteria 5084
82 Ga0157379_10014879 3300014968 Bacteria 6825
83 Ga0157376_10056993 3300014969 Bacteria 3267
84 Ga0183362_10001 3300015683 Bacteria 2046624
85 Ga0163161_10000060 3300017792 Bacteria 112916
86 Ga0163161_10016080 3300017792 Bacteria 5223
87 Ga0209784_100612 3300025224 Bacteria 11421
88 Ga0209566_100227 3300025225 Bacteria 54875
89 Ga0209566_102126 3300025225 Bacteria 4040
90 Ga0209674_100210 3300025226 Bacteria 58337
91 Ga0209674_100827 3300025226 Bacteria 10320
92 Ga0209672_100170 3300025228 Bacteria 55173
93 Ga0209672_100283 3300025228 Bacteria 36077
94 Ga0209563_100011 3300025230 Bacteria 1187808
95 Ga0209646_1000046 3300025246 Bacteria 332737
96 Ga0209026_1000918 3300025250 Bacteria 15055
97 Ga0209677_102012 3300025253 Bacteria 8079
98 Ga0209148_1000623 3300025254 Bacteria 31407
99 Ga0209148_1001631 3300025254 Bacteria 10305
100 Ga0209759_1006600 3300025256 Bacteria 3875
101 Ga0209759_1014951 3300025256 Bacteria 2025
102 Ga0209673_1005903 3300025273 Bacteria 6053
103 Ga0209130_1000318 3300025284 Bacteria 56545
104 Ga0209675_1002118 3300025291 Bacteria 10501
105 Ga0209676_1007297 3300025292 Bacteria 5229
106 Ga0209025_1000360 3300025294 Bacteria 97454
107 Ga0209025_1003809 3300025294 Bacteria 13783
108 Ga0209564_1000008 3300025295 Bacteria 953227
109 Ga0209564_1006066 3300025295 Bacteria 6655
110 Ga0209758_1000232 3300025297 Bacteria 117382
111 Ga0209050_1001185 3300025298 Bacteria 30671
112 Ga0209050_1001962 3300025298 Bacteria 19466
113 Ga0209050_1009817 3300025298 Bacteria 4821
114 Ga0209050_1010140 3300025298 Bacteria 4689
115 Ga0209256_1000496 3300025299 Bacteria 57666
116 Ga0209256_1001508 3300025299 Bacteria 23583
117 Ga0207426_1000512 3300025302 Bacteria 56516
118 Ga0209051_1001413 3300025303 Bacteria 20632
119 Ga0209051_1008926 3300025303 Bacteria 5235
120 Ga0209257_1002804 3300025304 Bacteria 16390
121 Ga0209257_1014752 3300025304 Bacteria 3323
122 Ga0207682_10032638 3300025893 Bacteria 2094
123 Ga0207647_10001599 3300025904 Bacteria 17398
124 Ga0207645_10016502 3300025907 Bacteria 4887
125 Ga0207705_10005370 3300025909 Bacteria 9581
126 Ga0207705_10036965 3300025909 Bacteria 3495
127 Ga0207695_10019083 3300025913 Bacteria 7908
128 Ga0207657_10000622 3300025919 Bacteria 37668
129 Ga0207657_10025487 3300025919 Bacteria 5453
130 Ga0207657_10035519 3300025919 Bacteria 4468
131 Ga0207657_10077838 3300025919 Bacteria 2794
132 Ga0207687_10023840 3300025927 Bacteria 4082
133 Ga0207690_10030404 3300025932 Bacteria 3445
134 Ga0207706_10065898 3300025933 Bacteria 3188
135 Ga0207686_10002005 3300025934 Bacteria 11234
136 Ga0207686_10046067 3300025934 Bacteria 2687
137 Ga0207709_10000019 3300025935 Bacteria 402225
138 Ga0207709_10021885 3300025935 Bacteria 3622
139 Ga0207669_10094267 3300025937 Bacteria 1958
140 Ga0207711_10220049 3300025941 Bacteria 1736
141 Ga0207689_10019275 3300025942 Bacteria 5751
142 Ga0207679_10005957 3300025945 Bacteria 7669
143 Ga0207667_10019915 3300025949 Bacteria 7476
144 Ga0207667_10032991 3300025949 Bacteria 5572
145 Ga0207667_10038811 3300025949 Bacteria 5080
146 Ga0207658_10006636 3300025986 Bacteria 7883
147 Ga0207658_10244352 3300025986 Bacteria 1522
148 Ga0207677_10005409 3300026023 Bacteria 6931
149 Ga0207639_10065407 3300026041 Bacteria 2823
150 Ga0207639_10087626 3300026041 Bacteria 2482
151 Ga0207678_10177079 3300026067 Bacteria 1821
152 Ga0207641_10116200 3300026088 Bacteria 2380
153 Ga0207641_10148436 3300026088 Bacteria 2122
154 Ga0207641_10342943 3300026088 Bacteria 1422
155 Ga0207648_10006778 3300026089 Bacteria 11357
156 Ga0207648_10069136 3300026089 Bacteria 3077
157 Ga0207676_10107597 3300026095 Bacteria 2326
158 Ga0207675_100080456 3300026118 Bacteria 3054
159 Ga0207675_100175614 3300026118 Bacteria 2049
160 Ga0207683_10027211 3300026121 Bacteria 4941
161 Ga0207683_10084076 3300026121 Bacteria 2829
162 Ga0207683_10136892 3300026121 Bacteria 2205
163 Ga0209281_1000005 3300027111 Bacteria 1242284
164 Ga0209389_1011446 3300027296 Bacteria 8031
165 Ga0268265_10262313 3300028380 Bacteria 1537
166 Ga0307515_10000944 3300028794 Bacteria 66492
167 Ga0265327_10000746 3300031251 Bacteria 50605
168 Ga0307513_10009393 3300031456 Bacteria 12368
169 Ga0307509_10053194 3300031507 Bacteria 4319
170 Ga0307408_100003993 3300031548 Bacteria 10054
171 Ga0307408_100008571 3300031548 Bacteria 6753
172 Ga0307514_10000823 3300031649 Bacteria 50357
173 Ga0307516_10149908 3300031730 Bacteria 2094
174 Ga0307405_10183794 3300031731 Bacteria 1503
175 Ga0307405_10217743 3300031731 Bacteria 1399
176 Ga0307413_10076527 3300031824 Bacteria 2127
177 Ga0307406_10002603 3300031901 Bacteria 9832
178 Ga0307406_10002719 3300031901 Bacteria 9639
179 Ga0307406_10048548 3300031901 Bacteria 2682
180 Ga0307412_10018640 3300031911 Bacteria 4182
181 Ga0307409_100016348 3300031995 Bacteria 4906
182 Ga0307409_100100066 3300031995 Bacteria 2402
183 Ga0307416_100121933 3300032002 Bacteria 2325
184 Ga0307416_100155070 3300032002 Bacteria 2107
185 Ga0307416_100169443 3300032002 Bacteria 2030
186 Ga0307414_10012349 3300032004 Bacteria 5047
187 Ga0395899_0000023 3300037312 Bacteria 367159
188 Ga0395899_0001126 3300037312 Bacteria 23796
189 Ga0395899_0002639 3300037312 Bacteria 14458
190 Ga0395899_0002926 3300037312 Bacteria 13698
191 Ga0395899_0006373 3300037312 Bacteria 9137
192 Ga0395899_0011024 3300037312 Bacteria 6922
193 Ga0395899_0121618 3300037312 Bacteria 1869
194 Ga0395900_0000019 3300037418 Bacteria 357240
195 Ga0395900_0000363 3300037418 Bacteria 65369
196 Ga0395900_0000483 3300037418 Bacteria 56510
197 Ga0395900_0001577 3300037418 Bacteria 26973
198 Ga0395900_0001969 3300037418 Bacteria 23192
199 Ga0395900_0031030 3300037418 Bacteria 5489
200 Ga0395900_0050527 3300037418 Bacteria 4282
201 Ga0395900_0162570 3300037418 Bacteria 2276
202 Ga0395898_0000016 3300037466 Bacteria 435585
203 Ga0395898_0005276 3300037466 Bacteria 13970
204 Ga0395898_0011459 3300037466 Bacteria 9209
205 Ga0395898_0035532 3300037466 Bacteria 4953
206 Ga0395898_0046557 3300037466 Bacteria 4261
207 Ga0395898_0072649 3300037466 Bacteria 3323
208 Ga0395898_0177262 3300037466 Bacteria 2037
209 Ga0395905_0021521 3300037471 Bacteria 6097
210 Ga0395905_0026226 3300037471 Bacteria 5495
211 Ga0395905_0094347 3300037471 Bacteria 2807
212 Ga0395905_0164114 3300037471 Bacteria 2087
213 Ga0395901_0000038 3300038443 Bacteria 210534
214 Ga0395901_0001589 3300038443 Bacteria 23506
215 Ga0395901_0005200 3300038443 Bacteria 13133
216 Ga0395901_0064774 3300038443 Bacteria 3804
217 Ga0436361_1176026 3300039447 Bacteria 1808
218 Ga0439448_0001418 3300042005 Bacteria 6189
219 Ga0466969_0019855 3300044656 Bacteria 3485
220 Ga0466969_0021565 3300044656 Bacteria 3329
221 Ga0466972_0017724 3300044658 Bacteria 3563
222 Ga0466978_0003338 3300044671 Bacteria 7331
223 Ga0466982_0010653 3300044672 Bacteria 4791
224 Ga0466965_0018804 3300044683 Bacteria 3315
225 Ga0466965_0020212 3300044683 Bacteria 3199
226 Ga0466966_0000143 3300044684 Bacteria 45651
227 Ga0466966_0014619 3300044684 Bacteria 5196
228 Ga0466961_0000413 3300044693 Bacteria 27243
229 Ga0466961_0031790 3300044693 Bacteria 3393
230 Ga0466961_0041705 3300044693 Bacteria 2942
231 Ga0466961_0051098 3300044693 Bacteria 2641
232 Ga0466963_0021881 3300044694 Bacteria 4041
233 Ga0466964_0000287 3300044706 Bacteria 14783
234 Ga0466964_0004083 3300044706 Bacteria 5372
235 Ga0466964_0005309 3300044706 Bacteria 4781
236 Ga0453684_0024224 3300044712 Bacteria 8883
237 Ga0466971_0006003 3300044719 Bacteria 5284
238 Ga0466971_0022159 3300044719 Bacteria 2829
239 Ga0466971_0036758 3300044719 Bacteria 2196
240 Ga0466968_0013924 3300044735 Bacteria 3170
241 Ga0466970_0000237 3300044765 Bacteria 27023
242 Ga0466957_0003630 3300044842 Bacteria 8505
243 Ga0466957_0013034 3300044842 Bacteria 4816
244 Ga0466959_0004248 3300045049 Bacteria 9559
245 Ga0466959_0005842 3300045049 Bacteria 8472
246 Ga0466959_0032904 3300045049 Bacteria 3837
247 Ga0466959_0139419 3300045049 Bacteria 1715
248 Ga0451576_0061863 3300045051 Bacteria 3904
249 Ga0466958_0009906 3300045836 Bacteria 5322
250 Ga0466958_0024256 3300045836 Bacteria 3568
251 Ga0466967_0009026 3300045976 Bacteria 7369
252 Ga0466967_0011697 3300045976 Bacteria 6670
253 Ga0495617_000116 3300046452 Bacteria 55671
254 Ga0495617_000167 3300046452 Bacteria 41872
255 Ga0495627_000707 3300046453 Bacteria 25434
256 Ga0495590_0000033 3300046457 Bacteria 133950
257 Ga0495590_0010446 3300046457 Bacteria 3490
258 Ga0495591_000487 3300046458 Bacteria 31425
259 Ga0495638_0016828 3300046460 Bacteria 4889
260 Ga0495653_0063492 3300046463 Bacteria 2786
261 Ga0495580_0143872 3300046472 Bacteria 1652
262 Ga0495582_0003552 3300046473 Bacteria 8790
263 Ga0495582_0004731 3300046473 Bacteria 7651
264 Ga0495605_0000064 3300046474 Bacteria 140769
265 Ga0495605_0000286 3300046474 Bacteria 55733
266 Ga0495605_0003045 3300046474 Bacteria 10116
267 Ga0495605_0082599 3300046474 Bacteria 1500
268 Ga0495639_0071709 3300046475 Bacteria 1600
269 Ga0495584_0000006 3300046491 Bacteria 301775
270 Ga0495584_0000265 3300046491 Bacteria 37425
271 Ga0495584_0004941 3300046491 Bacteria 7111
272 Ga0495584_0034153 3300046491 Bacteria 2573
273 Ga0495585_0000061 3300046492 Bacteria 110727
274 Ga0495585_0000207 3300046492 Bacteria 61587
275 Ga0495585_0000265 3300046492 Bacteria 52393
276 Ga0495585_0000815 3300046492 Bacteria 27025
277 Ga0495585_0000972 3300046492 Bacteria 24063
278 Ga0495585_0008063 3300046492 Bacteria 6403
279 Ga0495585_0017940 3300046492 Bacteria 4083
280 Ga0495585_0021568 3300046492 Bacteria 3698
281 Ga0495585_0033007 3300046492 Bacteria 2932
282 Ga0495585_0034772 3300046492 Bacteria 2848
283 Ga0495594_0005542 3300046499 Bacteria 6483
284 Ga0495594_0005717 3300046499 Bacteria 6390
285 Ga0495596_0000031 3300046500 Bacteria 102612
286 Ga0495596_0000596 3300046500 Bacteria 22661
287 Ga0495596_0005046 3300046500 Bacteria 6301
288 Ga0495596_0010731 3300046500 Bacteria 3977
289 Ga0495596_0033771 3300046500 Bacteria 2035
290 Ga0495607_0000742 3300046501 Bacteria 31272
291 Ga0495607_0002695 3300046501 Bacteria 14173
292 Ga0495607_0003646 3300046501 Bacteria 11689
293 Ga0495607_0004470 3300046501 Bacteria 10256
294 Ga0495607_0005537 3300046501 Bacteria 9009
295 Ga0495607_0011202 3300046501 Bacteria 5984
296 Ga0495607_0011961 3300046501 Bacteria 5746
297 Ga0495607_0024775 3300046501 Bacteria 3736
298 Ga0495583_0000121 3300046506 Bacteria 132793
299 Ga0495583_0000885 3300046506 Bacteria 35926
300 Ga0495583_0001244 3300046506 Bacteria 27002
301 Ga0495583_0002234 3300046506 Bacteria 17059
302 Ga0495583_0006994 3300046506 Bacteria 7225
303 Ga0495583_0031370 3300046506 Bacteria 2576
304 Ga0495583_0082743 3300046506 Bacteria 1392
305 Ga0495610_0003167 3300046512 Bacteria 13048
306 Ga0495616_0000453 3300046513 Bacteria 31306
307 Ga0495616_0000574 3300046513 Bacteria 27725
308 Ga0495616_0001983 3300046513 Bacteria 13776
309 Ga0495616_0002837 3300046513 Bacteria 11296
310 Ga0495616_0008751 3300046513 Bacteria 5966
311 Ga0495616_0010002 3300046513 Bacteria 5510
312 Ga0495616_0011986 3300046513 Bacteria 4935
313 Ga0495616_0022238 3300046513 Bacteria 3425
314 Ga0495616_0031229 3300046513 Bacteria 2791
315 Ga0495616_0041448 3300046513 Bacteria 2348
316 Ga0495620_0023168 3300046515 Bacteria 2975
317 Ga0495631_0000047 3300046518 Bacteria 74243
318 Ga0495631_0000689 3300046518 Bacteria 21859
319 Ga0495631_0004290 3300046518 Bacteria 7608
320 Ga0495631_0006424 3300046518 Bacteria 6065
321 Ga0495631_0018175 3300046518 Bacteria 3313
322 Ga0495631_0021450 3300046518 Bacteria 3008
323 Ga0495632_0000435 3300046519 Bacteria 39771
324 Ga0495632_0003786 3300046519 Bacteria 10569
325 Ga0495632_0007206 3300046519 Bacteria 7022
326 Ga0495632_0018920 3300046519 Bacteria 3762
327 Ga0495632_0044227 3300046519 Bacteria 2223
328 Ga0495637_0000221 3300046520 Bacteria 43880
329 Ga0495637_0004533 3300046520 Bacteria 7188
330 Ga0495637_0004976 3300046520 Bacteria 6838
331 Ga0495643_0000158 3300046522 Bacteria 110592
332 Ga0495643_0002050 3300046522 Bacteria 16731
333 Ga0495643_0005876 3300046522 Bacteria 8207
334 Ga0495643_0018605 3300046522 Bacteria 4033
335 Ga0495643_0053745 3300046522 Bacteria 2158
336 Ga0495644_0008455 3300046523 Bacteria 3965
337 Ga0495644_0008648 3300046523 Bacteria 3919
338 Ga0495644_0008753 3300046523 Bacteria 3893
339 Ga0495644_0020427 3300046523 Bacteria 2528
340 Ga0495644_0041551 3300046523 Bacteria 1731
341 Ga0495648_0000096 3300046524 Bacteria 110227
342 Ga0495648_0005009 3300046524 Bacteria 11128
343 Ga0495666_0007288 3300046526 Bacteria 5548
344 Ga0495642_0001030 3300046528 Bacteria 12944
345 Ga0495642_0001119 3300046528 Bacteria 12351
346 Ga0495642_0020444 3300046528 Bacteria 2600
347 Ga0495642_0030748 3300046528 Bacteria 2149
348 Ga0495654_0006903 3300046530 Bacteria 6403
349 Ga0495654_0039490 3300046530 Bacteria 2356
350 Ga0495665_0001390 3300046531 Bacteria 12944
351 Ga0495640_0141027 3300046533 Bacteria 1554
352 Ga0495586_0004392 3300046535 Bacteria 7532
353 Ga0495586_0103597 3300046535 Bacteria 1580
354 Ga0495587_0114457 3300046536 Bacteria 1547
355 Ga0495609_0000007 3300046538 Bacteria 398812
356 Ga0495609_0006585 3300046538 Bacteria 5914
357 Ga0495609_0015942 3300046538 Bacteria 3507
358 Ga0495609_0018094 3300046538 Bacteria 3269
359 Ga0495597_0000142 3300046542 Bacteria 64212
360 Ga0495597_0000783 3300046542 Bacteria 25099
361 Ga0495597_0006408 3300046542 Bacteria 6091
362 Ga0495597_0020045 3300046542 Bacteria 3120
363 Ga0495597_0022067 3300046542 Bacteria 2954
364 Ga0495622_0004865 3300046557 Bacteria 6219
365 Ga0495622_0026323 3300046557 Bacteria 2716
366 Ga0495633_0001892 3300046558 Bacteria 15275
367 Ga0495633_0003368 3300046558 Bacteria 10710
368 Ga0495633_0004889 3300046558 Bacteria 8371
369 Ga0495633_0023644 3300046558 Bacteria 3042
370 Ga0495633_0027206 3300046558 Bacteria 2796
371 Ga0495656_0000042 3300046615 Bacteria 62167
372 Ga0495668_0000897 3300046616 Bacteria 33506
373 Ga0495668_0001114 3300046616 Bacteria 27719
374 Ga0495668_0009478 3300046616 Bacteria 5978
375 Ga0495668_0022910 3300046616 Bacteria 3566
376 Ga0495611_0000071 3300046648 Bacteria 70920
377 Ga0495611_0002754 3300046648 Bacteria 7889
378 Ga0495611_0013947 3300046648 Bacteria 3428
379 Ga0495625_0086165 3300046660 Bacteria 2179
380 Ga0495635_0003855 3300046663 Bacteria 10417
381 Ga0495661_0000062 3300046665 Bacteria 130151
382 Ga0495661_0000856 3300046665 Bacteria 28337
383 Ga0495661_0003794 3300046665 Bacteria 11058
384 Ga0495661_0012324 3300046665 Bacteria 5773
385 Ga0495661_0022507 3300046665 Bacteria 4100
386 Ga0495661_0046578 3300046665 Bacteria 2646
387 Ga0495661_0047183 3300046665 Bacteria 2624
388 Ga0495661_0049387 3300046665 Bacteria 2551
389 Ga0495661_0055072 3300046665 Bacteria 2385
390 Ga0495588_0000147 3300046674 Bacteria 100948
391 Ga0495588_0007001 3300046674 Bacteria 5111
392 Ga0495588_0009256 3300046674 Bacteria 4548
393 Ga0495588_0021277 3300046674 Bacteria 3195
394 Ga0495588_0054020 3300046674 Bacteria 2072
395 Ga0495623_0022147 3300046679 Bacteria 4104
396 Ga0495669_0000124 3300046684 Bacteria 49700
397 Ga0495669_0002126 3300046684 Bacteria 8125
398 Ga0495669_0004456 3300046684 Bacteria 5783
399 Ga0495613_0115713 3300046689 Bacteria 1929
400 Ga0495670_0002320 3300046691 Bacteria 9400
401 Ga0495670_0009393 3300046691 Bacteria 4807
402 Ga0495670_0016136 3300046691 Bacteria 3672
403 Ga0495670_0065516 3300046691 Bacteria 1831
404 Ga0495671_0001845 3300046692 Bacteria 13633
405 Ga0495649_0000358 3300046694 Bacteria 39351
406 Ga0495649_0002781 3300046694 Bacteria 12175
407 Ga0495649_0010844 3300046694 Bacteria 5366
408 Ga0495589_0000020 3300046794 Bacteria 199645
409 Ga0495589_0000359 3300046794 Bacteria 35371
410 Ga0495589_0001946 3300046794 Bacteria 11688
411 Ga0495589_0002158 3300046794 Bacteria 11082
412 Ga0495589_0002352 3300046794 Bacteria 10613
413 Ga0495589_0018627 3300046794 Bacteria 3559
414 Ga0495589_0037292 3300046794 Bacteria 2435
415 Ga0495589_0038529 3300046794 Bacteria 2392
416 Ga0495589_0063725 3300046794 Bacteria 1808
417 Ga0495600_0154392 3300046809 Bacteria 1485
418 Ga0495660_0000299 3300046810 Bacteria 45148
419 Ga0495660_0004418 3300046810 Bacteria 8512
420 Ga0495660_0012680 3300046810 Bacteria 4891
421 Ga0495660_0014935 3300046810 Bacteria 4492
422 Ga0495660_0018483 3300046810 Bacteria 4008
423 Ga0495581_0047500 3300047315 Bacteria 2481
424 Ga0495581_0082568 3300047315 Bacteria 1861
425 Ga0495604_0093661 3300047317 Bacteria 2222
426 Ga0495604_0127598 3300047317 Bacteria 1832
427 Ga0495672_0000148 3300047320 Bacteria 101427
428 Ga0495672_0001124 3300047320 Bacteria 27126
429 Ga0495672_0010131 3300047320 Bacteria 6741
430 Ga0495672_0012104 3300047320 Bacteria 6040
431 Ga0495676_0000015 3300047321 Bacteria 199492
432 Ga0495676_0017902 3300047321 Bacteria 6254
433 Ga0495680_0008411 3300047322 Bacteria 9386
434 Ga0495680_0107406 3300047322 Bacteria 2073
435 Ga0495683_0000041 3300047323 Bacteria 137557
436 Ga0495683_0000104 3300047323 Bacteria 87180
437 Ga0495683_0004819 3300047323 Bacteria 7570
438 Ga0495687_000005 3300047443 Bacteria 610401
439 Ga0495687_000038 3300047443 Bacteria 251616
440 Ga0495687_000103 3300047443 Bacteria 128840
441 Ga0495687_000269 3300047443 Bacteria 69487
442 Ga0495687_001224 3300047443 Bacteria 24532
443 Ga0495687_006895 3300047443 Bacteria 6842
444 Ga0495675_0003256 3300047444 Bacteria 9751
445 Ga0495675_0007145 3300047444 Bacteria 6874
446 Ga0495677_0000004 3300047445 Bacteria 248210
447 Ga0495677_0000192 3300047445 Bacteria 28391
448 Ga0495677_0000266 3300047445 Bacteria 22942
449 Ga0495677_0001975 3300047445 Bacteria 8183
450 Ga0495677_0004101 3300047445 Bacteria 5626
451 Ga0495679_000667 3300047446 Bacteria 22623
452 Ga0495679_002591 3300047446 Bacteria 9088
453 Ga0495679_037203 3300047446 Bacteria 1532
454 Ga0495685_005581 3300047447 Bacteria 4108
455 Ga0495681_0015810 3300047470 Bacteria 4258
456 Ga0495681_0018846 3300047470 Bacteria 3787
457 Ga0495686_0000963 3300047472 Bacteria 35463
458 Ga0495686_0001203 3300047472 Bacteria 29874
459 Ga0495686_0107152 3300047472 Bacteria 1679
460 Ga0495614_0002022 3300048089 Bacteria 8913
461 Ga0495614_0009349 3300048089 Bacteria 4336
462 Ga0495626_0000022 3300048091 Bacteria 216166
463 Ga0495626_0001509 3300048091 Bacteria 18340
464 Ga0495626_0001755 3300048091 Bacteria 16509
465 Ga0495626_0003410 3300048091 Bacteria 10216
466 Ga0495626_0004100 3300048091 Bacteria 9055
467 Ga0495626_0006772 3300048091 Bacteria 6479
468 Ga0495626_0006800 3300048091 Bacteria 6463
469 Ga0495626_0012655 3300048091 Bacteria 4413
470 Ga0495626_0015327 3300048091 Bacteria 3928
471 Ga0495626_0040317 3300048091 Bacteria 2206
472 Ga0496101_0018540 3300048904 Bacteria 4734
473 Ga0496102_0000953 3300048905 Bacteria 27244
474 Ga0496104_0154372 3300048907 Bacteria 2203
475 Ga0496105_0017536 3300048908 Bacteria 5743
476 Ga0496106_0040467 3300048909 Bacteria 3491
477 Ga0496109_0003564 3300048912 Bacteria 13000
478 Ga0496109_0013744 3300048912 Bacteria 7034
479 Ga0496109_0136901 3300048912 Bacteria 2289
480 Ga0496110_0000009 3300048913 Bacteria 111367
481 Ga0496110_0036834 3300048913 Bacteria 4250
482 Ga0496112_0011119 3300048915 Bacteria 8204
483 Ga0496112_0360517 3300048915 Bacteria 1396
484 Ga0496113_0020813 3300048916 Bacteria 4619
485 Ga0496114_0072840 3300048917 Bacteria 2890
486 Ga0496115_0017163 3300048918 Bacteria 5525
487 Ga0496122_0000127 3300048925 Bacteria 178260
488 Ga0496122_0000238 3300048925 Bacteria 123588
489 Ga0496123_0000084 3300048926 Bacteria 187479
490 Ga0496123_0000257 3300048926 Bacteria 107629
491 Ga0496123_0060972 3300048926 Bacteria 2428
492 Ga0496124_0002142 3300048927 Bacteria 26508
493 Ga0496124_0007256 3300048927 Bacteria 11823
494 Ga0496125_0000233 3300048928 Bacteria 113820
495 Ga0496125_0005968 3300048928 Bacteria 13334
496 Ga0495678_000164 3300049459 Bacteria 77961
497 Ga0495678_000819 3300049459 Bacteria 27851
498 Ga0495678_015226 3300049459 Bacteria 3548
499 Ga0495678_015936 3300049459 Bacteria 3448
500 Ga0495682_0000582 3300049460 Bacteria 24765
501 Ga0495682_0007677 3300049460 Bacteria 4279
502 Ga0495682_0016645 3300049460 Bacteria 2782
503 Ga0501031_0011047 3300049568 Bacteria 5884
504 Ga0501043_0000012 3300049579 Bacteria 188907
505 Ga0501046_0000030 3300049580 Bacteria 187803
506 Ga0501047_0000049 3300049581 Bacteria 162513
507 Ga0501047_0012393 3300049581 Bacteria 8069
508 Ga0501048_0000082 3300049582 Bacteria 49693
509 Ga0501068_0025556 3300049584 Bacteria 3474
510 Ga0501069_0010091 3300049585 Bacteria 4994
511 Ga0501070_0000471 3300049586 Bacteria 36618
512 Ga0501073_0004619 3300049589 Bacteria 10347
513 Ga0501074_0000233 3300049590 Bacteria 30989
514 Ga0501198_000001 3300049649 Bacteria 234552
515 Ga0501222_000013 3300049662 Bacteria 87490
516 Ga0501079_0007605 3300049741 Bacteria 8208
517 Ga0501080_0005747 3300049742 Bacteria 11093
518 Ga0501083_0000944 3300049744 Bacteria 19228
519 Ga0501035_0006551 3300049822 Bacteria 10922
520 Ga0501035_0033120 3300049822 Bacteria 4699
521 Ga0501044_0001216 3300049823 Bacteria 30550
522 Ga0501045_0017067 3300049824 Bacteria 5155
523 nmdc:mga03683_29046_c1 3300050489 Bacteria 2203
524 nmdc:mga03683_3442_c1 3300050489 Bacteria 5109
525 nmdc:mga03n38_4211_c1 3300050490 Bacteria 4730
526 nmdc:mga0yw44_132885_c1 3300050492 Bacteria 1612
527 nmdc:mga0k408_25214_c1 3300050493 Bacteria 2824
528 nmdc:mga0k408_265_c1 3300050493 Bacteria 28616
529 nmdc:mga07m45_102_c1 3300050496 Bacteria 33231
530 nmdc:mga09592_4479_c1 3300050508 Bacteria 11299
531 Ga0500651_0014799 3300053093 Bacteria 4777
532 Ga0500559_0000251 3300053136 Bacteria 42552
533 Ga0500619_000018 3300053154 Bacteria 52926
534 Ga0500622_0000866 3300053156 Bacteria 25758
535 Ga0466962_0001020 3300061719 Bacteria 12802
536 Ga0466962_0041904 3300061719 Bacteria 2190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100031603 Ga0070660_1000316032 372
2 3300005366 Ga0070659_100061573 Ga0070659_1000615732 372
3 3300025919 Ga0207657_10025487 Ga0207657_100254872 372
4 3300048927 Ga0496124_0007256 Ga0496124_0007256_2040_3260 372
5 3300044658 Ga0466972_0017724 Ga0466972_0017724_2059_3276 373
6 3300044683 Ga0466965_0018804 Ga0466965_0018804_1891_3108 373
7 3300044706 Ga0466964_0004083 Ga0466964_0004083_2225_3442 373
8 3300044735 Ga0466968_0013924 Ga0466968_0013924_1794_3011 373
9 3300044842 Ga0466957_0003630 Ga0466957_0003630_315_1532 373
10 3300037312 Ga0395899_0002639 Ga0395899_0002639_1899_3110 375
11 3300037418 Ga0395900_0000363 Ga0395900_0000363_52711_53922 375
12 3300038443 Ga0395901_0000038 Ga0395901_0000038_44347_45612 376
13 3300044684 Ga0466966_0000143 Ga0466966_0000143_17021_18289 376
14 3300044693 Ga0466961_0051098 Ga0466961_0051098_1288_2556 376
15 3300044719 Ga0466971_0022159 Ga0466971_0022159_130_1398 376
16 3300045049 Ga0466959_0005842 Ga0466959_0005842_7150_8418 376
17 3300046528 Ga0495642_0001030 Ga0495642_0001030_1878_3089 382
18 3300046501 Ga0495607_0011202 Ga0495607_0011202_3111_4397 383
19 3300046472 Ga0495580_0143872 Ga0495580_0143872_13_1167 384
20 3300046533 Ga0495640_0141027 Ga0495640_0141027_178_1332 384
21 3300046535 Ga0495586_0103597 Ga0495586_0103597_13_1167 384
22 3300046536 Ga0495587_0114457 Ga0495587_0114457_381_1535 384
23 3300048912 Ga0496109_0136901 Ga0496109_0136901_1121_2275 384
24 3300053136 Ga0500559_0000251 Ga0500559_0000251_22054_23271 384
25 3300048926 Ga0496123_0060972 Ga0496123_0060972_826_2061 385
26 3300048928 Ga0496125_0000233 Ga0496125_0000233_2545_3780 385
27 3300005539 Ga0068853_100011494 Ga0068853_1000114944 386
28 3300025919 Ga0207657_10035519 Ga0207657_100355192 386
29 3300049579 Ga0501043_0000012 Ga0501043_0000012_115180_116397 386
30 3300049580 Ga0501046_0000030 Ga0501046_0000030_115152_116369 386
31 3300049581 Ga0501047_0000049 Ga0501047_0000049_89849_91066 386
32 3300049582 Ga0501048_0000082 Ga0501048_0000082_13954_15171 386
33 3300049824 Ga0501045_0017067 Ga0501045_0017067_2519_3736 386
34 3300005331 Ga0070670_100039671 Ga0070670_1000396712 387
35 3300005355 Ga0070671_100019581 Ga0070671_1000195813 387
36 3300005367 Ga0070667_100041650 Ga0070667_1000416503 387
37 3300026118 Ga0207675_100175614 Ga0207675_1001756142 387
38 3300037312 Ga0395899_0002926 Ga0395899_0002926_10164_11375 387
39 3300037418 Ga0395900_0001969 Ga0395900_0001969_3043_4254 387
40 3300037466 Ga0395898_0011459 Ga0395898_0011459_1000_2211 387
41 3300037471 Ga0395905_0164114 Ga0395905_0164114_101_1267 387
42 3300038443 Ga0395901_0005200 Ga0395901_0005200_5009_6220 387
43 3300046457 Ga0495590_0010446 Ga0495590_0010446_1014_2180 387
44 3300049581 Ga0501047_0012393 Ga0501047_0012393_4269_5447 387
45 3300049584 Ga0501068_0025556 Ga0501068_0025556_665_1843 387
46 3300049585 Ga0501069_0010091 Ga0501069_0010091_2708_3886 387
47 3300049586 Ga0501070_0000471 Ga0501070_0000471_8156_9334 387
48 3300049589 Ga0501073_0004619 Ga0501073_0004619_864_2042 387
49 3300049590 Ga0501074_0000233 Ga0501074_0000233_22618_23796 387
50 3300049741 Ga0501079_0007605 Ga0501079_0007605_2538_3716 387
51 3300049742 Ga0501080_0005747 Ga0501080_0005747_2681_3859 387
52 3300049744 Ga0501083_0000944 Ga0501083_0000944_11489_12667 387
53 3300031901 Ga0307406_10048548 Ga0307406_100485482 390
54 3300032002 Ga0307416_100155070 Ga0307416_1001550702 390
55 3300044706 Ga0466964_0000287 Ga0466964_0000287_4576_5787 391
56 3300046501 Ga0495607_0000742 Ga0495607_0000742_3330_4523 391
57 3300046513 Ga0495616_0008751 Ga0495616_0008751_4153_5346 391
58 3300046538 Ga0495609_0000007 Ga0495609_0000007_243806_244999 391
59 3300046665 Ga0495661_0000062 Ga0495661_0000062_5444_6637 391
60 3300046794 Ga0495589_0000020 Ga0495589_0000020_175519_176712 391
61 3300047443 Ga0495687_000038 Ga0495687_000038_243806_244999 391
62 3300047445 Ga0495677_0000004 Ga0495677_0000004_3365_4558 391
63 3300048925 Ga0496122_0000238 Ga0496122_0000238_51217_52434 391
64 3300048926 Ga0496123_0000257 Ga0496123_0000257_72875_74092 391
65 3300053154 Ga0500619_000018 Ga0500619_000018_4488_5723 391
66 3300046679 Ga0495623_0022147 Ga0495623_0022147_2792_4045 392
67 3300002705 JGI25156J39149_1010707 JGI25156J39149_10107072 394
68 3300002738 JGI25154J39366_1002814 JGI25154J39366_10028142 394
69 3300003756 Ga0055533_1003302 Ga0055533_10033023 394
70 3300003762 Ga0055542_1004599 Ga0055542_10045991 394
71 3300037418 Ga0395900_0000483 Ga0395900_0000483_47603_48787 394
72 3300037471 Ga0395905_0094347 Ga0395905_0094347_235_1422 394
73 3300046558 Ga0495633_0001892 Ga0495633_0001892_13651_14835 394
74 iso_pu_bacteria 2831864461 2831865607 394
75 iso_pu_bacteria 2886848708 2886853633 394
76 3300005327 Ga0070658_10269204 Ga0070658_102692041 395
77 3300005339 Ga0070660_100116698 Ga0070660_1001166983 395
78 3300009093 Ga0105240_10002604 Ga0105240_1000260415 395
79 3300009551 Ga0105238_10064586 Ga0105238_100645864 395
80 3300025919 Ga0207657_10077838 Ga0207657_100778383 395
81 3300025949 Ga0207667_10038811 Ga0207667_100388114 395
82 3300045051 Ga0451576_0061863 Ga0451576_0061863_671_1912 395
83 3300050489 nmdc:mga03683_29046_c1 nmdc:mga03683_29046_c1_248_1543 395
84 iso_pu_bacteria 2600255389 2602010350 395
85 iso_pu_bacteria 2738541296 2738824315 395
86 iso_pu_bacteria 2738541298 2738836754 395
87 iso_pu_bacteria 2738541306 2738878285 395
88 iso_pu_bacteria 2738543002 2739189977 395
89 iso_pu_bacteria 2738543008 2739224878 395
90 iso_pu_bacteria 2919501602 2919504719 395
91 iso_pu_bacteria 2926063275 2926066396 395
92 iso_pu_bacteria 8034962539 8034965975 395
93 3300002987 JGI25159J45721_1017784 JGI25159J45721_10177841 396
94 3300003771 Ga0055526_1006558 Ga0055526_10065583 396
95 3300003775 Ga0055524_1000942 Ga0055524_10009427 396
96 3300004625 Ga0055543_1005844 Ga0055543_10058441 396
97 3300005262 Ga0065165_1000177 Ga0065165_100017785 396
98 3300012497 Ga0157319_1000016 Ga0157319_1000016111 396
99 3300025284 Ga0209130_1000318 Ga0209130_100031822 396
100 3300025295 Ga0209564_1000008 Ga0209564_1000008738 396
101 3300025299 Ga0209256_1000496 Ga0209256_100049647 396
102 3300025302 Ga0207426_1000512 Ga0207426_100051222 396
103 3300031548 Ga0307408_100008571 Ga0307408_1000085713 396
104 3300031731 Ga0307405_10217743 Ga0307405_102177432 396
105 3300031824 Ga0307413_10076527 Ga0307413_100765272 396
106 3300031995 Ga0307409_100016348 Ga0307409_1000163484 396
107 3300032002 Ga0307416_100121933 Ga0307416_1001219332 396
108 iso_pu_bacteria 2939631187 2939633244 396
109 3300005356 Ga0070674_100050915 Ga0070674_1000509153 397
110 3300005578 Ga0068854_100215456 Ga0068854_1002154562 397
111 3300006195 Ga0075366_10014591 Ga0075366_100145912 397
112 3300028380 Ga0268265_10262313 Ga0268265_102623131 397
113 3300044656 Ga0466969_0019855 Ga0466969_0019855_1105_2322 397
114 3300044683 Ga0466965_0020212 Ga0466965_0020212_1173_2390 397
115 3300044719 Ga0466971_0036758 Ga0466971_0036758_59_1276 397
116 3300045049 Ga0466959_0032904 Ga0466959_0032904_313_1530 397
117 3300048918 Ga0496115_0017163 Ga0496115_0017163_4190_5383 397
118 iso_pu_bacteria 2547132374 2548498448 397
119 iso_pu_bacteria 2643221570 2643867007 397
120 iso_pu_bacteria 2643221596 2643992191 397
121 iso_pu_bacteria 2643221609 2644058516 397
122 iso_pu_bacteria 2643221652 2644294870 397
123 iso_pu_bacteria 2643221654 2644301817 397
124 iso_pu_bacteria 2643221717 2644646387 397
125 iso_pu_bacteria 2842733646 2842734920 397
126 iso_pu_bacteria 2881101125 2881101268 397
127 iso_pu_bacteria 2904541872 2904546569 397
128 iso_pu_bacteria 2929160207 2929166023 397
129 iso_pu_bacteria 2945909444 2945912752 397
130 iso_pu_bacteria 2945984333 2945984977 397
131 iso_pu_bacteria 2990710928 2990712997 397
132 3300031507 Ga0307509_10053194 Ga0307509_100531943 398
133 3300031731 Ga0307405_10183794 Ga0307405_101837942 398
134 3300037312 Ga0395899_0001126 Ga0395899_0001126_8042_9253 398
135 3300037418 Ga0395900_0162570 Ga0395900_0162570_280_1491 398
136 3300037466 Ga0395898_0005276 Ga0395898_0005276_10824_12035 398
137 3300038443 Ga0395901_0064774 Ga0395901_0064774_1936_3147 398
138 3300046457 Ga0495590_0000033 Ga0495590_0000033_12508_13704 398
139 3300046458 Ga0495591_000487 Ga0495591_000487_18758_19954 398
140 3300046460 Ga0495638_0016828 Ga0495638_0016828_1129_2325 398
141 3300046474 Ga0495605_0082599 Ga0495605_0082599_88_1284 398
142 3300046491 Ga0495584_0000265 Ga0495584_0000265_26793_27989 398
143 3300046500 Ga0495596_0010731 Ga0495596_0010731_2205_3401 398
144 3300046501 Ga0495607_0003646 Ga0495607_0003646_5188_6384 398
145 3300046506 Ga0495583_0000885 Ga0495583_0000885_26973_28169 398
146 3300046506 Ga0495583_0031370 Ga0495583_0031370_1029_2225 398
147 3300046506 Ga0495583_0082743 Ga0495583_0082743_130_1326 398
148 3300046512 Ga0495610_0003167 Ga0495610_0003167_8810_10006 398
149 3300046513 Ga0495616_0041448 Ga0495616_0041448_1106_2302 398
150 3300046518 Ga0495631_0000689 Ga0495631_0000689_16648_17844 398
151 3300046518 Ga0495631_0021450 Ga0495631_0021450_1692_2888 398
152 3300046519 Ga0495632_0007206 Ga0495632_0007206_521_1717 398
153 3300046520 Ga0495637_0000221 Ga0495637_0000221_28350_29546 398
154 3300046522 Ga0495643_0005876 Ga0495643_0005876_1400_2596 398
155 3300046528 Ga0495642_0020444 Ga0495642_0020444_636_1832 398
156 3300046528 Ga0495642_0030748 Ga0495642_0030748_338_1534 398
157 3300046542 Ga0495597_0020045 Ga0495597_0020045_148_1344 398
158 3300046558 Ga0495633_0003368 Ga0495633_0003368_765_1961 398
159 3300046648 Ga0495611_0000071 Ga0495611_0000071_27908_29104 398
160 3300046648 Ga0495611_0002754 Ga0495611_0002754_4528_5724 398
161 3300046665 Ga0495661_0055072 Ga0495661_0055072_10_1206 398
162 3300046694 Ga0495649_0000358 Ga0495649_0000358_25729_26925 398
163 3300046794 Ga0495589_0018627 Ga0495589_0018627_1247_2443 398
164 3300046810 Ga0495660_0004418 Ga0495660_0004418_7139_8335 398
165 3300047320 Ga0495672_0000148 Ga0495672_0000148_28251_29447 398
166 3300047323 Ga0495683_0000104 Ga0495683_0000104_11556_12752 398
167 3300047445 Ga0495677_0000192 Ga0495677_0000192_9470_10666 398
168 3300047446 Ga0495679_037203 Ga0495679_037203_138_1334 398
169 3300047472 Ga0495686_0000963 Ga0495686_0000963_19682_20878 398
170 3300048091 Ga0495626_0001755 Ga0495626_0001755_11620_12816 398
171 3300049459 Ga0495678_000164 Ga0495678_000164_7443_8639 398
172 3300049459 Ga0495678_015936 Ga0495678_015936_2117_3313 398
173 3300049460 Ga0495682_0000582 Ga0495682_0000582_13187_14383 398
174 3300049460 Ga0495682_0007677 Ga0495682_0007677_1860_3056 398
175 3300049460 Ga0495682_0016645 Ga0495682_0016645_578_1774 398
176 iso_pu_bacteria 2585428057 2587727844 398
177 iso_pu_bacteria 2585428058 2587733842 398
178 iso_pu_bacteria 2588253510 2588292383 398
179 3300003187 JGI25151J46595_10001832 JGI25151J46595_100018328 399
180 3300005289 Ga0065704_10001178 Ga0065704_100011789 399
181 3300005338 Ga0068868_100027724 Ga0068868_1000277244 399
182 3300005367 Ga0070667_100011958 Ga0070667_1000119584 399
183 3300005456 Ga0070678_100192030 Ga0070678_1001920302 399
184 3300005459 Ga0068867_100013767 Ga0068867_1000137673 399
185 3300006944 Ga0099823_1000238 Ga0099823_10002384 399
186 3300017792 Ga0163161_10016080 Ga0163161_100160802 399
187 3300025273 Ga0209673_1005903 Ga0209673_10059032 399
188 3300025294 Ga0209025_1000360 Ga0209025_10003605 399
189 3300025298 Ga0209050_1001185 Ga0209050_10011852 399
190 3300025299 Ga0209256_1001508 Ga0209256_10015083 399
191 3300025303 Ga0209051_1001413 Ga0209051_10014132 399
192 3300025304 Ga0209257_1002804 Ga0209257_100280414 399
193 3300025907 Ga0207645_10016502 Ga0207645_100165024 399
194 3300025986 Ga0207658_10006636 Ga0207658_100066365 399
195 3300026023 Ga0207677_10005409 Ga0207677_100054092 399
196 3300026067 Ga0207678_10177079 Ga0207678_101770792 399
197 3300027296 Ga0209389_1011446 Ga0209389_10114466 399
198 3300031901 Ga0307406_10002719 Ga0307406_1000271910 399
199 3300031995 Ga0307409_100100066 Ga0307409_1001000661 399
200 3300032002 Ga0307416_100169443 Ga0307416_1001694431 399
201 3300032004 Ga0307414_10012349 Ga0307414_100123492 399
202 3300046475 Ga0495639_0071709 Ga0495639_0071709_361_1575 399
203 3300046492 Ga0495585_0000972 Ga0495585_0000972_13480_14688 399
204 3300047443 Ga0495687_006895 Ga0495687_006895_3031_4230 399
205 3300048907 Ga0496104_0154372 Ga0496104_0154372_611_1918 399
206 3300048908 Ga0496105_0017536 Ga0496105_0017536_4279_5586 399
207 3300048912 Ga0496109_0013744 Ga0496109_0013744_3480_4679 399
208 3300048917 Ga0496114_0072840 Ga0496114_0072840_936_2135 399
209 iso_pu_bacteria 2643221611 2644075898 399
210 iso_pu_bacteria 2842718218 2842721062 399
211 iso_pu_bacteria 2919476304 2919477203 399
212 iso_pu_bacteria 2974320154 2974323972 399
213 3300005331 Ga0070670_100084589 Ga0070670_1000845891 400
214 3300005456 Ga0070678_100095625 Ga0070678_1000956252 400
215 3300005459 Ga0068867_100007440 Ga0068867_1000074402 400
216 3300005539 Ga0068853_100099505 Ga0068853_1000995052 400
217 3300014497 Ga0182008_10010034 Ga0182008_100100343 400
218 3300017792 Ga0163161_10000060 Ga0163161_1000006021 400
219 3300025298 Ga0209050_1010140 Ga0209050_10101404 400
220 3300025893 Ga0207682_10032638 Ga0207682_100326382 400
221 3300025986 Ga0207658_10244352 Ga0207658_102443522 400
222 3300026041 Ga0207639_10087626 Ga0207639_100876262 400
223 3300026089 Ga0207648_10006778 Ga0207648_100067784 400
224 3300026121 Ga0207683_10027211 Ga0207683_100272113 400
225 3300031911 Ga0307412_10018640 Ga0307412_100186402 400
226 3300046522 Ga0495643_0053745 Ga0495643_0053745_581_1783 400
227 3300048928 Ga0496125_0005968 Ga0496125_0005968_11863_13074 400
228 3300003759 Ga0055525_1000018 Ga0055525_1000018196 401
229 3300005459 Ga0068867_100098952 Ga0068867_1000989522 401
230 3300005577 Ga0068857_100253837 Ga0068857_1002538372 401
231 3300005842 Ga0068858_100178987 Ga0068858_1001789871 401
232 3300005844 Ga0068862_100179210 Ga0068862_1001792102 401
233 3300025230 Ga0209563_100011 Ga0209563_100011895 401
234 3300025253 Ga0209677_102012 Ga0209677_1020123 401
235 3300025942 Ga0207689_10019275 Ga0207689_100192754 401
236 3300026089 Ga0207648_10069136 Ga0207648_100691363 401
237 3300026118 Ga0207675_100080456 Ga0207675_1000804563 401
238 3300026121 Ga0207683_10084076 Ga0207683_100840763 401
239 3300031456 Ga0307513_10009393 Ga0307513_100093935 401
240 3300031548 Ga0307408_100003993 Ga0307408_1000039934 401
241 3300031901 Ga0307406_10002603 Ga0307406_100026037 401
242 3300037418 Ga0395900_0031030 Ga0395900_0031030_2600_3811 401
243 3300037466 Ga0395898_0046557 Ga0395898_0046557_493_1704 401
244 3300044656 Ga0466969_0021565 Ga0466969_0021565_75_1283 401
245 3300044684 Ga0466966_0014619 Ga0466966_0014619_1188_2396 401
246 3300044706 Ga0466964_0005309 Ga0466964_0005309_688_1896 401
247 3300044712 Ga0453684_0024224 Ga0453684_0024224_2240_3448 401
248 3300045836 Ga0466958_0024256 Ga0466958_0024256_1343_2551 401
249 3300046674 Ga0495588_0007001 Ga0495588_0007001_1305_2510 401
250 3300046794 Ga0495589_0063725 Ga0495589_0063725_468_1676 401
251 3300047443 Ga0495687_000005 Ga0495687_000005_328103_329311 401
252 3300048913 Ga0496110_0036834 Ga0496110_0036834_1566_2771 401
253 iso_pu_bacteria 2643221556 2643799554 401
254 iso_pu_bacteria 2643221684 2644471644 401
255 iso_pu_bacteria 2721755523 2722884488 401
256 iso_pu_bacteria 2839138175 2839143084 401
257 iso_pu_bacteria 8047673197 8047675945 401
258 3300003215 JGI25153J46596_10001224 JGI25153J46596_1000122412 402
259 3300003791 Ga0055530_10025047 Ga0055530_100250472 402
260 3300005347 Ga0070668_100038935 Ga0070668_1000389353 402
261 3300005841 Ga0068863_100075784 Ga0068863_1000757842 402
262 3300005843 Ga0068860_100022654 Ga0068860_1000226545 402
263 3300006051 Ga0075364_10045012 Ga0075364_100450122 402
264 3300014969 Ga0157376_10056993 Ga0157376_100569933 402
265 3300025297 Ga0209758_1000232 Ga0209758_100023251 402
266 3300025298 Ga0209050_1001962 Ga0209050_10019623 402
267 3300026088 Ga0207641_10116200 Ga0207641_101162001 402
268 3300026088 Ga0207641_10342943 Ga0207641_103429431 402
269 3300037466 Ga0395898_0177262 Ga0395898_0177262_485_1693 402
270 3300037471 Ga0395905_0026226 Ga0395905_0026226_288_1496 402
271 3300046492 Ga0495585_0000815 Ga0495585_0000815_19080_20288 402
272 3300046499 Ga0495594_0005717 Ga0495594_0005717_5011_6219 402
273 3300046518 Ga0495631_0018175 Ga0495631_0018175_717_1925 402
274 3300046523 Ga0495644_0008455 Ga0495644_0008455_720_1928 402
275 3300046558 Ga0495633_0023644 Ga0495633_0023644_290_1498 402
276 3300046616 Ga0495668_0001114 Ga0495668_0001114_18652_19860 402
277 3300046665 Ga0495661_0012324 Ga0495661_0012324_2758_3966 402
278 3300046665 Ga0495661_0022507 Ga0495661_0022507_1159_2367 402
279 3300046665 Ga0495661_0049387 Ga0495661_0049387_117_1331 402
280 3300046691 Ga0495670_0002320 Ga0495670_0002320_6439_7647 402
281 3300047443 Ga0495687_000269 Ga0495687_000269_60701_61915 402
282 3300047447 Ga0495685_005581 Ga0495685_005581_914_2122 402
283 3300047470 Ga0495681_0015810 Ga0495681_0015810_1744_2952 402
284 3300048091 Ga0495626_0004100 Ga0495626_0004100_1109_2317 402
285 3300048927 Ga0496124_0002142 Ga0496124_0002142_21726_23018 402
286 3300049568 Ga0501031_0011047 Ga0501031_0011047_4565_5779 402
287 3300053093 Ga0500651_0014799 Ga0500651_0014799_2590_3798 402
288 3300053156 Ga0500622_0000866 Ga0500622_0000866_5322_6530 402
289 3300003187 JGI25151J46595_10015996 JGI25151J46595_100159963 403
290 3300003322 rootL2_10019572 rootL2_100195723 403
291 3300005262 Ga0065165_1021119 Ga0065165_10211193 403
292 3300005327 Ga0070658_10014881 Ga0070658_100148813 403
293 3300005333 Ga0070677_10013670 Ga0070677_100136702 403
294 3300005344 Ga0070661_100058236 Ga0070661_1000582363 403
295 3300005364 Ga0070673_100085680 Ga0070673_1000856802 403
296 3300005366 Ga0070659_100043072 Ga0070659_1000430723 403
297 3300005543 Ga0070672_100035259 Ga0070672_1000352593 403
298 3300006048 Ga0075363_100000307 Ga0075363_10000030714 403
299 3300006177 Ga0075362_10011570 Ga0075362_100115702 403
300 3300006195 Ga0075366_10000159 Ga0075366_1000015910 403
301 3300006195 Ga0075366_10031803 Ga0075366_100318032 403
302 3300006353 Ga0075370_10000785 Ga0075370_100007852 403
303 3300006880 Ga0075429_100005204 Ga0075429_1000052049 403
304 3300009148 Ga0105243_10031409 Ga0105243_100314093 403
305 3300009176 Ga0105242_10056097 Ga0105242_100560972 403
306 3300013102 Ga0157371_10000078 Ga0157371_1000007827 403
307 3300025254 Ga0209148_1000623 Ga0209148_10006236 403
308 3300025291 Ga0209675_1002118 Ga0209675_10021187 403
309 3300025292 Ga0209676_1007297 Ga0209676_10072974 403
310 3300025294 Ga0209025_1003809 Ga0209025_10038099 403
311 3300025295 Ga0209564_1006066 Ga0209564_10060663 403
312 3300025298 Ga0209050_1009817 Ga0209050_10098174 403
313 3300025303 Ga0209051_1008926 Ga0209051_10089264 403
314 3300025304 Ga0209257_1014752 Ga0209257_10147523 403
315 3300025909 Ga0207705_10005370 Ga0207705_100053704 403
316 3300025927 Ga0207687_10023840 Ga0207687_100238403 403
317 3300025932 Ga0207690_10030404 Ga0207690_100304043 403
318 3300025933 Ga0207706_10065898 Ga0207706_100658983 403
319 3300025934 Ga0207686_10046067 Ga0207686_100460672 403
320 3300025935 Ga0207709_10021885 Ga0207709_100218853 403
321 3300025937 Ga0207669_10094267 Ga0207669_100942671 403
322 3300025945 Ga0207679_10005957 Ga0207679_100059573 403
323 3300025949 Ga0207667_10019915 Ga0207667_100199156 403
324 3300026041 Ga0207639_10065407 Ga0207639_100654072 403
325 3300026121 Ga0207683_10136892 Ga0207683_101368922 403
326 3300037312 Ga0395899_0006373 Ga0395899_0006373_309_1577 403
327 3300037312 Ga0395899_0011024 Ga0395899_0011024_761_1972 403
328 3300037312 Ga0395899_0121618 Ga0395899_0121618_350_1561 403
329 3300037418 Ga0395900_0001577 Ga0395900_0001577_16941_18152 403
330 3300037418 Ga0395900_0050527 Ga0395900_0050527_1826_3094 403
331 3300037466 Ga0395898_0072649 Ga0395898_0072649_1477_2688 403
332 3300037471 Ga0395905_0021521 Ga0395905_0021521_3632_4876 403
333 3300038443 Ga0395901_0001589 Ga0395901_0001589_9267_10478 403
334 3300044693 Ga0466961_0031790 Ga0466961_0031790_1188_2399 403
335 3300044693 Ga0466961_0041705 Ga0466961_0041705_1481_2698 403
336 3300044694 Ga0466963_0021881 Ga0466963_0021881_1997_3208 403
337 3300045049 Ga0466959_0139419 Ga0466959_0139419_49_1305 403
338 3300045976 Ga0466967_0011697 Ga0466967_0011697_3532_4743 403
339 3300046452 Ga0495617_000116 Ga0495617_000116_42621_43832 403
340 3300046452 Ga0495617_000167 Ga0495617_000167_12477_13688 403
341 3300046453 Ga0495627_000707 Ga0495627_000707_11675_12886 403
342 3300046463 Ga0495653_0063492 Ga0495653_0063492_762_1973 403
343 3300046473 Ga0495582_0003552 Ga0495582_0003552_546_1757 403
344 3300046473 Ga0495582_0004731 Ga0495582_0004731_3769_4980 403
345 3300046474 Ga0495605_0000064 Ga0495605_0000064_28296_29507 403
346 3300046474 Ga0495605_0000286 Ga0495605_0000286_48408_49625 403
347 3300046474 Ga0495605_0003045 Ga0495605_0003045_3400_4611 403
348 3300046491 Ga0495584_0000006 Ga0495584_0000006_27388_28599 403
349 3300046491 Ga0495584_0004941 Ga0495584_0004941_3531_4742 403
350 3300046491 Ga0495584_0034153 Ga0495584_0034153_12_1244 403
351 3300046492 Ga0495585_0000061 Ga0495585_0000061_42272_43483 403
352 3300046492 Ga0495585_0000207 Ga0495585_0000207_38808_40019 403
353 3300046492 Ga0495585_0000265 Ga0495585_0000265_28843_30147 403
354 3300046492 Ga0495585_0008063 Ga0495585_0008063_347_1579 403
355 3300046492 Ga0495585_0017940 Ga0495585_0017940_2370_3581 403
356 3300046492 Ga0495585_0021568 Ga0495585_0021568_1273_2484 403
357 3300046492 Ga0495585_0033007 Ga0495585_0033007_526_1737 403
358 3300046492 Ga0495585_0034772 Ga0495585_0034772_1211_2422 403
359 3300046500 Ga0495596_0000031 Ga0495596_0000031_85194_86405 403
360 3300046500 Ga0495596_0000596 Ga0495596_0000596_10758_11969 403
361 3300046500 Ga0495596_0005046 Ga0495596_0005046_1041_2273 403
362 3300046500 Ga0495596_0033771 Ga0495596_0033771_439_1650 403
363 3300046501 Ga0495607_0002695 Ga0495607_0002695_12295_13506 403
364 3300046501 Ga0495607_0004470 Ga0495607_0004470_6882_8093 403
365 3300046501 Ga0495607_0005537 Ga0495607_0005537_1684_2901 403
366 3300046501 Ga0495607_0011961 Ga0495607_0011961_3326_4558 403
367 3300046501 Ga0495607_0024775 Ga0495607_0024775_2378_3589 403
368 3300046506 Ga0495583_0000121 Ga0495583_0000121_118455_119666 403
369 3300046506 Ga0495583_0001244 Ga0495583_0001244_17191_18423 403
370 3300046506 Ga0495583_0002234 Ga0495583_0002234_12664_13875 403
371 3300046506 Ga0495583_0006994 Ga0495583_0006994_5029_6240 403
372 3300046513 Ga0495616_0000453 Ga0495616_0000453_4609_5820 403
373 3300046513 Ga0495616_0000574 Ga0495616_0000574_23155_24366 403
374 3300046513 Ga0495616_0001983 Ga0495616_0001983_6315_7619 403
375 3300046513 Ga0495616_0002837 Ga0495616_0002837_2183_3394 403
376 3300046513 Ga0495616_0010002 Ga0495616_0010002_224_1486 403
377 3300046513 Ga0495616_0011986 Ga0495616_0011986_2847_4079 403
378 3300046513 Ga0495616_0022238 Ga0495616_0022238_893_2179 403
379 3300046513 Ga0495616_0031229 Ga0495616_0031229_353_1564 403
380 3300046515 Ga0495620_0023168 Ga0495620_0023168_429_1640 403
381 3300046518 Ga0495631_0000047 Ga0495631_0000047_8425_9636 403
382 3300046518 Ga0495631_0004290 Ga0495631_0004290_4279_5490 403
383 3300046518 Ga0495631_0006424 Ga0495631_0006424_770_1981 403
384 3300046519 Ga0495632_0000435 Ga0495632_0000435_8731_9942 403
385 3300046519 Ga0495632_0003786 Ga0495632_0003786_4068_5300 403
386 3300046519 Ga0495632_0018920 Ga0495632_0018920_1160_2422 403
387 3300046519 Ga0495632_0044227 Ga0495632_0044227_575_1792 403
388 3300046520 Ga0495637_0004533 Ga0495637_0004533_2744_3955 403
389 3300046520 Ga0495637_0004976 Ga0495637_0004976_4680_5891 403
390 3300046522 Ga0495643_0000158 Ga0495643_0000158_86949_88160 403
391 3300046522 Ga0495643_0002050 Ga0495643_0002050_8328_9545 403
392 3300046522 Ga0495643_0018605 Ga0495643_0018605_2614_3831 403
393 3300046523 Ga0495644_0008648 Ga0495644_0008648_52_1263 403
394 3300046523 Ga0495644_0008753 Ga0495644_0008753_2525_3757 403
395 3300046523 Ga0495644_0020427 Ga0495644_0020427_171_1382 403
396 3300046523 Ga0495644_0041551 Ga0495644_0041551_377_1588 403
397 3300046524 Ga0495648_0000096 Ga0495648_0000096_67245_68456 403
398 3300046524 Ga0495648_0005009 Ga0495648_0005009_8524_9735 403
399 3300046526 Ga0495666_0007288 Ga0495666_0007288_3182_4393 403
400 3300046528 Ga0495642_0001119 Ga0495642_0001119_1247_2458 403
401 3300046530 Ga0495654_0006903 Ga0495654_0006903_1072_2283 403
402 3300046530 Ga0495654_0039490 Ga0495654_0039490_175_1386 403
403 3300046531 Ga0495665_0001390 Ga0495665_0001390_8121_9332 403
404 3300046535 Ga0495586_0004392 Ga0495586_0004392_5116_6327 403
405 3300046538 Ga0495609_0006585 Ga0495609_0006585_197_1429 403
406 3300046538 Ga0495609_0015942 Ga0495609_0015942_20_1231 403
407 3300046538 Ga0495609_0018094 Ga0495609_0018094_1154_2365 403
408 3300046542 Ga0495597_0000142 Ga0495597_0000142_1030_2241 403
409 3300046542 Ga0495597_0006408 Ga0495597_0006408_2861_4090 403
410 3300046542 Ga0495597_0022067 Ga0495597_0022067_197_1408 403
411 3300046557 Ga0495622_0026323 Ga0495622_0026323_945_2156 403
412 3300046558 Ga0495633_0004889 Ga0495633_0004889_2564_3868 403
413 3300046558 Ga0495633_0027206 Ga0495633_0027206_155_1366 403
414 3300046615 Ga0495656_0000042 Ga0495656_0000042_24363_25586 403
415 3300046616 Ga0495668_0000897 Ga0495668_0000897_28130_29341 403
416 3300046616 Ga0495668_0009478 Ga0495668_0009478_1816_3048 403
417 3300046616 Ga0495668_0022910 Ga0495668_0022910_798_2009 403
418 3300046648 Ga0495611_0013947 Ga0495611_0013947_950_2161 403
419 3300046660 Ga0495625_0086165 Ga0495625_0086165_126_1337 403
420 3300046663 Ga0495635_0003855 Ga0495635_0003855_379_1590 403
421 3300046665 Ga0495661_0000856 Ga0495661_0000856_7956_9179 403
422 3300046665 Ga0495661_0003794 Ga0495661_0003794_750_1961 403
423 3300046665 Ga0495661_0046578 Ga0495661_0046578_745_1956 403
424 3300046665 Ga0495661_0047183 Ga0495661_0047183_616_1827 403
425 3300046674 Ga0495588_0000147 Ga0495588_0000147_77498_78709 403
426 3300046674 Ga0495588_0009256 Ga0495588_0009256_195_1406 403
427 3300046674 Ga0495588_0021277 Ga0495588_0021277_1166_2377 403
428 3300046684 Ga0495669_0000124 Ga0495669_0000124_26932_28143 403
429 3300046684 Ga0495669_0002126 Ga0495669_0002126_2172_3383 403
430 3300046684 Ga0495669_0004456 Ga0495669_0004456_1606_2817 403
431 3300046689 Ga0495613_0115713 Ga0495613_0115713_362_1573 403
432 3300046691 Ga0495670_0009393 Ga0495670_0009393_299_1531 403
433 3300046691 Ga0495670_0016136 Ga0495670_0016136_2009_3256 403
434 3300046692 Ga0495671_0001845 Ga0495671_0001845_1093_2304 403
435 3300046694 Ga0495649_0002781 Ga0495649_0002781_6943_8160 403
436 3300046694 Ga0495649_0010844 Ga0495649_0010844_1461_2693 403
437 3300046794 Ga0495589_0000359 Ga0495589_0000359_9798_11015 403
438 3300046794 Ga0495589_0001946 Ga0495589_0001946_1945_3156 403
439 3300046794 Ga0495589_0002158 Ga0495589_0002158_6921_8153 403
440 3300046794 Ga0495589_0002352 Ga0495589_0002352_6385_7596 403
441 3300046794 Ga0495589_0037292 Ga0495589_0037292_1105_2316 403
442 3300046794 Ga0495589_0038529 Ga0495589_0038529_39_1250 403
443 3300046809 Ga0495600_0154392 Ga0495600_0154392_164_1375 403
444 3300046810 Ga0495660_0000299 Ga0495660_0000299_16639_17856 403
445 3300046810 Ga0495660_0012680 Ga0495660_0012680_334_1566 403
446 3300046810 Ga0495660_0014935 Ga0495660_0014935_309_1520 403
447 3300046810 Ga0495660_0018483 Ga0495660_0018483_1670_2956 403
448 3300047315 Ga0495581_0047500 Ga0495581_0047500_41_1252 403
449 3300047315 Ga0495581_0082568 Ga0495581_0082568_124_1335 403
450 3300047317 Ga0495604_0093661 Ga0495604_0093661_80_1291 403
451 3300047317 Ga0495604_0127598 Ga0495604_0127598_290_1501 403
452 3300047320 Ga0495672_0001124 Ga0495672_0001124_8321_9538 403
453 3300047320 Ga0495672_0010131 Ga0495672_0010131_5064_6275 403
454 3300047320 Ga0495672_0012104 Ga0495672_0012104_1715_2944 403
455 3300047321 Ga0495676_0000015 Ga0495676_0000015_180707_181918 403
456 3300047322 Ga0495680_0008411 Ga0495680_0008411_7797_9008 403
457 3300047322 Ga0495680_0107406 Ga0495680_0107406_284_1495 403
458 3300047323 Ga0495683_0000041 Ga0495683_0000041_24911_26215 403
459 3300047323 Ga0495683_0004819 Ga0495683_0004819_4008_5240 403
460 3300047443 Ga0495687_000103 Ga0495687_000103_118624_119835 403
461 3300047443 Ga0495687_001224 Ga0495687_001224_9635_10852 403
462 3300047444 Ga0495675_0003256 Ga0495675_0003256_1442_2653 403
463 3300047444 Ga0495675_0007145 Ga0495675_0007145_4406_5617 403
464 3300047445 Ga0495677_0000266 Ga0495677_0000266_5471_6682 403
465 3300047445 Ga0495677_0001975 Ga0495677_0001975_2183_3400 403
466 3300047445 Ga0495677_0004101 Ga0495677_0004101_3956_5167 403
467 3300047446 Ga0495679_000667 Ga0495679_000667_536_1747 403
468 3300047446 Ga0495679_002591 Ga0495679_002591_6683_7915 403
469 3300047470 Ga0495681_0018846 Ga0495681_0018846_1350_2582 403
470 3300047472 Ga0495686_0001203 Ga0495686_0001203_3203_4414 403
471 3300047472 Ga0495686_0107152 Ga0495686_0107152_215_1426 403
472 3300048089 Ga0495614_0002022 Ga0495614_0002022_6180_7391 403
473 3300048089 Ga0495614_0009349 Ga0495614_0009349_950_2161 403
474 3300048091 Ga0495626_0000022 Ga0495626_0000022_172057_173274 403
475 3300048091 Ga0495626_0001509 Ga0495626_0001509_13412_14623 403
476 3300048091 Ga0495626_0003410 Ga0495626_0003410_1747_2958 403
477 3300048091 Ga0495626_0006772 Ga0495626_0006772_3612_4823 403
478 3300048091 Ga0495626_0006800 Ga0495626_0006800_3612_4823 403
479 3300048091 Ga0495626_0012655 Ga0495626_0012655_1384_2601 403
480 3300048091 Ga0495626_0015327 Ga0495626_0015327_1798_3030 403
481 3300048091 Ga0495626_0040317 Ga0495626_0040317_93_1304 403
482 3300048904 Ga0496101_0018540 Ga0496101_0018540_328_1551 403
483 3300048905 Ga0496102_0000953 Ga0496102_0000953_12332_13543 403
484 3300048909 Ga0496106_0040467 Ga0496106_0040467_1070_2302 403
485 3300048912 Ga0496109_0003564 Ga0496109_0003564_5254_6477 403
486 3300048913 Ga0496110_0000009 Ga0496110_0000009_6749_7960 403
487 3300048915 Ga0496112_0360517 Ga0496112_0360517_132_1343 403
488 3300048916 Ga0496113_0020813 Ga0496113_0020813_3247_4464 403
489 3300048925 Ga0496122_0000127 Ga0496122_0000127_164903_166126 403
490 3300048926 Ga0496123_0000084 Ga0496123_0000084_11629_12852 403
491 3300049459 Ga0495678_000819 Ga0495678_000819_21960_23171 403
492 3300049459 Ga0495678_015226 Ga0495678_015226_1047_2279 403
493 3300049649 Ga0501198_000001 Ga0501198_000001_193784_195070 403
494 3300049662 Ga0501222_000013 Ga0501222_000013_46748_48034 403
495 3300049822 Ga0501035_0006551 Ga0501035_0006551_1445_2656 403
496 3300050489 nmdc:mga03683_3442_c1 nmdc:mga03683_3442_c1_1522_2772 403
497 3300050490 nmdc:mga03n38_4211_c1 nmdc:mga03n38_4211_c1_2694_3944 403
498 3300050492 nmdc:mga0yw44_132885_c1 nmdc:mga0yw44_132885_c1_370_1596 403
499 3300050493 nmdc:mga0k408_25214_c1 nmdc:mga0k408_25214_c1_987_2273 403
500 3300050493 nmdc:mga0k408_265_c1 nmdc:mga0k408_265_c1_18273_19523 403
501 3300050496 nmdc:mga07m45_102_c1 nmdc:mga07m45_102_c1_11859_13109 403
502 3300050508 nmdc:mga09592_4479_c1 nmdc:mga09592_4479_c1_280_1500 403
503 3300061719 Ga0466962_0041904 Ga0466962_0041904_906_2123 403
504 iso_pu_bacteria 2738541307 2738882225 403
505 iso_pu_bacteria 8055225921 8055227689 403
506 3300005618 Ga0068864_100094615 Ga0068864_1000946152 404
507 3300006946 Ga0079104_1000004 Ga0079104_100000471 404
508 3300009148 Ga0105243_10000547 Ga0105243_100005473 404
509 3300009176 Ga0105242_10001479 Ga0105242_1000147913 404
510 3300014968 Ga0157379_10014879 Ga0157379_100148797 404
511 3300015683 Ga0183362_10001 Ga0183362_100011707 404
512 3300025934 Ga0207686_10002005 Ga0207686_100020057 404
513 3300025935 Ga0207709_10000019 Ga0207709_10000019183 404
514 3300026088 Ga0207641_10148436 Ga0207641_101484362 404
515 3300026095 Ga0207676_10107597 Ga0207676_101075972 404
516 3300027111 Ga0209281_1000005 Ga0209281_1000005272 404
517 3300028794 Ga0307515_10000944 Ga0307515_1000094441 404
518 3300031251 Ga0265327_10000746 Ga0265327_1000074614 404
519 3300031649 Ga0307514_10000823 Ga0307514_1000082313 404
520 3300046542 Ga0495597_0000783 Ga0495597_0000783_9517_10740 404
521 3300048915 Ga0496112_0011119 Ga0496112_0011119_1455_2675 404
522 iso_pu_bacteria 2738543012 2739247212 404
523 iso_pu_bacteria 2932422444 2932426594 404
524 3300002067 JGI24735J21928_10001616 JGI24735J21928_100016166 405
525 3300003841 Ga0055541_1000116 Ga0055541_10001169 405
526 3300003841 Ga0055541_1000548 Ga0055541_10005483 405
527 3300005327 Ga0070658_10018437 Ga0070658_100184372 405
528 3300005339 Ga0070660_100000821 Ga0070660_1000008217 405
529 3300005563 Ga0068855_100005337 Ga0068855_10000533711 405
530 3300009093 Ga0105240_10000982 Ga0105240_1000098211 405
531 3300009177 Ga0105248_10017940 Ga0105248_100179407 405
532 3300009545 Ga0105237_10015736 Ga0105237_100157363 405
533 3300013100 Ga0157373_10011816 Ga0157373_100118165 405
534 3300013104 Ga0157370_10008096 Ga0157370_100080962 405
535 3300013105 Ga0157369_10002205 Ga0157369_1000220519 405
536 3300013296 Ga0157374_10000053 Ga0157374_10000053105 405
537 3300025224 Ga0209784_100612 Ga0209784_1006127 405
538 3300025225 Ga0209566_100227 Ga0209566_10022744 405
539 3300025225 Ga0209566_102126 Ga0209566_1021263 405
540 3300025226 Ga0209674_100210 Ga0209674_1002108 405
541 3300025226 Ga0209674_100827 Ga0209674_1008273 405
542 3300025228 Ga0209672_100170 Ga0209672_1001708 405
543 3300025228 Ga0209672_100283 Ga0209672_10028330 405
544 3300025246 Ga0209646_1000046 Ga0209646_10000463 405
545 3300025250 Ga0209026_1000918 Ga0209026_100091810 405
546 3300025254 Ga0209148_1001631 Ga0209148_10016313 405
547 3300025256 Ga0209759_1006600 Ga0209759_10066003 405
548 3300025256 Ga0209759_1014951 Ga0209759_10149512 405
549 3300025904 Ga0207647_10001599 Ga0207647_1000159911 405
550 3300025909 Ga0207705_10036965 Ga0207705_100369653 405
551 3300025913 Ga0207695_10019083 Ga0207695_100190832 405
552 3300025919 Ga0207657_10000622 Ga0207657_1000062227 405
553 3300025941 Ga0207711_10220049 Ga0207711_102200492 405
554 3300025949 Ga0207667_10032991 Ga0207667_100329912 405
555 3300031730 Ga0307516_10149908 Ga0307516_101499082 405
556 3300037312 Ga0395899_0000023 Ga0395899_0000023_73854_75260 405
557 3300037418 Ga0395900_0000019 Ga0395900_0000019_291900_293306 405
558 3300037466 Ga0395898_0000016 Ga0395898_0000016_287046_288452 405
559 3300037466 Ga0395898_0035532 Ga0395898_0035532_3603_4820 405
560 3300039447 Ga0436361_1176026 Ga0436361_1176026_540_1757 405
561 3300042005 Ga0439448_0001418 Ga0439448_0001418_290_1507 405
562 3300044671 Ga0466978_0003338 Ga0466978_0003338_3608_4837 405
563 3300044672 Ga0466982_0010653 Ga0466982_0010653_1383_2612 405
564 3300044693 Ga0466961_0000413 Ga0466961_0000413_3709_4938 405
565 3300044719 Ga0466971_0006003 Ga0466971_0006003_2574_3803 405
566 3300044765 Ga0466970_0000237 Ga0466970_0000237_22132_23361 405
567 3300044842 Ga0466957_0013034 Ga0466957_0013034_2211_3440 405
568 3300045049 Ga0466959_0004248 Ga0466959_0004248_4694_5923 405
569 3300045836 Ga0466958_0009906 Ga0466958_0009906_2306_3535 405
570 3300045976 Ga0466967_0009026 Ga0466967_0009026_3842_5071 405
571 3300046499 Ga0495594_0005542 Ga0495594_0005542_3975_5243 405
572 3300046557 Ga0495622_0004865 Ga0495622_0004865_1389_2657 405
573 3300046674 Ga0495588_0054020 Ga0495588_0054020_296_1564 405
574 3300046691 Ga0495670_0065516 Ga0495670_0065516_65_1333 405
575 3300047321 Ga0495676_0017902 Ga0495676_0017902_1618_2886 405
576 3300049822 Ga0501035_0033120 Ga0501035_0033120_2511_3728 405
577 3300049823 Ga0501044_0001216 Ga0501044_0001216_17480_18697 405
578 3300061719 Ga0466962_0001020 Ga0466962_0001020_7665_8894 405
579 iso_pu_bacteria 2738543013 2739252433 405
580 iso_pu_bacteria 2900577576 2900581740 405
581 iso_pu_bacteria 2928058823 2928059713 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

4

372

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.8777 11 45
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.868 14 45
4bk2-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: q301e mutant 0.8679 14 45
4bjy-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: platinum derivative 0.8663 14 45
4bjz-assembly1.cif.gz_A crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: native data 0.8587 14 46
ID Description Score Start End Superfamily
1x74D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9071 17 206 3.40.50.10540
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8928 235 326 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.884 235 326 3.30.1540.10
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.879 235 326 3.30.1540.10
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8704 235 326 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A0F9NUV7-F1-model_v4 Formyl-CoA transferase 0.9578 11 146 GO:0003824
AF-A0A3M1RQL6-F1-model_v4 CoA transferase 0.957 11 146 GO:0008410
AF-A0A352PVR8-F1-model_v4 Carnitine dehydratase 0.9569 11 143 GO:0008410
AF-F3GKP8-F1-model_v4 L-carnitine dehydratase/bile acid-inducible protein F 0.9536 11 154 GO:0003824
AF-A0A3M3RLL0-F1-model_v4 deleted 0.9523 11 154

Feature Viewer

pLDDT pTM Quality
86.04 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map