F465860

General Info

Members Datasets Scaffolds Average Seq Length
579 278 1154 281

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0083268|Ga0495592_0083268_1101_2075
Length 324
Sequence MHRGYRFTSPGAEASRDDFANPPGRAGAAPVNRLYPGELVMQIGAAMFFTDYSMSAAELARACEERGFESVWAPEHSHIPLARNSPFPSGGELPKQYSQVMDPFVTLSAAAAVTKTIKLGTGVCLVIQRDPIQTAKSVASLDQVSGGRFLFGVGGGWNAEEMADHGTAFKTRFKLMRERIEAMQQIWTADAAEYHGEFVDFGPMAAWPKPVQKPHPPVIVGGMFPHAARRALRYGNGWIPHSRRPQYEDVTDFLPQFKEMAAAAGRDLAQVPVTVWGIPEDPDRLRRYEDQGVARGVVQLAAAGADTIMPILDRWAALIRQVGG

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
168 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 1.55
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 3.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0083268 3300046454 Bacteria 2310
2 JGI25406J46586_10019554 3300003203 Bacteria 2755
3 Ga0070658_10019915 3300005327 Bacteria 5375
4 Ga0070683_100002614 3300005329 Bacteria 14407
5 Ga0070683_100051578 3300005329 Bacteria 3809
6 Ga0070683_100123720 3300005329 Bacteria 2444
7 Ga0070690_100215024 3300005330 Bacteria 1344
8 Ga0070670_100520547 3300005331 Unclassified 1059
9 Ga0068869_100118253 3300005334 Bacteria 2024
10 Ga0070680_100006963 3300005336 Bacteria 8618
11 Ga0070680_100010559 3300005336 Bacteria 7125
12 Ga0070680_100029669 3300005336 Bacteria 4392
13 Ga0070682_100079648 3300005337 Bacteria 2116
14 Ga0068868_100019021 3300005338 Bacteria 5141
15 Ga0068868_100372083 3300005338 Bacteria 1228
16 Ga0070660_100472359 3300005339 Bacteria 1042
17 Ga0070689_100144086 3300005340 Unclassified 1918
18 Ga0070691_10021049 3300005341 Bacteria 3015
19 Ga0070687_100025284 3300005343 Bacteria 2847
20 Ga0070661_100001848 3300005344 Bacteria 14669
21 Ga0070668_100294167 3300005347 Bacteria 1360
22 Ga0070669_100235371 3300005353 Bacteria 1453
23 Ga0070671_100209563 3300005355 Bacteria 1653
24 Ga0070674_100215251 3300005356 Bacteria 1492
25 Ga0070659_100002454 3300005366 Bacteria 13181
26 Ga0070667_100224570 3300005367 Bacteria 1673
27 Ga0070714_100032223 3300005435 Bacteria 4373
28 Ga0070714_100036191 3300005435 Bacteria 4139
29 Ga0070714_100330987 3300005435 Bacteria 1426
30 Ga0070714_100462387 3300005435 Bacteria 1206
31 Ga0070714_100711262 3300005435 Bacteria 970
32 Ga0070713_100009696 3300005436 Bacteria 6915
33 Ga0070713_100095284 3300005436 Bacteria 2567
34 Ga0070713_100629069 3300005436 Bacteria 1021
35 Ga0070710_10001612 3300005437 Bacteria 10652
36 Ga0070710_10001720 3300005437 Bacteria 10330
37 Ga0070710_10147216 3300005437 Bacteria 1450
38 Ga0070701_10064526 3300005438 Unclassified 1941
39 Ga0070711_100004534 3300005439 Bacteria 8215
40 Ga0070711_100037647 3300005439 Bacteria 3247
41 Ga0070700_100052192 3300005441 Bacteria 2549
42 Ga0070708_100007087 3300005445 Bacteria 8944
43 Ga0070708_100105327 3300005445 Bacteria 2587
44 Ga0070708_100225564 3300005445 Bacteria 1758
45 Ga0070663_100272397 3300005455 Bacteria 1346
46 Ga0070678_100179854 3300005456 Bacteria 1730
47 Ga0070678_100271341 3300005456 Bacteria 1431
48 Ga0070681_10010150 3300005458 Bacteria 9287
49 Ga0070681_10017515 3300005458 Bacteria 7160
50 Ga0070681_10127348 3300005458 Bacteria 2479
51 Ga0070706_100050157 3300005467 Bacteria 3851
52 Ga0070706_100088879 3300005467 Bacteria 2864
53 Ga0070706_100146771 3300005467 Bacteria 2203
54 Ga0070707_100007719 3300005468 Bacteria 9994
55 Ga0070707_100028039 3300005468 Bacteria 5357
56 Ga0070707_100158170 3300005468 Bacteria 2207
57 Ga0070707_100280255 3300005468 Bacteria 1620
58 Ga0070707_100289545 3300005468 Bacteria 1591
59 Ga0070698_100006786 3300005471 Bacteria 12409
60 Ga0070698_100026400 3300005471 Bacteria 6045
61 Ga0070698_100055879 3300005471 Bacteria 4001
62 Ga0070698_100096548 3300005471 Bacteria 2932
63 Ga0070698_100384261 3300005471 Bacteria 1336
64 Ga0070699_100005675 3300005518 Bacteria 10932
65 Ga0070699_100013179 3300005518 Bacteria 7128
66 Ga0070699_100071030 3300005518 Bacteria 3027
67 Ga0070699_100134287 3300005518 Bacteria 2182
68 Ga0070679_100061071 3300005530 Bacteria 3757
69 Ga0070684_100023673 3300005535 Bacteria 5141
70 Ga0070684_100093524 3300005535 Bacteria 2676
71 Ga0070684_100160476 3300005535 Bacteria 2039
72 Ga0070697_100064824 3300005536 Unclassified 2984
73 Ga0070697_100172620 3300005536 Bacteria 1830
74 Ga0068853_100298387 3300005539 Bacteria 1489
75 Ga0070695_100004741 3300005545 Bacteria 8003
76 Ga0070696_100027078 3300005546 Bacteria 3904
77 Ga0070696_100530314 3300005546 Bacteria 941
78 Ga0070665_100139672 3300005548 Bacteria 2426
79 Ga0070665_100141126 3300005548 Bacteria 2412
80 Ga0068855_100006207 3300005563 Bacteria 14565
81 Ga0070664_100024759 3300005564 Bacteria 4970
82 Ga0070664_100118806 3300005564 Bacteria 2313
83 Ga0068854_100045405 3300005578 Bacteria 3124
84 Ga0068856_100007707 3300005614 Bacteria 10507
85 Ga0068856_100360534 3300005614 Bacteria 1472
86 Ga0068852_100049010 3300005616 Bacteria 3612
87 Ga0068852_100284281 3300005616 Bacteria 1596
88 Ga0068859_100309677 3300005617 Bacteria 1673
89 Ga0068864_100075087 3300005618 Bacteria 2951
90 Ga0068864_100451673 3300005618 Bacteria 1229
91 Ga0068861_100279861 3300005719 Bacteria 1436
92 Ga0068863_100016618 3300005841 Bacteria 7060
93 Ga0068858_100222205 3300005842 Bacteria 1789
94 Ga0068858_100362034 3300005842 Bacteria 1390
95 Ga0068858_100668485 3300005842 Bacteria 1010
96 Ga0068860_100643699 3300005843 Bacteria 1068
97 Ga0068862_100002673 3300005844 Bacteria 15683
98 Ga0068862_100232266 3300005844 Bacteria 1674
99 Ga0068862_100547000 3300005844 Bacteria 1105
100 Ga0081455_10000637 3300005937 Bacteria 45442
101 Ga0081455_10004055 3300005937 Bacteria 16598
102 Ga0081538_10009864 3300005981 Bacteria 7897
103 Ga0081540_1008886 3300005983 Bacteria 6974
104 Ga0081540_1032736 3300005983 Bacteria 2834
105 Ga0081539_10000044 3300005985 Bacteria 284021
106 Ga0081539_10000772 3300005985 Bacteria 62952
107 Ga0081539_10001514 3300005985 Bacteria 39031
108 Ga0070717_10024846 3300006028 Bacteria 4761
109 Ga0070717_10027375 3300006028 Bacteria 4556
110 Ga0070717_10032035 3300006028 Bacteria 4233
111 Ga0070717_10072881 3300006028 Bacteria 2869
112 Ga0070717_10074149 3300006028 Bacteria 2844
113 Ga0070717_10091747 3300006028 Bacteria 2565
114 Ga0070717_10222742 3300006028 Unclassified 1658
115 Ga0070717_10274431 3300006028 Bacteria 1494
116 Ga0070716_100052773 3300006173 Bacteria 2316
117 Ga0070712_100008694 3300006175 Bacteria 6397
118 Ga0075369_10050067 3300006186 Bacteria 1806
119 Ga0075428_100000358 3300006844 Bacteria 45303
120 Ga0075428_100022540 3300006844 Bacteria 6972
121 Ga0075428_100036484 3300006844 Bacteria 5414
122 Ga0075428_100055693 3300006844 Bacteria 4333
123 Ga0075428_100067341 3300006844 Bacteria 3920
124 Ga0075428_100218615 3300006844 Bacteria 2058
125 Ga0075428_100430448 3300006844 Bacteria 1414
126 Ga0075428_100565966 3300006844 Unclassified 1215
127 Ga0075430_100003107 3300006846 Bacteria 13881
128 Ga0075430_100118192 3300006846 Bacteria 2210
129 Ga0075430_100124795 3300006846 Bacteria 2146
130 Ga0075430_100133941 3300006846 Bacteria 2065
131 Ga0075430_100187331 3300006846 Bacteria 1721
132 Ga0075431_100001284 3300006847 Bacteria 22920
133 Ga0075431_100005830 3300006847 Bacteria 12185
134 Ga0075431_100005838 3300006847 Bacteria 12178
135 Ga0075431_100007402 3300006847 Bacteria 10931
136 Ga0075431_100009346 3300006847 Bacteria 9841
137 Ga0075431_100020147 3300006847 Bacteria 6811
138 Ga0075431_100025203 3300006847 Bacteria 6097
139 Ga0075431_100055178 3300006847 Bacteria 4098
140 Ga0075431_100112050 3300006847 Bacteria 2816
141 Ga0075433_10005488 3300006852 Bacteria 9963
142 Ga0075433_10048835 3300006852 Bacteria 3681
143 Ga0075433_10075354 3300006852 Bacteria 2969
144 Ga0075433_10112929 3300006852 Bacteria 2410
145 Ga0075433_10118753 3300006852 Bacteria 2347
146 Ga0075433_10184515 3300006852 Bacteria 1856
147 Ga0075433_10197918 3300006852 Bacteria 1787
148 Ga0075434_100001101 3300006871 Bacteria 22162
149 Ga0075434_100003725 3300006871 Bacteria 13617
150 Ga0075434_100069679 3300006871 Bacteria 3506
151 Ga0075434_100095696 3300006871 Bacteria 2975
152 Ga0075434_100167933 3300006871 Bacteria 2214
153 Ga0075434_100255390 3300006871 Bacteria 1771
154 Ga0075429_100001958 3300006880 Bacteria 17096
155 Ga0075429_100020609 3300006880 Bacteria 5722
156 Ga0075429_100023690 3300006880 Bacteria 5328
157 Ga0075429_100032848 3300006880 Bacteria 4510
158 Ga0075429_100045716 3300006880 Bacteria 3809
159 Ga0075429_100059753 3300006880 Bacteria 3321
160 Ga0075429_100077333 3300006880 Bacteria 2899
161 Ga0075429_100359136 3300006880 Bacteria 1276
162 Ga0068865_100078122 3300006881 Bacteria 2367
163 Ga0097620_100309687 3300006931 Bacteria 1673
164 Ga0075435_100059429 3300007076 Bacteria 3099
165 Ga0075435_100094245 3300007076 Bacteria 2474
166 Ga0075435_100175667 3300007076 Bacteria 1809
167 Ga0099794_10007403 3300007265 Bacteria 4508
168 Ga0099795_10032441 3300007788 Bacteria 1806
169 Ga0099795_10058993 3300007788 Bacteria 1418
170 Ga0105240_10550224 3300009093 Bacteria 1277
171 Ga0105240_10600204 3300009093 Bacteria 1212
172 Ga0111539_10000139 3300009094 Bacteria 82909
173 Ga0111539_10000319 3300009094 Bacteria 58756
174 Ga0111539_10006317 3300009094 Bacteria 15281
175 Ga0111539_10057976 3300009094 Bacteria 4596
176 Ga0111539_10107664 3300009094 Bacteria 3271
177 Ga0111539_10604477 3300009094 Bacteria 1277
178 Ga0111539_10646420 3300009094 Bacteria 1232
179 Ga0105245_10044722 3300009098 Bacteria 3953
180 Ga0105247_10037546 3300009101 Bacteria 2956
181 Ga0105247_10268749 3300009101 Bacteria 1172
182 Ga0114129_10000149 3300009147 Bacteria 73883
183 Ga0114129_10003297 3300009147 Bacteria 22665
184 Ga0114129_10004885 3300009147 Bacteria 18915
185 Ga0114129_10005930 3300009147 Bacteria 17291
186 Ga0114129_10010031 3300009147 Bacteria 13502
187 Ga0114129_10015533 3300009147 Bacteria 10826
188 Ga0114129_10017681 3300009147 Bacteria 10151
189 Ga0114129_10104384 3300009147 Bacteria 3916
190 Ga0114129_10193151 3300009147 Bacteria 2763
191 Ga0114129_10292603 3300009147 Bacteria 2173
192 Ga0114129_10297705 3300009147 Bacteria 2151
193 Ga0114129_10316501 3300009147 Bacteria 2075
194 Ga0114129_10335865 3300009147 Bacteria 2005
195 Ga0114129_10414538 3300009147 Bacteria 1773
196 Ga0105243_10191700 3300009148 Bacteria 1786
197 Ga0105241_10000874 3300009174 Bacteria 22784
198 Ga0105242_10330233 3300009176 Bacteria 1402
199 Ga0105237_10032090 3300009545 Bacteria 5318
200 Ga0105237_10158491 3300009545 Bacteria 2261
201 Ga0105237_10515202 3300009545 Bacteria 1203
202 Ga0105238_10051722 3300009551 Bacteria 4131
203 Ga0099796_10066635 3300010159 Bacteria 1290
204 Ga0105239_10266658 3300010375 Bacteria 1925
205 Ga0105239_10294118 3300010375 Bacteria 1829
206 Ga0105239_10452178 3300010375 Unclassified 1457
207 Ga0105239_10674929 3300010375 Bacteria 1181
208 Ga0157373_10000408 3300013100 Bacteria 34529
209 Ga0157371_10481468 3300013102 Bacteria 915
210 Ga0157370_10095691 3300013104 Bacteria 2786
211 Ga0157370_10458761 3300013104 Bacteria 1171
212 Ga0157369_10006391 3300013105 Bacteria 13662
213 Ga0157378_10069985 3300013297 Bacteria 3149
214 Ga0157378_10719089 3300013297 Bacteria 1019
215 Ga0163162_10042520 3300013306 Bacteria 4548
216 Ga0163162_10222301 3300013306 Bacteria 2018
217 Ga0163162_10276487 3300013306 Unclassified 1811
218 Ga0157372_10000902 3300013307 Bacteria 32257
219 Ga0157372_10225200 3300013307 Bacteria 2174
220 Ga0157372_10281670 3300013307 Bacteria 1933
221 Ga0163163_10137137 3300014325 Bacteria 2488
222 Ga0157380_10044636 3300014326 Bacteria 3475
223 Ga0157380_10143564 3300014326 Bacteria 2054
224 Ga0157379_10202999 3300014968 Bacteria 1793
225 Ga0157379_10489952 3300014968 Bacteria 1138
226 Ga0206354_10751500 3300020081 Bacteria 1205
227 Ga0206353_11566805 3300020082 Bacteria 6249
228 Ga0213873_10017801 3300021358 Bacteria 1625
229 Ga0213876_10001191 3300021384 Bacteria 16434
230 Ga0213876_10037467 3300021384 Bacteria 2558
231 Ga0213876_10271301 3300021384 Bacteria 902
232 Ga0213875_10000852 3300021388 Bacteria 22541
233 Ga0213875_10001926 3300021388 Bacteria 12850
234 Ga0213875_10003545 3300021388 Bacteria 8867
235 Ga0213875_10007554 3300021388 Bacteria 5605
236 Ga0213875_10046244 3300021388 Bacteria 2043
237 Ga0213875_10079101 3300021388 Bacteria 1534
238 Ga0207426_1011443 3300025302 Bacteria 3379
239 Ga0207426_1015163 3300025302 Bacteria 2802
240 Ga0207682_10059570 3300025893 Bacteria 1595
241 Ga0207692_10081366 3300025898 Bacteria 1733
242 Ga0207692_10285974 3300025898 Bacteria 999
243 Ga0207680_10313252 3300025903 Bacteria 1096
244 Ga0207699_10396527 3300025906 Bacteria 982
245 Ga0207705_10025057 3300025909 Bacteria 4258
246 Ga0207684_10115734 3300025910 Bacteria 2297
247 Ga0207707_10017366 3300025912 Bacteria 6272
248 Ga0207707_10030166 3300025912 Bacteria 4743
249 Ga0207707_10053395 3300025912 Bacteria 3518
250 Ga0207671_10032167 3300025914 Bacteria 3905
251 Ga0207693_10005304 3300025915 Bacteria 10772
252 Ga0207693_10040721 3300025915 Bacteria 3659
253 Ga0207693_10089964 3300025915 Unclassified 2406
254 Ga0207693_10222618 3300025915 Bacteria 1482
255 Ga0207693_10311337 3300025915 Bacteria 1233
256 Ga0207693_10462818 3300025915 Bacteria 991
257 Ga0207663_10106834 3300025916 Bacteria 1892
258 Ga0207663_10182536 3300025916 Bacteria 1500
259 Ga0207663_10472996 3300025916 Bacteria 970
260 Ga0207660_10050198 3300025917 Bacteria 2961
261 Ga0207660_10159082 3300025917 Bacteria 1741
262 Ga0207657_10111004 3300025919 Bacteria 2265
263 Ga0207652_10117193 3300025921 Bacteria 2366
264 Ga0207646_10011778 3300025922 Bacteria 8447
265 Ga0207646_10013167 3300025922 Bacteria 7916
266 Ga0207646_10034689 3300025922 Bacteria 4560
267 Ga0207646_10114681 3300025922 Bacteria 2420
268 Ga0207646_10199903 3300025922 Bacteria 1805
269 Ga0207681_10207936 3300025923 Bacteria 1507
270 Ga0207700_10029562 3300025928 Bacteria 3868
271 Ga0207700_10068418 3300025928 Bacteria 2722
272 Ga0207700_10131497 3300025928 Bacteria 2044
273 Ga0207700_10201546 3300025928 Bacteria 1677
274 Ga0207700_10286611 3300025928 Bacteria 1418
275 Ga0207664_10110328 3300025929 Bacteria 2287
276 Ga0207664_10161831 3300025929 Bacteria 1909
277 Ga0207664_10163383 3300025929 Bacteria 1901
278 Ga0207644_10158613 3300025931 Bacteria 1757
279 Ga0207706_10577739 3300025933 Bacteria 966
280 Ga0207686_10134183 3300025934 Bacteria 1702
281 Ga0207670_10114841 3300025936 Unclassified 1946
282 Ga0207669_10111913 3300025937 Bacteria 1832
283 Ga0207704_10067452 3300025938 Bacteria 2251
284 Ga0207665_10100810 3300025939 Bacteria 2015
285 Ga0207665_10179688 3300025939 Bacteria 1532
286 Ga0207691_10055992 3300025940 Bacteria 3593
287 Ga0207661_10011785 3300025944 Bacteria 6348
288 Ga0207679_10121005 3300025945 Bacteria 2084
289 Ga0207679_10200991 3300025945 Bacteria 1665
290 Ga0207667_10302514 3300025949 Bacteria 1634
291 Ga0207712_10273193 3300025961 Unclassified 1376
292 Ga0207668_10331759 3300025972 Bacteria 1266
293 Ga0207640_10054529 3300025981 Bacteria 2614
294 Ga0207677_10420157 3300026023 Bacteria 1138
295 Ga0207703_10126449 3300026035 Bacteria 2202
296 Ga0207678_10346914 3300026067 Bacteria 1280
297 Ga0207708_10176460 3300026075 Bacteria 1695
298 Ga0207702_10020284 3300026078 Bacteria 5506
299 Ga0207702_10044343 3300026078 Bacteria 3737
300 Ga0207648_10086640 3300026089 Bacteria 2733
301 Ga0207676_10290750 3300026095 Bacteria 1488
302 Ga0207676_10312952 3300026095 Bacteria 1438
303 Ga0207675_100054477 3300026118 Unclassified 3731
304 Ga0207675_100455197 3300026118 Bacteria 1269
305 Ga0207675_100745141 3300026118 Bacteria 991
306 Ga0207683_10052145 3300026121 Bacteria 3584
307 Ga0207698_10004184 3300026142 Bacteria 8778
308 Ga0209974_10028449 3300027876 Unclassified 1851
309 Ga0207428_10000239 3300027907 Bacteria 75249
310 Ga0207428_10000960 3300027907 Bacteria 31981
311 Ga0268266_10073198 3300028379 Bacteria 2973
312 Ga0268266_10324658 3300028379 Bacteria 1441
313 Ga0268265_10003859 3300028380 Bacteria 10584
314 Ga0265334_10105475 3300028573 Bacteria 1016
315 Ga0265318_10033332 3300028577 Bacteria 1989
316 Ga0265338_10015655 3300028800 Bacteria 8310
317 Ga0265332_10001991 3300031238 Bacteria 10743
318 Ga0265339_10000279 3300031249 Bacteria 41139
319 Ga0265339_10174055 3300031249 Bacteria 1076
320 Ga0265331_10067501 3300031250 Bacteria 1678
321 Ga0265316_10046822 3300031344 Bacteria 3424
322 Ga0307408_100249060 3300031548 Bacteria 1464
323 Ga0307408_100335501 3300031548 Bacteria 1278
324 Ga0307408_100543690 3300031548 Bacteria 1024
325 Ga0265313_10073990 3300031595 Bacteria 1563
326 Ga0265314_10002991 3300031711 Bacteria 16727
327 Ga0265342_10152082 3300031712 Bacteria 1284
328 Ga0307410_10252679 3300031852 Bacteria 1371
329 Ga0307406_10069542 3300031901 Bacteria 2302
330 Ga0307412_10215329 3300031911 Bacteria 1469
331 Ga0307409_100267667 3300031995 Unclassified 1572
332 Ga0307416_100035260 3300032002 Unclassified 3819
333 Ga0307415_100193042 3300032126 Bacteria 1609
334 Ga0373959_0014888 3300034820 Bacteria 1422
335 Ga0373928_0016812 3300035084 Bacteria 1499
336 Ga0373928_0062677 3300035084 Bacteria 903
337 Ga0373934_0031963 3300035086 Bacteria 2063
338 Ga0373951_0044053 3300035091 Bacteria 1083
339 Ga0373952_0035306 3300035092 Bacteria 1131
340 Ga0373936_0019663 3300035113 Bacteria 2618
341 Ga0373936_0145659 3300035113 Bacteria 1025
342 Ga0373939_0015015 3300035114 Bacteria 2018
343 Ga0373953_0020153 3300035117 Bacteria 2490
344 Ga0373956_0010387 3300035119 Bacteria 3816
345 Ga0373957_0012237 3300035120 Bacteria 2885
346 Ga0373946_0049411 3300035171 Bacteria 1754
347 Ga0373961_0024456 3300035241 Unclassified 1634
348 Ga0373931_0090000 3300035691 Unclassified 1708
349 Ga0373931_0117798 3300035691 Bacteria 1515
350 Ga0373931_0124463 3300035691 Bacteria 1477
351 Ga0373935_0050955 3300035692 Bacteria 2628
352 Ga0373935_0083624 3300035692 Bacteria 2078
353 Ga0373927_0041844 3300035695 Bacteria 2971
354 Ga0373927_0088001 3300035695 Bacteria 2016
355 Ga0373927_0102879 3300035695 Bacteria 1858
356 Ga0373933_0003149 3300035724 Bacteria 9208
357 Ga0373933_0009008 3300035724 Bacteria 5445
358 Ga0373933_0041381 3300035724 Bacteria 2720
359 Ga0373947_0033242 3300035725 Bacteria 3043
360 Ga0373947_0034121 3300035725 Bacteria 3009
361 Ga0373937_0018651 3300036401 Bacteria 6198
362 Ga0373937_0037236 3300036401 Bacteria 4433
363 Ga0373937_0042900 3300036401 Bacteria 4128
364 Ga0373937_0047565 3300036401 Bacteria 3925
365 Ga0373937_0425905 3300036401 Bacteria 1260
366 Ga0373925_0037743 3300037068 Bacteria 3568
367 Ga0373925_0165855 3300037068 Bacteria 1742
368 Ga0395899_0001978 3300037312 Bacteria 16855
369 Ga0395899_0046095 3300037312 Bacteria 3247
370 Ga0395899_0102608 3300037312 Bacteria 2064
371 Ga0395899_0124963 3300037312 Bacteria 1840
372 Ga0395900_0019093 3300037418 Bacteria 6990
373 Ga0395900_0023910 3300037418 Bacteria 6253
374 Ga0395900_0028422 3300037418 Bacteria 5727
375 Ga0395900_0041095 3300037418 Bacteria 4768
376 Ga0395898_0200281 3300037466 Bacteria 1906
377 Ga0395905_0121422 3300037471 Bacteria 2456
378 Ga0436364_0036004 3300037853 Bacteria 64723
379 Ga0436364_0167149 3300037853 Bacteria 26449
380 Ga0436364_0259249 3300037853 Bacteria 81192
381 Ga0436364_0266271 3300037853 Bacteria 210347
382 Ga0436364_0668201 3300037853 Bacteria 105492
383 Ga0436364_0777786 3300037853 Bacteria 2248
384 Ga0436364_0999480 3300037853 Bacteria 18342
385 Ga0436364_1191432 3300037853 Bacteria 1861
386 Ga0436364_1250008 3300037853 Bacteria 1330
387 Ga0436364_1295067 3300037853 Bacteria 1364
388 Ga0436364_1434326 3300037853 Bacteria 2534
389 Ga0395901_0005326 3300038443 Bacteria 12998
390 Ga0395901_0008713 3300038443 Bacteria 10252
391 Ga0395901_0014831 3300038443 Bacteria 7916
392 Ga0395901_0091953 3300038443 Bacteria 3176
393 Ga0395901_0267004 3300038443 Bacteria 1780
394 Ga0395901_0344370 3300038443 Bacteria 1539
395 Ga0436365_0114166 3300039437 Bacteria 25992
396 Ga0436365_0379608 3300039437 Bacteria 1184
397 Ga0436365_0846099 3300039437 Bacteria 15473
398 Ga0436365_1199999 3300039437 Bacteria 1665
399 Ga0436365_1858420 3300039437 Bacteria 1688
400 Ga0436360_0103850 3300039438 Bacteria 1444
401 Ga0436360_0683254 3300039438 Bacteria 3709
402 Ga0436361_0782247 3300039447 Bacteria 1564
403 Ga0436361_1048232 3300039447 Bacteria 1778
404 Ga0436363_0626431 3300039450 Bacteria 2631
405 Ga0436362_1039322 3300039453 Bacteria 12931
406 Ga0439441_005289 3300042001 Bacteria 1998
407 Ga0439448_0082373 3300042005 Bacteria 1081
408 Ga0439458_0012360 3300042157 Bacteria 1916
409 Ga0451577_0000840 3300042876 Bacteria 45907
410 Ga0451577_0030171 3300042876 Bacteria 4899
411 Ga0453683_0056543 3300044673 Bacteria 2455
412 Ga0466963_0171869 3300044694 Bacteria 1511
413 Ga0453684_0033267 3300044712 Bacteria 7191
414 Ga0451576_0004313 3300045051 Bacteria 18575
415 Ga0451576_0231868 3300045051 Bacteria 1928
416 Ga0466967_0033192 3300045976 Bacteria 4368
417 Ga0495592_0056847 3300046454 Bacteria 2889
418 Ga0495651_0039674 3300046462 Bacteria 3665
419 Ga0495580_0001087 3300046472 Bacteria 23860
420 Ga0495664_0000849 3300046477 Bacteria 15703
421 Ga0495584_0195966 3300046491 Bacteria 1027
422 Ga0495608_0004054 3300046511 Bacteria 10513
423 Ga0495618_0113374 3300046514 Bacteria 1736
424 Ga0495628_0034281 3300046516 Bacteria 4084
425 Ga0495586_0092816 3300046535 Bacteria 1669
426 Ga0495587_0008765 3300046536 Bacteria 6488
427 Ga0495645_0013413 3300046543 Bacteria 5792
428 Ga0495667_0009781 3300046559 Bacteria 6495
429 Ga0495667_0013747 3300046559 Bacteria 5467
430 Ga0495668_0101752 3300046616 Bacteria 1572
431 Ga0495634_0134414 3300046642 Bacteria 1574
432 Ga0495635_0177024 3300046663 Bacteria 1450
433 Ga0495599_0045003 3300046678 Bacteria 2767
434 Ga0495599_0117392 3300046678 Bacteria 1655
435 Ga0495623_0014266 3300046679 Bacteria 5147
436 Ga0495646_0007052 3300046680 Bacteria 7139
437 Ga0495658_0095988 3300046683 Bacteria 1763
438 Ga0495600_0087159 3300046809 Bacteria 2037
439 Ga0495600_0132190 3300046809 Bacteria 1622
440 Ga0495604_0132462 3300047317 Bacteria 1790
441 Ga0495674_0108361 3300047319 Bacteria 2357
442 Ga0495674_0578651 3300047319 Bacteria 891
443 Ga0495680_0065560 3300047322 Bacteria 2781
444 Ga0495680_0228312 3300047322 Bacteria 1326
445 Ga0495680_0233304 3300047322 Bacteria 1309
446 Ga0495675_0007471 3300047444 Bacteria 6729
447 Ga0495684_0032636 3300047471 Bacteria 3998
448 Ga0495602_0000162 3300048088 Bacteria 62143
449 Ga0495602_0067428 3300048088 Bacteria 3079
450 Ga0496102_0101821 3300048905 Bacteria 2669
451 Ga0496102_0175835 3300048905 Bacteria 2016
452 Ga0496104_0005162 3300048907 Bacteria 11410
453 Ga0496105_0197467 3300048908 Bacteria 1643
454 Ga0496108_0424121 3300048911 Bacteria 1162
455 Ga0496109_0026903 3300048912 Bacteria 5131
456 Ga0496110_0088431 3300048913 Bacteria 2767
457 Ga0496112_0207239 3300048915 Bacteria 1918
458 Ga0496112_0232483 3300048915 Bacteria 1798
459 Ga0496119_0004311 3300048922 Bacteria 14204
460 Ga0501033_0310566 3300049570 Bacteria 1109
461 Ga0501034_0083894 3300049571 Bacteria 3188
462 Ga0501034_0143437 3300049571 Unclassified 2367
463 Ga0501036_0221515 3300049572 Bacteria 1589
464 Ga0501036_0297080 3300049572 Bacteria 1351
465 Ga0501039_0103454 3300049575 Bacteria 2223
466 Ga0501040_0001002 3300049576 Bacteria 17888
467 Ga0501041_0122730 3300049577 Bacteria 1615
468 Ga0501042_0132043 3300049578 Bacteria 1800
469 Ga0501042_0177859 3300049578 Bacteria 1535
470 Ga0501042_0214347 3300049578 Bacteria 1389
471 Ga0501046_0047656 3300049580 Bacteria 3397
472 Ga0501047_0221807 3300049581 Bacteria 1747
473 Ga0501067_0004586 3300049583 Bacteria 7644
474 Ga0501070_0204190 3300049586 Bacteria 1623
475 Ga0501072_0214625 3300049588 Bacteria 1533
476 Ga0501073_0082487 3300049589 Bacteria 2237
477 Ga0501074_0247820 3300049590 Bacteria 1267
478 Ga0501075_0047716 3300049591 Bacteria 3218
479 Ga0501076_0059379 3300049592 Bacteria 3042
480 Ga0501076_0233901 3300049592 Bacteria 1502
481 Ga0501076_0386006 3300049592 Bacteria 1151
482 Ga0501077_0181201 3300049593 Bacteria 1339
483 Ga0501079_0071438 3300049741 Bacteria 2682
484 Ga0501079_0075029 3300049741 Bacteria 2615
485 Ga0501080_0139941 3300049742 Bacteria 2238
486 Ga0501080_0220778 3300049742 Bacteria 1735
487 Ga0501081_0043678 3300049743 Bacteria 3075
488 Ga0501081_0110078 3300049743 Bacteria 1954
489 Ga0501081_0207516 3300049743 Bacteria 1422
490 Ga0501035_0002722 3300049822 Bacteria 17156
491 Ga0501044_0077839 3300049823 Bacteria 3362
492 Ga0501044_0271787 3300049823 Bacteria 1630
493 nmdc:mga03683_39378_c1 3300050489 Bacteria 1935
494 nmdc:mga0yw44_46455_c1 3300050492 Bacteria 2607
495 nmdc:mga07m45_223165_c1 3300050496 Bacteria 1096
496 nmdc:mga05p37_14292_c1 3300050507 Bacteria 9534
497 nmdc:mga05p37_190962_c1 3300050507 Bacteria 2487
498 nmdc:mga05p37_198801_c1 3300050507 Bacteria 2429
499 nmdc:mga05p37_25039_c1 3300050507 Bacteria 7255
500 nmdc:mga05p37_335041_c1 3300050507 Bacteria 1786
501 nmdc:mga05p37_368689_c1 3300050507 Bacteria 1686
502 nmdc:mga05p37_384446_c1 3300050507 Bacteria 1643
503 nmdc:mga05p37_415309_c1 3300050507 Bacteria 1567
504 nmdc:mga05p37_4197_c1 3300050507 Bacteria 16837
505 nmdc:mga05p37_51897_c1 3300050507 Bacteria 5043
506 nmdc:mga05p37_519764_c1 3300050507 Bacteria 1362
507 nmdc:mga05p37_68076_c1 3300050507 Bacteria 4378
508 nmdc:mga05p37_71108_c1 3300050507 Bacteria 4280
509 nmdc:mga05p37_80784_c1 3300050507 Bacteria 4005
510 nmdc:mga09592_23000_c1 3300050508 Bacteria 5143
511 nmdc:mga09592_2313_c1 3300050508 Bacteria 15364
512 nmdc:mga09592_26072_c1 3300050508 Bacteria 4841
513 nmdc:mga09592_28735_c1 3300050508 Bacteria 4622
514 nmdc:mga09592_39254_c1 3300050508 Bacteria 3976
515 nmdc:mga09592_40309_c1 3300050508 Bacteria 3923
516 nmdc:mga09592_60318_c1 3300050508 Bacteria 3207
517 nmdc:mga09592_91052_c1 3300050508 Bacteria 2606
518 nmdc:mga0qj67_111984_c1 3300050509 Bacteria 2204
519 nmdc:mga0qj67_117675_c1 3300050509 Bacteria 2148
520 nmdc:mga0qj67_123898_c1 3300050509 Bacteria 2091
521 nmdc:mga0qj67_152782_c1 3300050509 Bacteria 1873
522 nmdc:mga0qj67_38194_c1 3300050509 Bacteria 3766
523 nmdc:mga0qj67_643467_c1 3300050509 Bacteria 846
524 nmdc:mga0qj67_95080_c1 3300050509 Bacteria 2398
525 nmdc:mga06r32_13723_c1 3300050510 Bacteria 7347
526 nmdc:mga06r32_162744_c1 3300050510 Bacteria 2214
527 nmdc:mga06r32_16577_c1 3300050510 Bacteria 6717
528 nmdc:mga06r32_3432_c1 3300050510 Bacteria 14179
529 nmdc:mga06r32_3531_c1 3300050510 Bacteria 13964
530 nmdc:mga06r32_53_c1 3300050510 Bacteria 72230
531 nmdc:mga06r32_66791_c1 3300050510 Bacteria 3471
532 nmdc:mga06r32_68894_c1 3300050510 Bacteria 3418
533 nmdc:mga06r32_763561_c1 3300050510 Unclassified 929
534 nmdc:mga06r32_77532_c1 3300050510 Bacteria 3229
535 nmdc:mga06r32_8216_c1 3300050510 Bacteria 9395
536 nmdc:mga06r32_88670_c1 3300050510 Bacteria 3020
537 nmdc:mga08y16_13395_c1 3300050511 Bacteria 8625
538 nmdc:mga08y16_17015_c1 3300050511 Bacteria 7657
539 nmdc:mga08y16_181366_c1 3300050511 Bacteria 2186
540 nmdc:mga08y16_248429_c1 3300050511 Bacteria 1838
541 nmdc:mga08y16_265612_c1 3300050511 Bacteria 1772
542 nmdc:mga08y16_3596_c1 3300050511 Bacteria 16099
543 nmdc:mga08y16_4811_c1 3300050511 Bacteria 14084
544 nmdc:mga08y16_583405_c1 3300050511 Bacteria 1128
545 nmdc:mga08y16_82551_c1 3300050511 Bacteria 3350
546 nmdc:mga0n895_166025_c1 3300050512 Bacteria 2239
547 nmdc:mga0n895_188193_c1 3300050512 Bacteria 2095
548 nmdc:mga0n895_252223_c1 3300050512 Bacteria 1791
549 nmdc:mga0n895_273909_c1 3300050512 Bacteria 1712
550 nmdc:mga0n895_62199_c1 3300050512 Bacteria 3689
551 nmdc:mga0rr50_116976_c1 3300050513 Bacteria 2117
552 nmdc:mga0rr50_156073_c1 3300050513 Bacteria 1849
553 nmdc:mga0rr50_66096_c1 3300050513 Bacteria 2742
554 nmdc:mga08x19_45776_c1 3300050514 Bacteria 2796
555 nmdc:mga0a205_105573_c1 3300050515 Bacteria 2716
556 nmdc:mga0a205_157_c1 3300050515 Bacteria 44357
557 nmdc:mga0a205_159330_c1 3300050515 Bacteria 2154
558 nmdc:mga0a205_4530_c1 3300050515 Bacteria 12473
559 nmdc:mga0a205_60477_c1 3300050515 Bacteria 3658
560 nmdc:mga0a205_8656_c1 3300050515 Bacteria 9263
561 nmdc:mga0a205_898_c2 3300050515 Bacteria 14474
562 Ga0495601_0002864 3300053077 Bacteria 9804
563 Ga0495601_0011429 3300053077 Bacteria 5310
564 Ga0495601_0019934 3300053077 Bacteria 4093
565 Ga0495612_0018359 3300053078 Bacteria 2801
566 Ga0495595_0027540 3300053084 Bacteria 2533
567 Ga0495595_0074096 3300053084 Bacteria 1613
568 Ga0495619_0011373 3300053085 Bacteria 5604
569 Ga0495619_0013391 3300053085 Bacteria 5168
570 Ga0495619_0039578 3300053085 Bacteria 3078
571 Ga0495619_0130516 3300053085 Bacteria 1727
572 Ga0500647_0040508 3300053091 Bacteria 2235
573 Ga0500568_0019036 3300053139 Bacteria 2993
574 Ga0500620_090256 3300053155 Bacteria 1067
575 Ga0501084_0068122 3300054114 Bacteria 2980
576 Ga0530510_0075944 3300061734 Bacteria 2441
577 Ga0530510_0271229 3300061734 Bacteria 1266
578 Ga0495592_0083268
579 JGI25406J46586_10019554
580 Ga0070658_10019915
581 Ga0070683_100002614
582 Ga0070683_100051578
583 Ga0070683_100123720
584 Ga0070690_100215024
585 Ga0070670_100520547
586 Ga0068869_100118253
587 Ga0070680_100006963
588 Ga0070680_100010559
589 Ga0070680_100029669
590 Ga0070682_100079648
591 Ga0068868_100019021
592 Ga0068868_100372083
593 Ga0070660_100472359
594 Ga0070689_100144086
595 Ga0070691_10021049
596 Ga0070687_100025284
597 Ga0070661_100001848
598 Ga0070668_100294167
599 Ga0070669_100235371
600 Ga0070671_100209563
601 Ga0070674_100215251
602 Ga0070659_100002454
603 Ga0070667_100224570
604 Ga0070714_100032223
605 Ga0070714_100036191
606 Ga0070714_100330987
607 Ga0070714_100462387
608 Ga0070714_100711262
609 Ga0070713_100009696
610 Ga0070713_100095284
611 Ga0070713_100629069
612 Ga0070710_10001612
613 Ga0070710_10001720
614 Ga0070710_10147216
615 Ga0070701_10064526
616 Ga0070711_100004534
617 Ga0070711_100037647
618 Ga0070700_100052192
619 Ga0070708_100007087
620 Ga0070708_100105327
621 Ga0070708_100225564
622 Ga0070663_100272397
623 Ga0070678_100179854
624 Ga0070678_100271341
625 Ga0070681_10010150
626 Ga0070681_10017515
627 Ga0070681_10127348
628 Ga0070706_100050157
629 Ga0070706_100088879
630 Ga0070706_100146771
631 Ga0070707_100007719
632 Ga0070707_100028039
633 Ga0070707_100158170
634 Ga0070707_100280255
635 Ga0070707_100289545
636 Ga0070698_100006786
637 Ga0070698_100026400
638 Ga0070698_100055879
639 Ga0070698_100096548
640 Ga0070698_100384261
641 Ga0070699_100005675
642 Ga0070699_100013179
643 Ga0070699_100071030
644 Ga0070699_100134287
645 Ga0070679_100061071
646 Ga0070684_100023673
647 Ga0070684_100093524
648 Ga0070684_100160476
649 Ga0070697_100064824
650 Ga0070697_100172620
651 Ga0068853_100298387
652 Ga0070695_100004741
653 Ga0070696_100027078
654 Ga0070696_100530314
655 Ga0070665_100139672
656 Ga0070665_100141126
657 Ga0068855_100006207
658 Ga0070664_100024759
659 Ga0070664_100118806
660 Ga0068854_100045405
661 Ga0068856_100007707
662 Ga0068856_100360534
663 Ga0068852_100049010
664 Ga0068852_100284281
665 Ga0068859_100309677
666 Ga0068864_100075087
667 Ga0068864_100451673
668 Ga0068861_100279861
669 Ga0068863_100016618
670 Ga0068858_100222205
671 Ga0068858_100362034
672 Ga0068858_100668485
673 Ga0068860_100643699
674 Ga0068862_100002673
675 Ga0068862_100232266
676 Ga0068862_100547000
677 Ga0081455_10000637
678 Ga0081455_10004055
679 Ga0081538_10009864
680 Ga0081540_1008886
681 Ga0081540_1032736
682 Ga0081539_10000044
683 Ga0081539_10000772
684 Ga0081539_10001514
685 Ga0070717_10024846
686 Ga0070717_10027375
687 Ga0070717_10032035
688 Ga0070717_10072881
689 Ga0070717_10074149
690 Ga0070717_10091747
691 Ga0070717_10222742
692 Ga0070717_10274431
693 Ga0070716_100052773
694 Ga0070712_100008694
695 Ga0075369_10050067
696 Ga0075428_100000358
697 Ga0075428_100022540
698 Ga0075428_100036484
699 Ga0075428_100055693
700 Ga0075428_100067341
701 Ga0075428_100218615
702 Ga0075428_100430448
703 Ga0075428_100565966
704 Ga0075430_100003107
705 Ga0075430_100118192
706 Ga0075430_100124795
707 Ga0075430_100133941
708 Ga0075430_100187331
709 Ga0075431_100001284
710 Ga0075431_100005830
711 Ga0075431_100005838
712 Ga0075431_100007402
713 Ga0075431_100009346
714 Ga0075431_100020147
715 Ga0075431_100025203
716 Ga0075431_100055178
717 Ga0075431_100112050
718 Ga0075433_10005488
719 Ga0075433_10048835
720 Ga0075433_10075354
721 Ga0075433_10112929
722 Ga0075433_10118753
723 Ga0075433_10184515
724 Ga0075433_10197918
725 Ga0075434_100001101
726 Ga0075434_100003725
727 Ga0075434_100069679
728 Ga0075434_100095696
729 Ga0075434_100167933
730 Ga0075434_100255390
731 Ga0075429_100001958
732 Ga0075429_100020609
733 Ga0075429_100023690
734 Ga0075429_100032848
735 Ga0075429_100045716
736 Ga0075429_100059753
737 Ga0075429_100077333
738 Ga0075429_100359136
739 Ga0068865_100078122
740 Ga0097620_100309687
741 Ga0075435_100059429
742 Ga0075435_100094245
743 Ga0075435_100175667
744 Ga0099794_10007403
745 Ga0099795_10032441
746 Ga0099795_10058993
747 Ga0105240_10550224
748 Ga0105240_10600204
749 Ga0111539_10000139
750 Ga0111539_10000319
751 Ga0111539_10006317
752 Ga0111539_10057976
753 Ga0111539_10107664
754 Ga0111539_10604477
755 Ga0111539_10646420
756 Ga0105245_10044722
757 Ga0105247_10037546
758 Ga0105247_10268749
759 Ga0114129_10000149
760 Ga0114129_10003297
761 Ga0114129_10004885
762 Ga0114129_10005930
763 Ga0114129_10010031
764 Ga0114129_10015533
765 Ga0114129_10017681
766 Ga0114129_10104384
767 Ga0114129_10193151
768 Ga0114129_10292603
769 Ga0114129_10297705
770 Ga0114129_10316501
771 Ga0114129_10335865
772 Ga0114129_10414538
773 Ga0105243_10191700
774 Ga0105241_10000874
775 Ga0105242_10330233
776 Ga0105237_10032090
777 Ga0105237_10158491
778 Ga0105237_10515202
779 Ga0105238_10051722
780 Ga0099796_10066635
781 Ga0105239_10266658
782 Ga0105239_10294118
783 Ga0105239_10452178
784 Ga0105239_10674929
785 Ga0157373_10000408
786 Ga0157371_10481468
787 Ga0157370_10095691
788 Ga0157370_10458761
789 Ga0157369_10006391
790 Ga0157378_10069985
791 Ga0157378_10719089
792 Ga0163162_10042520
793 Ga0163162_10222301
794 Ga0163162_10276487
795 Ga0157372_10000902
796 Ga0157372_10225200
797 Ga0157372_10281670
798 Ga0163163_10137137
799 Ga0157380_10044636
800 Ga0157380_10143564
801 Ga0157379_10202999
802 Ga0157379_10489952
803 Ga0206354_10751500
804 Ga0206353_11566805
805 Ga0213873_10017801
806 Ga0213876_10001191
807 Ga0213876_10037467
808 Ga0213876_10271301
809 Ga0213875_10000852
810 Ga0213875_10001926
811 Ga0213875_10003545
812 Ga0213875_10007554
813 Ga0213875_10046244
814 Ga0213875_10079101
815 Ga0207426_1011443
816 Ga0207426_1015163
817 Ga0207682_10059570
818 Ga0207692_10081366
819 Ga0207692_10285974
820 Ga0207680_10313252
821 Ga0207699_10396527
822 Ga0207705_10025057
823 Ga0207684_10115734
824 Ga0207707_10017366
825 Ga0207707_10030166
826 Ga0207707_10053395
827 Ga0207671_10032167
828 Ga0207693_10005304
829 Ga0207693_10040721
830 Ga0207693_10089964
831 Ga0207693_10222618
832 Ga0207693_10311337
833 Ga0207693_10462818
834 Ga0207663_10106834
835 Ga0207663_10182536
836 Ga0207663_10472996
837 Ga0207660_10050198
838 Ga0207660_10159082
839 Ga0207657_10111004
840 Ga0207652_10117193
841 Ga0207646_10011778
842 Ga0207646_10013167
843 Ga0207646_10034689
844 Ga0207646_10114681
845 Ga0207646_10199903
846 Ga0207681_10207936
847 Ga0207700_10029562
848 Ga0207700_10068418
849 Ga0207700_10131497
850 Ga0207700_10201546
851 Ga0207700_10286611
852 Ga0207664_10110328
853 Ga0207664_10161831
854 Ga0207664_10163383
855 Ga0207644_10158613
856 Ga0207706_10577739
857 Ga0207686_10134183
858 Ga0207670_10114841
859 Ga0207669_10111913
860 Ga0207704_10067452
861 Ga0207665_10100810
862 Ga0207665_10179688
863 Ga0207691_10055992
864 Ga0207661_10011785
865 Ga0207679_10121005
866 Ga0207679_10200991
867 Ga0207667_10302514
868 Ga0207712_10273193
869 Ga0207668_10331759
870 Ga0207640_10054529
871 Ga0207677_10420157
872 Ga0207703_10126449
873 Ga0207678_10346914
874 Ga0207708_10176460
875 Ga0207702_10020284
876 Ga0207702_10044343
877 Ga0207648_10086640
878 Ga0207676_10290750
879 Ga0207676_10312952
880 Ga0207675_100054477
881 Ga0207675_100455197
882 Ga0207675_100745141
883 Ga0207683_10052145
884 Ga0207698_10004184
885 Ga0209974_10028449
886 Ga0207428_10000239
887 Ga0207428_10000960
888 Ga0268266_10073198
889 Ga0268266_10324658
890 Ga0268265_10003859
891 Ga0265334_10105475
892 Ga0265318_10033332
893 Ga0265338_10015655
894 Ga0265332_10001991
895 Ga0265339_10000279
896 Ga0265339_10174055
897 Ga0265331_10067501
898 Ga0265316_10046822
899 Ga0307408_100249060
900 Ga0307408_100335501
901 Ga0307408_100543690
902 Ga0265313_10073990
903 Ga0265314_10002991
904 Ga0265342_10152082
905 Ga0307410_10252679
906 Ga0307406_10069542
907 Ga0307412_10215329
908 Ga0307409_100267667
909 Ga0307416_100035260
910 Ga0307415_100193042
911 Ga0373959_0014888
912 Ga0373928_0016812
913 Ga0373928_0062677
914 Ga0373934_0031963
915 Ga0373951_0044053
916 Ga0373952_0035306
917 Ga0373936_0019663
918 Ga0373936_0145659
919 Ga0373939_0015015
920 Ga0373953_0020153
921 Ga0373956_0010387
922 Ga0373957_0012237
923 Ga0373946_0049411
924 Ga0373961_0024456
925 Ga0373931_0090000
926 Ga0373931_0117798
927 Ga0373931_0124463
928 Ga0373935_0050955
929 Ga0373935_0083624
930 Ga0373927_0041844
931 Ga0373927_0088001
932 Ga0373927_0102879
933 Ga0373933_0003149
934 Ga0373933_0009008
935 Ga0373933_0041381
936 Ga0373947_0033242
937 Ga0373947_0034121
938 Ga0373937_0018651
939 Ga0373937_0037236
940 Ga0373937_0042900
941 Ga0373937_0047565
942 Ga0373937_0425905
943 Ga0373925_0037743
944 Ga0373925_0165855
945 Ga0395899_0001978
946 Ga0395899_0046095
947 Ga0395899_0102608
948 Ga0395899_0124963
949 Ga0395900_0019093
950 Ga0395900_0023910
951 Ga0395900_0028422
952 Ga0395900_0041095
953 Ga0395898_0200281
954 Ga0395905_0121422
955 Ga0436364_0036004
956 Ga0436364_0167149
957 Ga0436364_0259249
958 Ga0436364_0266271
959 Ga0436364_0668201
960 Ga0436364_0777786
961 Ga0436364_0999480
962 Ga0436364_1191432
963 Ga0436364_1250008
964 Ga0436364_1295067
965 Ga0436364_1434326
966 Ga0395901_0005326
967 Ga0395901_0008713
968 Ga0395901_0014831
969 Ga0395901_0091953
970 Ga0395901_0267004
971 Ga0395901_0344370
972 Ga0436365_0114166
973 Ga0436365_0379608
974 Ga0436365_0846099
975 Ga0436365_1199999
976 Ga0436365_1858420
977 Ga0436360_0103850
978 Ga0436360_0683254
979 Ga0436361_0782247
980 Ga0436361_1048232
981 Ga0436363_0626431
982 Ga0436362_1039322
983 Ga0439441_005289
984 Ga0439448_0082373
985 Ga0439458_0012360
986 Ga0451577_0000840
987 Ga0451577_0030171
988 Ga0453683_0056543
989 Ga0466963_0171869
990 Ga0453684_0033267
991 Ga0451576_0004313
992 Ga0451576_0231868
993 Ga0466967_0033192
994 Ga0495592_0056847
995 Ga0495651_0039674
996 Ga0495580_0001087
997 Ga0495664_0000849
998 Ga0495584_0195966
999 Ga0495608_0004054
1000 Ga0495618_0113374
1001 Ga0495628_0034281
1002 Ga0495586_0092816
1003 Ga0495587_0008765
1004 Ga0495645_0013413
1005 Ga0495667_0009781
1006 Ga0495667_0013747
1007 Ga0495668_0101752
1008 Ga0495634_0134414
1009 Ga0495635_0177024
1010 Ga0495599_0045003
1011 Ga0495599_0117392
1012 Ga0495623_0014266
1013 Ga0495646_0007052
1014 Ga0495658_0095988
1015 Ga0495600_0087159
1016 Ga0495600_0132190
1017 Ga0495604_0132462
1018 Ga0495674_0108361
1019 Ga0495674_0578651
1020 Ga0495680_0065560
1021 Ga0495680_0228312
1022 Ga0495680_0233304
1023 Ga0495675_0007471
1024 Ga0495684_0032636
1025 Ga0495602_0000162
1026 Ga0495602_0067428
1027 Ga0496102_0101821
1028 Ga0496102_0175835
1029 Ga0496104_0005162
1030 Ga0496105_0197467
1031 Ga0496108_0424121
1032 Ga0496109_0026903
1033 Ga0496110_0088431
1034 Ga0496112_0207239
1035 Ga0496112_0232483
1036 Ga0496119_0004311
1037 Ga0501033_0310566
1038 Ga0501034_0083894
1039 Ga0501034_0143437
1040 Ga0501036_0221515
1041 Ga0501036_0297080
1042 Ga0501039_0103454
1043 Ga0501040_0001002
1044 Ga0501041_0122730
1045 Ga0501042_0132043
1046 Ga0501042_0177859
1047 Ga0501042_0214347
1048 Ga0501046_0047656
1049 Ga0501047_0221807
1050 Ga0501067_0004586
1051 Ga0501070_0204190
1052 Ga0501072_0214625
1053 Ga0501073_0082487
1054 Ga0501074_0247820
1055 Ga0501075_0047716
1056 Ga0501076_0059379
1057 Ga0501076_0233901
1058 Ga0501076_0386006
1059 Ga0501077_0181201
1060 Ga0501079_0071438
1061 Ga0501079_0075029
1062 Ga0501080_0139941
1063 Ga0501080_0220778
1064 Ga0501081_0043678
1065 Ga0501081_0110078
1066 Ga0501081_0207516
1067 Ga0501035_0002722
1068 Ga0501044_0077839
1069 Ga0501044_0271787
1070 nmdc:mga03683_39378_c1
1071 nmdc:mga0yw44_46455_c1
1072 nmdc:mga07m45_223165_c1
1073 nmdc:mga05p37_14292_c1
1074 nmdc:mga05p37_190962_c1
1075 nmdc:mga05p37_198801_c1
1076 nmdc:mga05p37_25039_c1
1077 nmdc:mga05p37_335041_c1
1078 nmdc:mga05p37_368689_c1
1079 nmdc:mga05p37_384446_c1
1080 nmdc:mga05p37_415309_c1
1081 nmdc:mga05p37_4197_c1
1082 nmdc:mga05p37_51897_c1
1083 nmdc:mga05p37_519764_c1
1084 nmdc:mga05p37_68076_c1
1085 nmdc:mga05p37_71108_c1
1086 nmdc:mga05p37_80784_c1
1087 nmdc:mga09592_23000_c1
1088 nmdc:mga09592_2313_c1
1089 nmdc:mga09592_26072_c1
1090 nmdc:mga09592_28735_c1
1091 nmdc:mga09592_39254_c1
1092 nmdc:mga09592_40309_c1
1093 nmdc:mga09592_60318_c1
1094 nmdc:mga09592_91052_c1
1095 nmdc:mga0qj67_111984_c1
1096 nmdc:mga0qj67_117675_c1
1097 nmdc:mga0qj67_123898_c1
1098 nmdc:mga0qj67_152782_c1
1099 nmdc:mga0qj67_38194_c1
1100 nmdc:mga0qj67_643467_c1
1101 nmdc:mga0qj67_95080_c1
1102 nmdc:mga06r32_13723_c1
1103 nmdc:mga06r32_162744_c1
1104 nmdc:mga06r32_16577_c1
1105 nmdc:mga06r32_3432_c1
1106 nmdc:mga06r32_3531_c1
1107 nmdc:mga06r32_53_c1
1108 nmdc:mga06r32_66791_c1
1109 nmdc:mga06r32_68894_c1
1110 nmdc:mga06r32_763561_c1
1111 nmdc:mga06r32_77532_c1
1112 nmdc:mga06r32_8216_c1
1113 nmdc:mga06r32_88670_c1
1114 nmdc:mga08y16_13395_c1
1115 nmdc:mga08y16_17015_c1
1116 nmdc:mga08y16_181366_c1
1117 nmdc:mga08y16_248429_c1
1118 nmdc:mga08y16_265612_c1
1119 nmdc:mga08y16_3596_c1
1120 nmdc:mga08y16_4811_c1
1121 nmdc:mga08y16_583405_c1
1122 nmdc:mga08y16_82551_c1
1123 nmdc:mga0n895_166025_c1
1124 nmdc:mga0n895_188193_c1
1125 nmdc:mga0n895_252223_c1
1126 nmdc:mga0n895_273909_c1
1127 nmdc:mga0n895_62199_c1
1128 nmdc:mga0rr50_116976_c1
1129 nmdc:mga0rr50_156073_c1
1130 nmdc:mga0rr50_66096_c1
1131 nmdc:mga08x19_45776_c1
1132 nmdc:mga0a205_105573_c1
1133 nmdc:mga0a205_157_c1
1134 nmdc:mga0a205_159330_c1
1135 nmdc:mga0a205_4530_c1
1136 nmdc:mga0a205_60477_c1
1137 nmdc:mga0a205_8656_c1
1138 nmdc:mga0a205_898_c2
1139 Ga0495601_0002864
1140 Ga0495601_0011429
1141 Ga0495601_0019934
1142 Ga0495612_0018359
1143 Ga0495595_0027540
1144 Ga0495595_0074096
1145 Ga0495619_0011373
1146 Ga0495619_0013391
1147 Ga0495619_0039578
1148 Ga0495619_0130516
1149 Ga0500647_0040508
1150 Ga0500568_0019036
1151 Ga0500620_090256
1152 Ga0501084_0068122
1153 Ga0530510_0075944
1154 Ga0530510_0271229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

41

279

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1luc-assembly1.cif.gz_A bacterial luciferase 0.8289 1 278
1luc-assembly1.cif.gz_A bacterial luciferase 0.8206 1 278
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8195 1 279
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8141 1 279
6ket-assembly1.cif.gz_B flavin-utilizing monooxygenase (ox) domain of hybrid polyketide/non-ribosomal peptide synthetase 0.8108 1 280
ID Description Score Start End Superfamily
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9639 16 275 3.20.20.30
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9566 16 275 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9419 1 277 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9374 1 278 3.20.20.30
af_I6XG43_1_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9308 1 278 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A2V7HCE7-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9945 1 168 GO:0016705
AF-A0A2V6RVL8-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9921 1 142 GO:0016705
AF-A0A2V6WJE8-F1-model_v4 LLM class F420-dependent oxidoreductase 0.992 34 182 GO:0008726
GO:0046306
AF-A0A2V6UAP1-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9919 1 178 GO:0008726
GO:0046306
AF-A0A383A412-F1-model_v4 Luciferase-like domain-containing protein 0.9907 1 175 GO:0008726
GO:0046306

Map