F465748

General Info

Members Datasets Scaffolds Average Seq Length
578 386 1156 459

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_135325|Ga0400483_135325_3914_5383
Length 489
Sequence MGLGLWRSDFCSRRLLGKIMPVVFDPIMQPTLVILVVGLSPALVGEHTPNLKTLADQGALRPLKTVTPAVTCTAQSTLVTGLMPSGHGAVANGWYFRDLSEVWLWRQSNRLVGGEKIWEAAKKKNPDFTCAKMFWWYNMYASADWSATPRPMYPADGRKIPDHYAEPPELHDELDAKLGQFPLFTFWGPVADISSSDWIAKATLHVMATRKPTLTLTYLPHLDYNLQRLGPDLDHPRLQEDLREIDACCGELIEAAEKEGRRVVVVSEYGITEVTDAVHINRALRQAGMIRVRPEEFGREILDAGASSAFAVADHQIAHVYVRDAARLGEVKQLIESLDGVEQVLDEDGKRAFGLDHPNSGELVAISKPDRWFSHYYWLDDNVAPDFARTVDIHRKPGYDPVELFFDPAISNPKLAAGWRLAKRKLGIRSLMDVISLKDTQLVRGSHGRLTDDPDHGPLVITSAPDLLDGDGAIEATAFKQLVLDHVFS

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
13 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
14 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
15 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
16 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
85 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
86 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
87 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
88 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
89 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
90 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
91 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
92 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
93 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
94 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
95 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
96 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
97 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
190 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
191 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
192 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
195 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
196 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
197 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
202 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
268 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
302 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
304 2511231004 Pseudomonas sp. GM102 Isolate Nodule
305 2511231007 Pseudomonas sp. GM18 Isolate Nodule
306 2511231016 Pseudomonas sp. GM50 Isolate Nodule
307 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
308 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
309 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
310 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
311 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
312 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
313 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
314 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
315 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
316 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
317 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
318 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
319 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
320 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
321 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
322 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
323 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
324 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
325 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
326 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
327 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
328 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
329 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
330 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
331 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
332 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
333 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
334 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
335 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
336 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
337 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
338 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
339 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
340 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
341 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
342 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
343 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
344 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
345 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
346 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
347 2643221711 Terrabacter sp. Root85 Isolate Unclassified
348 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
349 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
350 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
351 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
352 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
353 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
354 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
355 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
356 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
357 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
358 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
359 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
360 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
361 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
362 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
363 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
364 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
365 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
366 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
367 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
368 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
369 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
370 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
371 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
372 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
373 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
374 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
375 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
376 2952252522 Salinicola sp. DM10 Isolate Unclassified
377 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
378 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
379 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
380 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
381 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
382 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
383 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
384 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
385 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
386 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.64
Metatranscriptomes 0
Isolates 14.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.29
Nodule 0.52
Rhizoplane 8.82
Rhizosphere 80.62
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_135325 3300039062 Bacteria 6478
2 SwRhRL3b_contig_3029720 2162886006 Archaea 7122
3 ARcpr5oldR_c000086 3300000041 Archaea 16734
4 ARSoilYngRDRAFT_c00198 3300000042 Archaea 10085
5 ARcpr5yngRDRAFT_c000323 3300000043 Archaea 6560
6 ARCol0oldRDRAFT_c00380 3300000045 Archaea 4307
7 ARCol0yngRDRAFT_1000094 3300000652 Archaea 16580
8 JGI25162J39368_1000327 3300002737 Bacteria 41734
9 JGI25163J39215_1000190 3300002771 Bacteria 23907
10 JGI25164J39214_1000241 3300002772 Bacteria 41734
11 JGI25165J46597_1000442 3300003214 Bacteria 41734
12 JGI26129J50193_1000351 3300003349 Archaea 2869
13 JGI26144J50225_100436 3300003380 Archaea 1626
14 JGI26139J50223_100202 3300003382 Archaea 2914
15 JGI26130J50248_100096 3300003398 Archaea 4247
16 JGI26143J51219_1000185 3300003502 Archaea 2673
17 Ga0055536_1000343 3300003781 Bacteria 34478
18 Ga0055530_10000122 3300003791 Bacteria 67358
19 Ga0055530_10000488 3300003791 Bacteria 34478
20 Ga0055540_1000155 3300003792 Bacteria 67358
21 Ga0055540_1001256 3300003792 Bacteria 15495
22 JGI25405J52794_10007101 3300003911 Bacteria 2059
23 Ga0065717_1002164 3300005276 Archaea 2638
24 Ga0065704_10004821 3300005289 Archaea 5432
25 Ga0065704_10016340 3300005289 Archaea 8588
26 Ga0065704_10070517 3300005289 Bacteria 21943
27 Ga0065704_10073533 3300005289 Archaea 7046
28 Ga0065712_10000495 3300005290 Archaea 27180
29 Ga0065712_10100000 3300005290 Bacteria 2075
30 Ga0065715_10000193 3300005293 Archaea 48245
31 Ga0065715_10000629 3300005293 Archaea 24417
32 Ga0065715_10000853 3300005293 Archaea 10044
33 Ga0065707_10000202 3300005295 Archaea 9033
34 Ga0065707_10000468 3300005295 Archaea 35383
35 Ga0070658_10000812 3300005327 Bacteria 26680
36 Ga0070658_10005020 3300005327 Bacteria 10772
37 Ga0070676_10007854 3300005328 Archaea 5735
38 Ga0070676_10007867 3300005328 Archaea 5731
39 Ga0070670_100092650 3300005331 Archaea 2598
40 Ga0068869_100005727 3300005334 Archaea 7842
41 Ga0070680_100009455 3300005336 Archaea 7490
42 Ga0070691_10050674 3300005341 Archaea 1981
43 Ga0070661_100000170 3300005344 Bacteria 53577
44 Ga0070692_10016905 3300005345 Archaea 3477
45 Ga0070692_10018745 3300005345 Archaea 3332
46 Ga0070669_100042938 3300005353 Unclassified 3291
47 Ga0070669_100197443 3300005353 Archaea 1581
48 Ga0070673_100085361 3300005364 Archaea 2570
49 Ga0070659_100083859 3300005366 Archaea 2548
50 Ga0070701_10008163 3300005438 Archaea 4511
51 Ga0070701_10090970 3300005438 Archaea 1672
52 Ga0070705_100006381 3300005440 Archaea 5781
53 Ga0070705_100028989 3300005440 Archaea 3038
54 Ga0070700_100012353 3300005441 Archaea 4761
55 Ga0070694_100017061 3300005444 Bacteria 4583
56 Ga0070694_100072006 3300005444 Archaea 2384
57 Ga0070694_100147679 3300005444 Archaea 1714
58 Ga0070708_100292383 3300005445 Archaea 1534
59 Ga0070662_100027988 3300005457 Archaea 3919
60 Ga0070662_100117727 3300005457 Archaea 2032
61 Ga0070681_10024049 3300005458 Archaea 6134
62 Ga0070681_10095946 3300005458 Archaea 2914
63 Ga0068867_100002599 3300005459 Archaea 12731
64 Ga0068867_100004549 3300005459 Archaea 9752
65 Ga0068867_100158747 3300005459 Archaea 1782
66 Ga0070698_100220833 3300005471 Archaea 1829
67 Ga0070697_100120544 3300005536 Archaea 2194
68 Ga0068853_100010847 3300005539 Bacteria 7381
69 Ga0070672_100021068 3300005543 Archaea 4766
70 Ga0070672_100028182 3300005543 Archaea 4198
71 Ga0070672_100048589 3300005543 Archaea 3298
72 Ga0070672_100097429 3300005543 Archaea 2381
73 Ga0070686_100065330 3300005544 Archaea 2363
74 Ga0070695_100003214 3300005545 Bacteria 9535
75 Ga0070695_100031272 3300005545 Archaea 3319
76 Ga0070696_100014109 3300005546 Archaea 5363
77 Ga0070696_100015588 3300005546 Archaea 5106
78 Ga0070693_100014323 3300005547 Archaea 4061
79 Ga0068855_100004104 3300005563 Bacteria 17766
80 Ga0068855_100130371 3300005563 Bacteria 2872
81 Ga0070664_100011900 3300005564 Bacteria 7062
82 Ga0070702_100000923 3300005615 Archaea 11506
83 Ga0068864_100014528 3300005618 Archaea 6542
84 Ga0068864_100095411 3300005618 Archaea 2630
85 Ga0068870_10000381 3300005840 Archaea 16649
86 Ga0068870_10002319 3300005840 Archaea 7910
87 Ga0068858_100010081 3300005842 Bacteria 8970
88 Ga0068858_100132133 3300005842 Unclassified 2341
89 Ga0068860_100000347 3300005843 Bacteria 62207
90 Ga0068860_100031595 3300005843 Archaea 5089
91 Ga0068860_100099752 3300005843 Archaea 2770
92 Ga0068860_100176512 3300005843 Unclassified 2065
93 Ga0081455_10000282 3300005937 Bacteria 67197
94 Ga0081455_10001563 3300005937 Archaea 28124
95 Ga0081538_10030463 3300005981 Bacteria 3662
96 Ga0081538_10038273 3300005981 Bacteria 3097
97 Ga0081540_1000758 3300005983 Bacteria 29737
98 Ga0081540_1004147 3300005983 Bacteria 11171
99 Ga0081540_1053354 3300005983 Bacteria 1983
100 Ga0075432_10027939 3300006058 Bacteria 1945
101 Ga0075432_10048561 3300006058 Bacteria 1493
102 Ga0097621_100025594 3300006237 Archaea 4619
103 Ga0075428_100017329 3300006844 Bacteria 7961
104 Ga0075428_100019636 3300006844 Bacteria 7477
105 Ga0075431_100002097 3300006847 Bacteria 19055
106 Ga0075433_10004035 3300006852 Bacteria 11356
107 Ga0075433_10007828 3300006852 Archaea 8498
108 Ga0075434_100051483 3300006871 Bacteria 4093
109 Ga0075434_100104546 3300006871 Bacteria 2841
110 Ga0075434_100213144 3300006871 Archaea 1951
111 Ga0075429_100014469 3300006880 Archaea 6838
112 Ga0068865_100037370 3300006881 Archaea 3278
113 Ga0075436_100008865 3300006914 Archaea 6881
114 Ga0075436_100063043 3300006914 Unclassified 2562
115 Ga0075435_100016225 3300007076 Archaea 5614
116 Ga0075435_100030048 3300007076 Bacteria 4269
117 Ga0075435_100049888 3300007076 Bacteria 3367
118 Ga0105244_10000733 3300009036 Bacteria 28098
119 Ga0105244_10002094 3300009036 Bacteria 15352
120 Ga0105244_10002454 3300009036 Bacteria 13966
121 Ga0105244_10052375 3300009036 Archaea 2078
122 Ga0105240_10000069 3300009093 Bacteria 205335
123 Ga0111539_10000972 3300009094 Bacteria 37616
124 Ga0111539_10027726 3300009094 Bacteria 6919
125 Ga0111539_10047260 3300009094 Archaea 5144
126 Ga0111539_10064965 3300009094 Archaea 4315
127 Ga0114129_10107860 3300009147 Archaea 3845
128 Ga0114129_10411606 3300009147 Archaea 1780
129 Ga0105243_10000020 3300009148 Bacteria 214279
130 Ga0105243_10000449 3300009148 Bacteria 42923
131 Ga0105242_10000845 3300009176 Bacteria 23811
132 Ga0105237_10000517 3300009545 Bacteria 54535
133 Ga0105237_10026180 3300009545 Bacteria 5962
134 Ga0105237_10077308 3300009545 Archaea 3318
135 Ga0105238_10004458 3300009551 Bacteria 13882
136 Ga0105249_10037587 3300009553 Unclassified 4393
137 Ga0105239_10159519 3300010375 Unclassified 2519
138 Ga0105246_10000181 3300011119 Bacteria 30804
139 Ga0105246_10029511 3300011119 Archaea 3613
140 Ga0157336_1000008 3300012477 Archaea 7973
141 Ga0157346_1000099 3300012480 Archaea 3354
142 Ga0157337_1000013 3300012483 Archaea 7709
143 Ga0157325_1000032 3300012485 Archaea 5750
144 Ga0157341_1000028 3300012494 Archaea 5688
145 Ga0157323_1000079 3300012495 Archaea 4378
146 Ga0157345_1000610 3300012498 Archaea 3041
147 Ga0157314_1000938 3300012500 Archaea 2338
148 Ga0157313_1000274 3300012503 Archaea 2417
149 Ga0157342_1000009 3300012507 Archaea 7995
150 Ga0157315_1000054 3300012508 Archaea 4796
151 Ga0157316_1000009 3300012510 Archaea 8815
152 Ga0157327_1000105 3300012512 Archaea 3745
153 Ga0157338_1000019 3300012515 Archaea 7159
154 Ga0157373_10005925 3300013100 Bacteria 9147
155 Ga0157371_10000814 3300013102 Bacteria 35852
156 Ga0157370_10084645 3300013104 Bacteria 2980
157 Ga0157374_10078062 3300013296 Archaea 3135
158 Ga0157378_10124885 3300013297 Unclassified 2376
159 Ga0163162_10052859 3300013306 Archaea 4081
160 Ga0157375_10000142 3300013308 Bacteria 71529
161 Ga0157375_10007077 3300013308 Archaea 9796
162 Ga0157375_10007718 3300013308 Bacteria 9416
163 Ga0157375_10011776 3300013308 Bacteria 7734
164 Ga0157380_10019104 3300014326 Archaea 5103
165 Ga0182008_10001501 3300014497 Bacteria 15567
166 Ga0157377_10000870 3300014745 Archaea 12589
167 Ga0182006_1000073 3300015261 Bacteria 131224
168 Ga0182006_1001754 3300015261 Bacteria 12576
169 Ga0182007_10000031 3300015262 Bacteria 152299
170 Ga0182007_10000768 3300015262 Bacteria 17959
171 Ga0182005_1000755 3300015265 Bacteria 14802
172 Ga0163161_10004740 3300017792 Archaea 9457
173 Ga0209760_100153 3300025207 Bacteria 42023
174 Ga0207427_100056 3300025231 Bacteria 204343
175 Ga0209437_100065 3300025233 Bacteria 332417
176 Ga0209759_1003588 3300025256 Bacteria 6124
177 Ga0209233_1000085 3300025261 Bacteria 333078
178 Ga0207673_1002889 3300025290 Archaea 1986
179 Ga0209676_1000337 3300025292 Bacteria 89361
180 Ga0209050_1000013 3300025298 Bacteria 811408
181 Ga0209050_1000093 3300025298 Bacteria 250654
182 Ga0209050_1000106 3300025298 Bacteria 224396
183 Ga0209051_1000007 3300025303 Bacteria 811408
184 Ga0209051_1000260 3300025303 Bacteria 88213
185 Ga0207697_10000644 3300025315 Archaea 19855
186 Ga0207655_1000098 3300025728 Bacteria 190699
187 Ga0207655_1000125 3300025728 Bacteria 152896
188 Ga0207655_1000901 3300025728 Bacteria 31143
189 Ga0207655_1002375 3300025728 Bacteria 15346
190 Ga0207688_10002216 3300025901 Archaea 10465
191 Ga0207647_10002079 3300025904 Archaea 15315
192 Ga0207647_10013425 3300025904 Archaea 5677
193 Ga0207645_10009037 3300025907 Archaea 6918
194 Ga0207645_10020989 3300025907 Archaea 4266
195 Ga0207645_10021790 3300025907 Archaea 4174
196 Ga0207645_10022401 3300025907 Archaea 4110
197 Ga0207643_10000173 3300025908 Archaea 44225
198 Ga0207643_10000239 3300025908 Archaea 38264
199 Ga0207705_10001468 3300025909 Bacteria 18793
200 Ga0207705_10004141 3300025909 Bacteria 10998
201 Ga0207707_10029485 3300025912 Unclassified 4798
202 Ga0207707_10116047 3300025912 Archaea 2339
203 Ga0207695_10000186 3300025913 Bacteria 179847
204 Ga0207671_10000370 3300025914 Bacteria 63691
205 Ga0207662_10001156 3300025918 Archaea 12497
206 Ga0207649_10000139 3300025920 Bacteria 60740
207 Ga0207649_10065894 3300025920 Archaea 2294
208 Ga0207681_10005461 3300025923 Archaea 7806
209 Ga0207694_10007816 3300025924 Bacteria 8097
210 Ga0207650_10013650 3300025925 Archaea 5630
211 Ga0207690_10020936 3300025932 Archaea 4049
212 Ga0207690_10075869 3300025932 Archaea 2333
213 Ga0207706_10012849 3300025933 Archaea 7621
214 Ga0207706_10020925 3300025933 Archaea 5874
215 Ga0207709_10000004 3300025935 Bacteria 825156
216 Ga0207709_10000343 3300025935 Bacteria 48072
217 Ga0207669_10087722 3300025937 Archaea 2016
218 Ga0207691_10006714 3300025940 Archaea 11097
219 Ga0207691_10020950 3300025940 Archaea 6179
220 Ga0207691_10071509 3300025940 Archaea 3130
221 Ga0207691_10098326 3300025940 Archaea 2614
222 Ga0207689_10008131 3300025942 Archaea 9151
223 Ga0207679_10000034 3300025945 Bacteria 147162
224 Ga0207667_10011801 3300025949 Bacteria 10122
225 Ga0207667_10149108 3300025949 Bacteria 2408
226 Ga0207651_10135500 3300025960 Archaea 1893
227 Ga0207712_10006493 3300025961 Archaea 7374
228 Ga0207712_10042147 3300025961 Archaea 3142
229 Ga0207658_10004207 3300025986 Archaea 10026
230 Ga0207677_10013504 3300026023 Archaea 4736
231 Ga0207703_10007541 3300026035 Bacteria 8630
232 Ga0207639_10007605 3300026041 Bacteria 7390
233 Ga0207708_10005026 3300026075 Archaea 9751
234 Ga0207708_10020967 3300026075 Archaea 4931
235 Ga0207708_10160298 3300026075 Archaea 1776
236 Ga0207648_10001528 3300026089 Archaea 25487
237 Ga0207648_10002828 3300026089 Archaea 18417
238 Ga0207674_10002574 3300026116 Archaea 22843
239 Ga0209973_1000226 3300027252 Archaea 3826
240 Ga0209967_1000206 3300027364 Archaea 8365
241 Ga0209996_1000299 3300027395 Archaea 6197
242 Ga0209984_1000039 3300027424 Archaea 13516
243 Ga0210000_1000207 3300027462 Bacteria 8495
244 Ga0209995_1000608 3300027471 Archaea 5499
245 Ga0209995_1000899 3300027471 Bacteria 4610
246 Ga0209968_1001190 3300027526 Archaea 3980
247 Ga0209999_1000069 3300027543 Archaea 11743
248 Ga0209982_1000188 3300027552 Archaea 7097
249 Ga0209982_1005916 3300027552 Archaea 1773
250 Ga0209970_1000421 3300027614 Archaea 7185
251 Ga0210002_1006682 3300027617 Archaea 1742
252 Ga0209983_1000394 3300027665 Archaea 9349
253 Ga0209971_1001941 3300027682 Archaea 5054
254 Ga0209966_1000217 3300027695 Archaea 22959
255 Ga0209974_10000115 3300027876 Archaea 23215
256 Ga0207428_10000499 3300027907 Archaea 46861
257 Ga0207428_10001140 3300027907 Archaea 28784
258 Ga0207428_10009154 3300027907 Bacteria 8896
259 Ga0207428_10024457 3300027907 Bacteria 5070
260 Ga0207428_10041856 3300027907 Bacteria 3707
261 Ga0207428_10065920 3300027907 Bacteria 2854
262 Ga0268266_10114628 3300028379 Bacteria 2392
263 Ga0268265_10069328 3300028380 Unclassified 2737
264 Ga0268264_10001780 3300028381 Bacteria 19678
265 Ga0268264_10058705 3300028381 Archaea 3223
266 Ga0265338_10001579 3300028800 Bacteria 36700
267 Ga0265325_10000131 3300031241 Bacteria 51659
268 Ga0265339_10006781 3300031249 Bacteria 7471
269 Ga0265331_10000604 3300031250 Bacteria 31685
270 Ga0265327_10002617 3300031251 Bacteria 18606
271 Ga0307408_100002288 3300031548 Bacteria 13632
272 Ga0265313_10000774 3300031595 Bacteria 32494
273 Ga0265314_10000459 3300031711 Bacteria 54410
274 Ga0307409_100101195 3300031995 Bacteria 2391
275 Ga0307411_10010608 3300032005 Bacteria 4923
276 Ga0373959_0002595 3300034820 Archaea 2865
277 Ga0373939_0003722 3300035114 Bacteria 3591
278 Ga0373960_0005105 3300035121 Bacteria 3026
279 Ga0373961_0003576 3300035241 Bacteria 3828
280 Ga0373961_0006971 3300035241 Archaea 2720
281 Ga0373962_0007027 3300035242 Archaea 2747
282 Ga0373931_0002085 3300035691 Bacteria 8800
283 Ga0373931_0003146 3300035691 Bacteria 7367
284 Ga0373931_0006835 3300035691 Archaea 5364
285 Ga0316584_0048744 3300036712 Bacteria 3165
286 Ga0400483_043071 3300039062 Bacteria 13267
287 Ga0400483_159196 3300039062 Bacteria 7825
288 Ga0400483_176188 3300039062 Bacteria 10728
289 Ga0400483_233375 3300039062 Bacteria 10649
290 Ga0400483_252938 3300039062 Bacteria 1869
291 Ga0439453_0000246 3300041408 Archaea 5451
292 Ga0439453_0000919 3300041408 Archaea 3541
293 Ga0439461_0006098 3300041410 Bacteria 2088
294 Ga0439437_001011 3300042000 Archaea 2941
295 Ga0439441_004587 3300042001 Archaea 2103
296 Ga0439432_000086 3300042006 Bacteria 29117
297 Ga0439451_000095 3300042009 Bacteria 15663
298 Ga0439451_001065 3300042009 Archaea 5347
299 Ga0439452_012362 3300042010 Unclassified 2432
300 Ga0439456_003876 3300042013 Bacteria 3036
301 Ga0439463_001521 3300042016 Bacteria 6118
302 Ga0439463_001556 3300042016 Bacteria 6052
303 Ga0439446_0004782 3300042156 Bacteria 3449
304 Ga0450908_004283 3300042184 Bacteria 2754
305 Ga0439434_0002224 3300042435 Unclassified 5633
306 Ga0439434_0002793 3300042435 Bacteria 5092
307 Ga0439460_0000078 3300042461 Bacteria 14962
308 Ga0439460_0008295 3300042461 Archaea 2621
309 Ga0439440_0015097 3300042993 Archaea 1676
310 Ga0453684_0039043 3300044712 Archaea 6475
311 Ga0495617_000074 3300046452 Bacteria 80489
312 Ga0495617_001220 3300046452 Bacteria 11586
313 Ga0495592_0000794 3300046454 Bacteria 21829
314 Ga0495590_0000473 3300046457 Bacteria 19886
315 Ga0495590_0000791 3300046457 Bacteria 14397
316 Ga0495590_0000869 3300046457 Bacteria 13599
317 Ga0495653_0001585 3300046463 Bacteria 17858
318 Ga0495650_0002105 3300046471 Bacteria 17070
319 Ga0495580_0051566 3300046472 Bacteria 2909
320 Ga0495605_0000274 3300046474 Bacteria 58499
321 Ga0495605_0006565 3300046474 Bacteria 6672
322 Ga0495605_0009022 3300046474 Bacteria 5614
323 Ga0495639_0000033 3300046475 Bacteria 64043
324 Ga0495584_0000725 3300046491 Bacteria 21757
325 Ga0495584_0001358 3300046491 Bacteria 14799
326 Ga0495584_0003393 3300046491 Bacteria 8787
327 Ga0495584_0026588 3300046491 Archaea 2932
328 Ga0495584_0052780 3300046491 Bacteria 2046
329 Ga0495585_0045237 3300046492 Bacteria 2458
330 Ga0495594_0005700 3300046499 Bacteria 6404
331 Ga0495607_0000092 3300046501 Bacteria 93857
332 Ga0495583_0047671 3300046506 Bacteria 1969
333 Ga0495606_0001910 3300046507 Bacteria 25955
334 Ga0495606_0005590 3300046507 Bacteria 11961
335 Ga0495616_0003050 3300046513 Bacteria 10851
336 Ga0495631_0024766 3300046518 Bacteria 2769
337 Ga0495632_0001909 3300046519 Bacteria 16668
338 Ga0495637_0000856 3300046520 Bacteria 19897
339 Ga0495637_0002196 3300046520 Bacteria 10911
340 Ga0495637_0005231 3300046520 Bacteria 6643
341 Ga0495643_0000176 3300046522 Bacteria 102034
342 Ga0495643_0006313 3300046522 Bacteria 7834
343 Ga0495648_0015300 3300046524 Bacteria 5578
344 Ga0495666_0000396 3300046526 Bacteria 19135
345 Ga0495642_0000709 3300046528 Bacteria 16586
346 Ga0495654_0000141 3300046530 Bacteria 74618
347 Ga0495654_0005551 3300046530 Bacteria 7308
348 Ga0495609_0001339 3300046538 Bacteria 16675
349 Ga0495597_0001156 3300046542 Bacteria 19877
350 Ga0495597_0004755 3300046542 Bacteria 7346
351 Ga0495634_0013998 3300046642 Bacteria 5792
352 Ga0495611_0001017 3300046648 Bacteria 14884
353 Ga0495625_0013115 3300046660 Bacteria 6677
354 Ga0495625_0013710 3300046660 Bacteria 6498
355 Ga0495659_0000095 3300046664 Bacteria 38788
356 Ga0495613_0000593 3300046689 Bacteria 29247
357 Ga0495613_0000757 3300046689 Bacteria 25300
358 Ga0495613_0098084 3300046689 Bacteria 2118
359 Ga0495624_0000015 3300046690 Bacteria 108617
360 Ga0495671_0001593 3300046692 Bacteria 14984
361 Ga0495649_0000602 3300046694 Bacteria 29989
362 Ga0495649_0002015 3300046694 Bacteria 14719
363 Ga0495649_0011213 3300046694 Bacteria 5268
364 Ga0495589_0000075 3300046794 Bacteria 92974
365 Ga0495589_0024707 3300046794 Bacteria 3052
366 Ga0495581_0002391 3300047315 Bacteria 10604
367 Ga0495636_0001142 3300047318 Bacteria 10005
368 Ga0495672_0000433 3300047320 Bacteria 50107
369 Ga0495672_0000857 3300047320 Bacteria 32181
370 Ga0495672_0004336 3300047320 Bacteria 11679
371 Ga0495672_0007751 3300047320 Bacteria 8034
372 Ga0495676_0000316 3300047321 Bacteria 39327
373 Ga0495680_0001264 3300047322 Bacteria 27596
374 Ga0495683_0002418 3300047323 Bacteria 11290
375 Ga0495683_0002836 3300047323 Bacteria 10259
376 Ga0495687_002245 3300047443 Bacteria 15920
377 Ga0495687_005783 3300047443 Bacteria 7758
378 Ga0495673_0001237 3300047469 Bacteria 21147
379 Ga0495673_0007697 3300047469 Bacteria 6154
380 Ga0495681_0025385 3300047470 Bacteria 3100
381 Ga0495684_0002651 3300047471 Bacteria 14202
382 Ga0495593_0003650 3300047673 Bacteria 9191
383 Ga0495593_0018725 3300047673 Bacteria 3888
384 Ga0495602_0000219 3300048088 Bacteria 53199
385 Ga0495626_0008318 3300048091 Bacteria 5702
386 Ga0495626_0023126 3300048091 Bacteria 3063
387 Ga0496103_0070603 3300048906 Archaea 2185
388 Ga0496104_0033384 3300048907 Bacteria 4793
389 Ga0496105_0008953 3300048908 Bacteria 7808
390 Ga0496105_0045305 3300048908 Bacteria 3629
391 Ga0496105_0163106 3300048908 Bacteria 1829
392 Ga0496106_0034887 3300048909 Archaea 3759
393 Ga0496106_0052565 3300048909 Bacteria 3074
394 Ga0496107_0011602 3300048910 Archaea 6142
395 Ga0496107_0066738 3300048910 Bacteria 2609
396 Ga0496114_0015776 3300048917 Bacteria 6079
397 Ga0496114_0037486 3300048917 Bacteria 4009
398 Ga0496116_0000488 3300048919 Bacteria 54504
399 Ga0496116_0003637 3300048919 Bacteria 15147
400 Ga0496117_0001488 3300048920 Bacteria 33593
401 Ga0496118_0027807 3300048921 Bacteria 4777
402 Ga0496118_0070304 3300048921 Bacteria 2528
403 Ga0496119_0053643 3300048922 Bacteria 2461
404 Ga0496120_0115768 3300048923 Bacteria 1393
405 Ga0496121_0000867 3300048924 Bacteria 54641
406 Ga0496121_0005185 3300048924 Bacteria 16889
407 Ga0496122_0002919 3300048925 Bacteria 23335
408 Ga0496122_0003756 3300048925 Bacteria 19569
409 Ga0496122_0005376 3300048925 Bacteria 15290
410 Ga0496123_0002983 3300048926 Bacteria 19648
411 Ga0496123_0017923 3300048926 Bacteria 5669
412 Ga0496124_0006824 3300048927 Bacteria 12321
413 Ga0496125_0003373 3300048928 Bacteria 19453
414 Ga0496125_0092616 3300048928 Bacteria 2259
415 Ga0495678_001254 3300049459 Bacteria 20663
416 Ga0495678_001682 3300049459 Bacteria 16765
417 Ga0501031_0014522 3300049568 Archaea 5121
418 Ga0501031_0025857 3300049568 Archaea 3830
419 Ga0501034_0043688 3300049571 Bacteria 4534
420 Ga0501036_0026230 3300049572 Archaea 4917
421 Ga0501036_0059634 3300049572 Archaea 3233
422 Ga0501037_0037113 3300049573 Bacteria 3592
423 Ga0501038_0051989 3300049574 Bacteria 3533
424 Ga0501039_0190471 3300049575 Archaea 1613
425 Ga0501039_0222629 3300049575 Bacteria 1483
426 Ga0501040_0004204 3300049576 Archaea 9372
427 Ga0501040_0008917 3300049576 Bacteria 6523
428 Ga0501041_0000144 3300049577 Archaea 31221
429 Ga0501041_0033641 3300049577 Unclassified 3102
430 Ga0501041_0148609 3300049577 Bacteria 1462
431 Ga0501042_0003626 3300049578 Archaea 9739
432 Ga0501043_0040263 3300049579 Bacteria 3673
433 Ga0501043_0134582 3300049579 Archaea 1936
434 Ga0501046_0024943 3300049580 Bacteria 4899
435 Ga0501046_0028452 3300049580 Archaea 4551
436 Ga0501046_0038158 3300049580 Unclassified 3858
437 Ga0501046_0101739 3300049580 Bacteria 2204
438 Ga0501048_0045954 3300049582 Unclassified 3117
439 Ga0501071_0000092 3300049587 Bacteria 33638
440 Ga0501071_0091561 3300049587 Unclassified 2234
441 Ga0501071_0154502 3300049587 Unclassified 1713
442 Ga0501071_0164326 3300049587 Bacteria 1660
443 Ga0501072_0000196 3300049588 Archaea 44167
444 Ga0501074_0087184 3300049590 Bacteria 2236
445 Ga0501075_0002130 3300049591 Archaea 13097
446 Ga0501075_0008192 3300049591 Bacteria 7279
447 Ga0501075_0023438 3300049591 Unclassified 4520
448 Ga0501076_0000085 3300049592 Archaea 49144
449 Ga0501076_0003474 3300049592 Archaea 11068
450 Ga0501076_0010468 3300049592 Bacteria 6884
451 Ga0501076_0012819 3300049592 Bacteria 6275
452 Ga0501076_0096779 3300049592 Unclassified 2378
453 Ga0501077_0012782 3300049593 Archaea 5261
454 Ga0501079_0020237 3300049741 Archaea 5087
455 Ga0501079_0047789 3300049741 Bacteria 3302
456 Ga0501079_0133767 3300049741 Archaea 1930
457 Ga0501080_0000479 3300049742 Bacteria 31129
458 Ga0501080_0004603 3300049742 Bacteria 12292
459 Ga0501080_0024205 3300049742 Archaea 5630
460 Ga0501080_0090532 3300049742 Archaea 2842
461 Ga0501081_0000373 3300049743 Archaea 24533
462 Ga0501081_0008124 3300049743 Archaea 6812
463 Ga0501081_0010976 3300049743 Archaea 5921
464 Ga0501035_0063308 3300049822 Unclassified 3290
465 Ga0501044_0000372 3300049823 Bacteria 56197
466 Ga0501045_0001929 3300049824 Archaea 14006
467 Ga0501045_0130667 3300049824 Unclassified 1867
468 nmdc:mga05p37_19441_c1 3300050507 Archaea 8217
469 nmdc:mga05p37_256460_c1 3300050507 Bacteria 2095
470 nmdc:mga05p37_294763_c1 3300050507 Archaea 1930
471 nmdc:mga05p37_305506_c1 3300050507 Bacteria 1888
472 nmdc:mga05p37_434138_c1 3300050507 Archaea 1525
473 nmdc:mga09592_15856_c1 3300050508 Archaea 6158
474 nmdc:mga0qj67_28075_c1 3300050509 Archaea 4366
475 nmdc:mga0qj67_3549_c1 3300050509 Bacteria 11257
476 nmdc:mga0qj67_67921_c1 3300050509 Archaea 2841
477 nmdc:mga06r32_108952_c1 3300050510 Archaea 2724
478 nmdc:mga08y16_157421_c1 3300050511 Archaea 2361
479 nmdc:mga08y16_2036_c1 3300050511 Bacteria 20716
480 nmdc:mga08y16_3860_c1 3300050511 Archaea 15586
481 nmdc:mga08y16_42894_c1 3300050511 Archaea 4739
482 nmdc:mga0n895_1764_c1 3300050512 Archaea 16385
483 nmdc:mga0n895_70218_c1 3300050512 Bacteria 3471
484 nmdc:mga0rr50_203880_c1 3300050513 Archaea 1627
485 nmdc:mga0rr50_4254_c1 3300050513 Archaea 8380
486 nmdc:mga08x19_10292_c1 3300050514 Archaea 5614
487 nmdc:mga0a205_36630_c1 3300050515 Bacteria 4715
488 nmdc:mga0a205_49098_c1 3300050515 Archaea 4073
489 nmdc:mga0a205_74338_c2 3300050515 Bacteria 2739
490 Ga0501084_0003723 3300054114 Archaea 12377
491 Ga0501084_0023176 3300054114 Archaea 5183
492 Ga0501082_0008646 3300060353 Archaea 8778
493 Ga0501082_0172550 3300060353 Archaea 1880
494 Ga0501082_0313570 3300060353 Archaea 1366
495 Ga0530510_0165548 3300061734 Bacteria 1636
496 2511257690 2511231004 Bacteria 6669789
497 2511272972 2511231007 Bacteria 6306603
498 2511325795 2511231016 Bacteria 6704427
499 2555672441 2554235341 Bacteria 6867980
500 2599358106 2599185160 Bacteria 6844013
501 2599364469 2599185161 Bacteria 6960462
502 2599370995 2599185162 Bacteria 6957254
503 2599377017 2599185163 Bacteria 6995158
504 2599383271 2599185164 Bacteria 6841688
505 2599389718 2599185165 Bacteria 6843250
506 2599396015 2599185166 Bacteria 6959206
507 2599407855 2599185168 Bacteria 6997636
508 2599464921 2599185181 Bacteria 6844519
509 2599471246 2599185182 Bacteria 6883168
510 2599486636 2599185185 Bacteria 6652270
511 2599494164 2599185186 Bacteria 6831633
512 2599615404 2599185212 Bacteria 6765997
513 2599768879 2599185248 Bacteria 6696816
514 2599884661 2599185289 Bacteria 6778765
515 2599896160 2599185291 Bacteria 6775623
516 2599941266 2599185302 Bacteria 5954930
517 2599953214 2599185304 Bacteria 5951361
518 2599958046 2599185305 Bacteria 6748700
519 2599968847 2599185306 Bacteria 6637356
520 2599980047 2599185308 Bacteria 6621546
521 2599982534 2599185309 Bacteria 5969593
522 2599989868 2599185310 Bacteria 6014457
523 2599998761 2599185312 Bacteria 5912071
524 2600003868 2599185313 Bacteria 6658188
525 2600013911 2599185314 Bacteria 6621749
526 2600015769 2599185315 Bacteria 6771107
527 2600034068 2599185318 Bacteria 6961590
528 2600040408 2599185319 Bacteria 6637840
529 2600047441 2599185320 Bacteria 5963263
530 2600050976 2599185321 Bacteria 6764560
531 2600056861 2599185322 Bacteria 6763055
532 2600063414 2599185323 Bacteria 6688755
533 2600069052 2599185324 Bacteria 6590677
534 2600217653 2599185356 Bacteria 6843884
535 2600367895 2600254931 Bacteria 6734225
536 2601777820 2600255313 Bacteria 6842543
537 2624491991 2623620446 Bacteria 6500345
538 2644281161 2643221650 Bacteria 7029547
539 2644611734 2643221711 Bacteria 4865335
540 2671088854 2667528170 Bacteria 6786960
541 2671100643 2667528171 Bacteria 6900659
542 2677899262 2675903420 Bacteria 6247433
543 2678263805 2675903515 Bacteria 6580491
544 2745004258 2744054620 Bacteria 6551379
545 2807408404 2806310737 Bacteria 5751088
546 2807456718 2806310745 Bacteria 5742165
547 2808858745 2808606361 Bacteria 6136259
548 2808927159 2808606376 Bacteria 6248667
549 2808938880 2808606378 Bacteria 6177535
550 2808949278 2808606380 Bacteria 6248705
551 2808967247 2808606383 Bacteria 6138645
552 2809002059 2808606389 Bacteria 6138126
553 2812366683 2811994881 Bacteria 6298475
554 2819428252 2818991318 Bacteria 5266538
555 2819664617 2818991458 Bacteria 4794049
556 2819706310 2818991464 Bacteria 6907494
557 2825652185 2825651385 Bacteria 6715909
558 2837275579 2837268691 Bacteria 7850704
559 2844666613 2844665904 Bacteria 6817974
560 2908449174 2908446538 Bacteria 6829095
561 2917076324 2917070673 Bacteria 6868303
562 2919698166 2919697872 Bacteria 6553725
563 2923520715 2923519811 Bacteria 6298479
564 2923588229 2923586266 Bacteria 6565975
565 2931374970 2931369376 Bacteria 6847892
566 2935359748 2935353572 Unclassified 6955622
567 2946009226 2946006987 Bacteria 6705746
568 2952254359 2952252522 Bacteria 4171745
569 2984287001 2984286254 Bacteria 6702062
570 2988728592 2988728565 Bacteria 6124362
571 3007423220 3007419365 Bacteria 7026924
572 3007719901 3007718800 Bacteria 5971527
573 637322880 637000220 Bacteria 7074893
574 8019771198 8019769354 Bacteria 6924660
575 8019779947 8019775933 Bacteria 6858656
576 8056123423 8056120720 Bacteria 5758328
577 8056174326 8056172158 Bacteria 6133900
578 8057803901 8057798959 Bacteria 6713499
579 Ga0400483_135325
580 SwRhRL3b_contig_3029720
581 ARcpr5oldR_c000086
582 ARSoilYngRDRAFT_c00198
583 ARcpr5yngRDRAFT_c000323
584 ARCol0oldRDRAFT_c00380
585 ARCol0yngRDRAFT_1000094
586 JGI25162J39368_1000327
587 JGI25163J39215_1000190
588 JGI25164J39214_1000241
589 JGI25165J46597_1000442
590 JGI26129J50193_1000351
591 JGI26144J50225_100436
592 JGI26139J50223_100202
593 JGI26130J50248_100096
594 JGI26143J51219_1000185
595 Ga0055536_1000343
596 Ga0055530_10000122
597 Ga0055530_10000488
598 Ga0055540_1000155
599 Ga0055540_1001256
600 JGI25405J52794_10007101
601 Ga0065717_1002164
602 Ga0065704_10004821
603 Ga0065704_10016340
604 Ga0065704_10070517
605 Ga0065704_10073533
606 Ga0065712_10000495
607 Ga0065712_10100000
608 Ga0065715_10000193
609 Ga0065715_10000629
610 Ga0065715_10000853
611 Ga0065707_10000202
612 Ga0065707_10000468
613 Ga0070658_10000812
614 Ga0070658_10005020
615 Ga0070676_10007854
616 Ga0070676_10007867
617 Ga0070670_100092650
618 Ga0068869_100005727
619 Ga0070680_100009455
620 Ga0070691_10050674
621 Ga0070661_100000170
622 Ga0070692_10016905
623 Ga0070692_10018745
624 Ga0070669_100042938
625 Ga0070669_100197443
626 Ga0070673_100085361
627 Ga0070659_100083859
628 Ga0070701_10008163
629 Ga0070701_10090970
630 Ga0070705_100006381
631 Ga0070705_100028989
632 Ga0070700_100012353
633 Ga0070694_100017061
634 Ga0070694_100072006
635 Ga0070694_100147679
636 Ga0070708_100292383
637 Ga0070662_100027988
638 Ga0070662_100117727
639 Ga0070681_10024049
640 Ga0070681_10095946
641 Ga0068867_100002599
642 Ga0068867_100004549
643 Ga0068867_100158747
644 Ga0070698_100220833
645 Ga0070697_100120544
646 Ga0068853_100010847
647 Ga0070672_100021068
648 Ga0070672_100028182
649 Ga0070672_100048589
650 Ga0070672_100097429
651 Ga0070686_100065330
652 Ga0070695_100003214
653 Ga0070695_100031272
654 Ga0070696_100014109
655 Ga0070696_100015588
656 Ga0070693_100014323
657 Ga0068855_100004104
658 Ga0068855_100130371
659 Ga0070664_100011900
660 Ga0070702_100000923
661 Ga0068864_100014528
662 Ga0068864_100095411
663 Ga0068870_10000381
664 Ga0068870_10002319
665 Ga0068858_100010081
666 Ga0068858_100132133
667 Ga0068860_100000347
668 Ga0068860_100031595
669 Ga0068860_100099752
670 Ga0068860_100176512
671 Ga0081455_10000282
672 Ga0081455_10001563
673 Ga0081538_10030463
674 Ga0081538_10038273
675 Ga0081540_1000758
676 Ga0081540_1004147
677 Ga0081540_1053354
678 Ga0075432_10027939
679 Ga0075432_10048561
680 Ga0097621_100025594
681 Ga0075428_100017329
682 Ga0075428_100019636
683 Ga0075431_100002097
684 Ga0075433_10004035
685 Ga0075433_10007828
686 Ga0075434_100051483
687 Ga0075434_100104546
688 Ga0075434_100213144
689 Ga0075429_100014469
690 Ga0068865_100037370
691 Ga0075436_100008865
692 Ga0075436_100063043
693 Ga0075435_100016225
694 Ga0075435_100030048
695 Ga0075435_100049888
696 Ga0105244_10000733
697 Ga0105244_10002094
698 Ga0105244_10002454
699 Ga0105244_10052375
700 Ga0105240_10000069
701 Ga0111539_10000972
702 Ga0111539_10027726
703 Ga0111539_10047260
704 Ga0111539_10064965
705 Ga0114129_10107860
706 Ga0114129_10411606
707 Ga0105243_10000020
708 Ga0105243_10000449
709 Ga0105242_10000845
710 Ga0105237_10000517
711 Ga0105237_10026180
712 Ga0105237_10077308
713 Ga0105238_10004458
714 Ga0105249_10037587
715 Ga0105239_10159519
716 Ga0105246_10000181
717 Ga0105246_10029511
718 Ga0157336_1000008
719 Ga0157346_1000099
720 Ga0157337_1000013
721 Ga0157325_1000032
722 Ga0157341_1000028
723 Ga0157323_1000079
724 Ga0157345_1000610
725 Ga0157314_1000938
726 Ga0157313_1000274
727 Ga0157342_1000009
728 Ga0157315_1000054
729 Ga0157316_1000009
730 Ga0157327_1000105
731 Ga0157338_1000019
732 Ga0157373_10005925
733 Ga0157371_10000814
734 Ga0157370_10084645
735 Ga0157374_10078062
736 Ga0157378_10124885
737 Ga0163162_10052859
738 Ga0157375_10000142
739 Ga0157375_10007077
740 Ga0157375_10007718
741 Ga0157375_10011776
742 Ga0157380_10019104
743 Ga0182008_10001501
744 Ga0157377_10000870
745 Ga0182006_1000073
746 Ga0182006_1001754
747 Ga0182007_10000031
748 Ga0182007_10000768
749 Ga0182005_1000755
750 Ga0163161_10004740
751 Ga0209760_100153
752 Ga0207427_100056
753 Ga0209437_100065
754 Ga0209759_1003588
755 Ga0209233_1000085
756 Ga0207673_1002889
757 Ga0209676_1000337
758 Ga0209050_1000013
759 Ga0209050_1000093
760 Ga0209050_1000106
761 Ga0209051_1000007
762 Ga0209051_1000260
763 Ga0207697_10000644
764 Ga0207655_1000098
765 Ga0207655_1000125
766 Ga0207655_1000901
767 Ga0207655_1002375
768 Ga0207688_10002216
769 Ga0207647_10002079
770 Ga0207647_10013425
771 Ga0207645_10009037
772 Ga0207645_10020989
773 Ga0207645_10021790
774 Ga0207645_10022401
775 Ga0207643_10000173
776 Ga0207643_10000239
777 Ga0207705_10001468
778 Ga0207705_10004141
779 Ga0207707_10029485
780 Ga0207707_10116047
781 Ga0207695_10000186
782 Ga0207671_10000370
783 Ga0207662_10001156
784 Ga0207649_10000139
785 Ga0207649_10065894
786 Ga0207681_10005461
787 Ga0207694_10007816
788 Ga0207650_10013650
789 Ga0207690_10020936
790 Ga0207690_10075869
791 Ga0207706_10012849
792 Ga0207706_10020925
793 Ga0207709_10000004
794 Ga0207709_10000343
795 Ga0207669_10087722
796 Ga0207691_10006714
797 Ga0207691_10020950
798 Ga0207691_10071509
799 Ga0207691_10098326
800 Ga0207689_10008131
801 Ga0207679_10000034
802 Ga0207667_10011801
803 Ga0207667_10149108
804 Ga0207651_10135500
805 Ga0207712_10006493
806 Ga0207712_10042147
807 Ga0207658_10004207
808 Ga0207677_10013504
809 Ga0207703_10007541
810 Ga0207639_10007605
811 Ga0207708_10005026
812 Ga0207708_10020967
813 Ga0207708_10160298
814 Ga0207648_10001528
815 Ga0207648_10002828
816 Ga0207674_10002574
817 Ga0209973_1000226
818 Ga0209967_1000206
819 Ga0209996_1000299
820 Ga0209984_1000039
821 Ga0210000_1000207
822 Ga0209995_1000608
823 Ga0209995_1000899
824 Ga0209968_1001190
825 Ga0209999_1000069
826 Ga0209982_1000188
827 Ga0209982_1005916
828 Ga0209970_1000421
829 Ga0210002_1006682
830 Ga0209983_1000394
831 Ga0209971_1001941
832 Ga0209966_1000217
833 Ga0209974_10000115
834 Ga0207428_10000499
835 Ga0207428_10001140
836 Ga0207428_10009154
837 Ga0207428_10024457
838 Ga0207428_10041856
839 Ga0207428_10065920
840 Ga0268266_10114628
841 Ga0268265_10069328
842 Ga0268264_10001780
843 Ga0268264_10058705
844 Ga0265338_10001579
845 Ga0265325_10000131
846 Ga0265339_10006781
847 Ga0265331_10000604
848 Ga0265327_10002617
849 Ga0307408_100002288
850 Ga0265313_10000774
851 Ga0265314_10000459
852 Ga0307409_100101195
853 Ga0307411_10010608
854 Ga0373959_0002595
855 Ga0373939_0003722
856 Ga0373960_0005105
857 Ga0373961_0003576
858 Ga0373961_0006971
859 Ga0373962_0007027
860 Ga0373931_0002085
861 Ga0373931_0003146
862 Ga0373931_0006835
863 Ga0316584_0048744
864 Ga0400483_043071
865 Ga0400483_159196
866 Ga0400483_176188
867 Ga0400483_233375
868 Ga0400483_252938
869 Ga0439453_0000246
870 Ga0439453_0000919
871 Ga0439461_0006098
872 Ga0439437_001011
873 Ga0439441_004587
874 Ga0439432_000086
875 Ga0439451_000095
876 Ga0439451_001065
877 Ga0439452_012362
878 Ga0439456_003876
879 Ga0439463_001521
880 Ga0439463_001556
881 Ga0439446_0004782
882 Ga0450908_004283
883 Ga0439434_0002224
884 Ga0439434_0002793
885 Ga0439460_0000078
886 Ga0439460_0008295
887 Ga0439440_0015097
888 Ga0453684_0039043
889 Ga0495617_000074
890 Ga0495617_001220
891 Ga0495592_0000794
892 Ga0495590_0000473
893 Ga0495590_0000791
894 Ga0495590_0000869
895 Ga0495653_0001585
896 Ga0495650_0002105
897 Ga0495580_0051566
898 Ga0495605_0000274
899 Ga0495605_0006565
900 Ga0495605_0009022
901 Ga0495639_0000033
902 Ga0495584_0000725
903 Ga0495584_0001358
904 Ga0495584_0003393
905 Ga0495584_0026588
906 Ga0495584_0052780
907 Ga0495585_0045237
908 Ga0495594_0005700
909 Ga0495607_0000092
910 Ga0495583_0047671
911 Ga0495606_0001910
912 Ga0495606_0005590
913 Ga0495616_0003050
914 Ga0495631_0024766
915 Ga0495632_0001909
916 Ga0495637_0000856
917 Ga0495637_0002196
918 Ga0495637_0005231
919 Ga0495643_0000176
920 Ga0495643_0006313
921 Ga0495648_0015300
922 Ga0495666_0000396
923 Ga0495642_0000709
924 Ga0495654_0000141
925 Ga0495654_0005551
926 Ga0495609_0001339
927 Ga0495597_0001156
928 Ga0495597_0004755
929 Ga0495634_0013998
930 Ga0495611_0001017
931 Ga0495625_0013115
932 Ga0495625_0013710
933 Ga0495659_0000095
934 Ga0495613_0000593
935 Ga0495613_0000757
936 Ga0495613_0098084
937 Ga0495624_0000015
938 Ga0495671_0001593
939 Ga0495649_0000602
940 Ga0495649_0002015
941 Ga0495649_0011213
942 Ga0495589_0000075
943 Ga0495589_0024707
944 Ga0495581_0002391
945 Ga0495636_0001142
946 Ga0495672_0000433
947 Ga0495672_0000857
948 Ga0495672_0004336
949 Ga0495672_0007751
950 Ga0495676_0000316
951 Ga0495680_0001264
952 Ga0495683_0002418
953 Ga0495683_0002836
954 Ga0495687_002245
955 Ga0495687_005783
956 Ga0495673_0001237
957 Ga0495673_0007697
958 Ga0495681_0025385
959 Ga0495684_0002651
960 Ga0495593_0003650
961 Ga0495593_0018725
962 Ga0495602_0000219
963 Ga0495626_0008318
964 Ga0495626_0023126
965 Ga0496103_0070603
966 Ga0496104_0033384
967 Ga0496105_0008953
968 Ga0496105_0045305
969 Ga0496105_0163106
970 Ga0496106_0034887
971 Ga0496106_0052565
972 Ga0496107_0011602
973 Ga0496107_0066738
974 Ga0496114_0015776
975 Ga0496114_0037486
976 Ga0496116_0000488
977 Ga0496116_0003637
978 Ga0496117_0001488
979 Ga0496118_0027807
980 Ga0496118_0070304
981 Ga0496119_0053643
982 Ga0496120_0115768
983 Ga0496121_0000867
984 Ga0496121_0005185
985 Ga0496122_0002919
986 Ga0496122_0003756
987 Ga0496122_0005376
988 Ga0496123_0002983
989 Ga0496123_0017923
990 Ga0496124_0006824
991 Ga0496125_0003373
992 Ga0496125_0092616
993 Ga0495678_001254
994 Ga0495678_001682
995 Ga0501031_0014522
996 Ga0501031_0025857
997 Ga0501034_0043688
998 Ga0501036_0026230
999 Ga0501036_0059634
1000 Ga0501037_0037113
1001 Ga0501038_0051989
1002 Ga0501039_0190471
1003 Ga0501039_0222629
1004 Ga0501040_0004204
1005 Ga0501040_0008917
1006 Ga0501041_0000144
1007 Ga0501041_0033641
1008 Ga0501041_0148609
1009 Ga0501042_0003626
1010 Ga0501043_0040263
1011 Ga0501043_0134582
1012 Ga0501046_0024943
1013 Ga0501046_0028452
1014 Ga0501046_0038158
1015 Ga0501046_0101739
1016 Ga0501048_0045954
1017 Ga0501071_0000092
1018 Ga0501071_0091561
1019 Ga0501071_0154502
1020 Ga0501071_0164326
1021 Ga0501072_0000196
1022 Ga0501074_0087184
1023 Ga0501075_0002130
1024 Ga0501075_0008192
1025 Ga0501075_0023438
1026 Ga0501076_0000085
1027 Ga0501076_0003474
1028 Ga0501076_0010468
1029 Ga0501076_0012819
1030 Ga0501076_0096779
1031 Ga0501077_0012782
1032 Ga0501079_0020237
1033 Ga0501079_0047789
1034 Ga0501079_0133767
1035 Ga0501080_0000479
1036 Ga0501080_0004603
1037 Ga0501080_0024205
1038 Ga0501080_0090532
1039 Ga0501081_0000373
1040 Ga0501081_0008124
1041 Ga0501081_0010976
1042 Ga0501035_0063308
1043 Ga0501044_0000372
1044 Ga0501045_0001929
1045 Ga0501045_0130667
1046 nmdc:mga05p37_19441_c1
1047 nmdc:mga05p37_256460_c1
1048 nmdc:mga05p37_294763_c1
1049 nmdc:mga05p37_305506_c1
1050 nmdc:mga05p37_434138_c1
1051 nmdc:mga09592_15856_c1
1052 nmdc:mga0qj67_28075_c1
1053 nmdc:mga0qj67_3549_c1
1054 nmdc:mga0qj67_67921_c1
1055 nmdc:mga06r32_108952_c1
1056 nmdc:mga08y16_157421_c1
1057 nmdc:mga08y16_2036_c1
1058 nmdc:mga08y16_3860_c1
1059 nmdc:mga08y16_42894_c1
1060 nmdc:mga0n895_1764_c1
1061 nmdc:mga0n895_70218_c1
1062 nmdc:mga0rr50_203880_c1
1063 nmdc:mga0rr50_4254_c1
1064 nmdc:mga08x19_10292_c1
1065 nmdc:mga0a205_36630_c1
1066 nmdc:mga0a205_49098_c1
1067 nmdc:mga0a205_74338_c2
1068 Ga0501084_0003723
1069 Ga0501084_0023176
1070 Ga0501082_0008646
1071 Ga0501082_0172550
1072 Ga0501082_0313570
1073 Ga0530510_0165548
1074 2511257690
1075 2511272972
1076 2511325795
1077 2555672441
1078 2599358106
1079 2599364469
1080 2599370995
1081 2599377017
1082 2599383271
1083 2599389718
1084 2599396015
1085 2599407855
1086 2599464921
1087 2599471246
1088 2599486636
1089 2599494164
1090 2599615404
1091 2599768879
1092 2599884661
1093 2599896160
1094 2599941266
1095 2599953214
1096 2599958046
1097 2599968847
1098 2599980047
1099 2599982534
1100 2599989868
1101 2599998761
1102 2600003868
1103 2600013911
1104 2600015769
1105 2600034068
1106 2600040408
1107 2600047441
1108 2600050976
1109 2600056861
1110 2600063414
1111 2600069052
1112 2600217653
1113 2600367895
1114 2601777820
1115 2624491991
1116 2644281161
1117 2644611734
1118 2671088854
1119 2671100643
1120 2677899262
1121 2678263805
1122 2745004258
1123 2807408404
1124 2807456718
1125 2808858745
1126 2808927159
1127 2808938880
1128 2808949278
1129 2808967247
1130 2809002059
1131 2812366683
1132 2819428252
1133 2819664617
1134 2819706310
1135 2825652185
1136 2837275579
1137 2844666613
1138 2908449174
1139 2917076324
1140 2919698166
1141 2923520715
1142 2923588229
1143 2931374970
1144 2935359748
1145 2946009226
1146 2952254359
1147 2984287001
1148 2988728592
1149 3007423220
1150 3007719901
1151 637322880
1152 8019771198
1153 8019779947
1154 8056123423
1155 8056174326
1156 8057803901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01663

Phosphodiest

Type I phosphodiesterase / nucleotide pyrophosphatase

31

400

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lr2-assembly1.cif.gz_A crystal structure of human enpp4 (apo) 0.7833 1 439
5vem-assembly3.cif.gz_C human ectonucleotide pyrophosphatase / phosphodiesterase 5 (enpp5, npp5) 0.7798 4 439
7kng-assembly1.cif.gz_A 2.10a resolution structure of independent phosphoglycerate mutase from c. elegans in complex with a macrocyclic peptide inhibitor (ce-2 y7f) 0.7795 169 246
5dlw-assembly1.cif.gz_A crystal structure of autotaxin (enpp2) with tauroursodeoxycholic acid (tudca) and lysophosphatidic acid (lpa) 0.779 4 430
5m0e-assembly1.cif.gz_A structure-based evolution of a hybrid steroid series of autotaxin inhibitors 0.7769 4 430
ID Description Score Start End Superfamily
2gsnB01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.8014 4 246 3.40.720.10
4lqyA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7793 1 246 3.40.720.10
af_A1Z705_126_335_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7769 95 246 3.40.720.10
5eghA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7685 4 246 3.40.720.10
4b56B01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7653 1 246 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A842Q030-F1-model_v4 deleted 0.9814 38 370
AF-A0A533U809-F1-model_v4 Alkaline phosphatase family protein 0.9801 1 328
AF-A0A842Q2Z5-F1-model_v4 Alkaline phosphatase family protein 0.9754 1 439
AF-A0A800AH52-F1-model_v4 Alkaline phosphatase family protein 0.9747 3 357
AF-A0A533V5Y8-F1-model_v4 Alkaline phosphatase family protein 0.9743 1 191

Map