F465504
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 576 | 313 | 574 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10562471|Ga0105238_105624711 |
| Length | 141 |
| Sequence | LPRVEAESVKVACKAIMFLRICAAGVVSILALNQSAHAQASLQMRAAMHLSDPRSEFVRQCAPHMLGRWAHPEEVCGCLHDHAAAVVDDTDLRLALLRGISETGVPTIENGWVPASKQSEIGPTFTKIAKPTLQCMFEPAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 69 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 73 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 110 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 111 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 115 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 123 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 124 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 125 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 126 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 127 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 128 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 135 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 145 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 146 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 147 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 154 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 155 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 159 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 160 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 161 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 162 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 163 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 201 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 202 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 206 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 207 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 208 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 209 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 210 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 211 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 212 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 213 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 241 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 242 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 243 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 244 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 245 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 246 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 247 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 248 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 249 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 250 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 251 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 252 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 253 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 254 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 255 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 256 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 258 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 259 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 260 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 262 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 263 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 264 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 265 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 266 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 267 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
| 268 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 269 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 67.53 |
| Metatranscriptomes | 32.12 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.77 |
| Nodule | 0.87 |
| Rhizoplane | 3.99 |
| Rhizosphere | 80.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000104 | 3300003203 | Bacteria | 37774 |
| 2 | rootH2_10106806 | 3300003320 | Bacteria | 3198 |
| 3 | rootH1_10201677 | 3300003323 | Bacteria | 2090 |
| 4 | Ga0058861_10037956 | 3300004800 | Bacteria | 801 |
| 5 | Ga0070658_10055755 | 3300005327 | Bacteria | 3211 |
| 6 | Ga0070658_11262258 | 3300005327 | Bacteria | 642 |
| 7 | Ga0070683_100024847 | 3300005329 | Bacteria | 5372 |
| 8 | Ga0070683_100201833 | 3300005329 | Bacteria | 1888 |
| 9 | Ga0070683_100703220 | 3300005329 | Bacteria | 968 |
| 10 | Ga0068869_101134631 | 3300005334 | Bacteria | 685 |
| 11 | Ga0070680_100012602 | 3300005336 | Bacteria | 6573 |
| 12 | Ga0070682_100076497 | 3300005337 | Bacteria | 2155 |
| 13 | Ga0070682_100142354 | 3300005337 | Bacteria | 1636 |
| 14 | Ga0070682_101101482 | 3300005337 | Bacteria | 665 |
| 15 | Ga0068868_100028867 | 3300005338 | Bacteria | 4246 |
| 16 | Ga0068868_100655689 | 3300005338 | Bacteria | 935 |
| 17 | Ga0070691_10123850 | 3300005341 | Bacteria | 1304 |
| 18 | Ga0070661_100415203 | 3300005344 | Bacteria | 1066 |
| 19 | Ga0070671_100429000 | 3300005355 | Bacteria | 1133 |
| 20 | Ga0070673_101845832 | 3300005364 | Bacteria | 573 |
| 21 | Ga0070709_10004487 | 3300005434 | Bacteria | 7531 |
| 22 | Ga0070709_10013858 | 3300005434 | Bacteria | 4545 |
| 23 | Ga0070709_10159977 | 3300005434 | Bacteria | 1565 |
| 24 | Ga0070714_100061575 | 3300005435 | Bacteria | 3224 |
| 25 | Ga0070714_100223687 | 3300005435 | Bacteria | 1731 |
| 26 | Ga0070713_100039476 | 3300005436 | Bacteria | 3832 |
| 27 | Ga0070713_100066052 | 3300005436 | Bacteria | 3041 |
| 28 | Ga0070713_100091479 | 3300005436 | Bacteria | 2617 |
| 29 | Ga0070710_10036825 | 3300005437 | Bacteria | 2677 |
| 30 | Ga0070710_10077714 | 3300005437 | Bacteria | 1930 |
| 31 | Ga0070710_10699552 | 3300005437 | Bacteria | 715 |
| 32 | Ga0070711_100094825 | 3300005439 | Bacteria | 2158 |
| 33 | Ga0070711_100348100 | 3300005439 | Bacteria | 1191 |
| 34 | Ga0070663_100009083 | 3300005455 | Bacteria | 6142 |
| 35 | Ga0070663_100391067 | 3300005455 | Bacteria | 1135 |
| 36 | Ga0070681_10010590 | 3300005458 | Bacteria | 9110 |
| 37 | Ga0070681_10011972 | 3300005458 | Bacteria | 8602 |
| 38 | Ga0070681_10080599 | 3300005458 | Bacteria | 3211 |
| 39 | Ga0070706_100013118 | 3300005467 | Bacteria | 7665 |
| 40 | Ga0070706_100993100 | 3300005467 | Bacteria | 774 |
| 41 | Ga0070698_100723160 | 3300005471 | Bacteria | 938 |
| 42 | Ga0070679_100044917 | 3300005530 | Bacteria | 4402 |
| 43 | Ga0070679_100276174 | 3300005530 | Bacteria | 1633 |
| 44 | Ga0070684_100009632 | 3300005535 | Bacteria | 7616 |
| 45 | Ga0070684_100015331 | 3300005535 | Bacteria | 6238 |
| 46 | Ga0070697_100112753 | 3300005536 | Bacteria | 2268 |
| 47 | Ga0068853_100124531 | 3300005539 | Bacteria | 2302 |
| 48 | Ga0068853_100244002 | 3300005539 | Bacteria | 1647 |
| 49 | Ga0068853_100424239 | 3300005539 | Bacteria | 1247 |
| 50 | Ga0070665_100092705 | 3300005548 | Bacteria | 3025 |
| 51 | Ga0070665_100433818 | 3300005548 | Bacteria | 1323 |
| 52 | Ga0068855_100112704 | 3300005563 | Bacteria | 3121 |
| 53 | Ga0068855_100580630 | 3300005563 | Bacteria | 1211 |
| 54 | Ga0068855_101007445 | 3300005563 | Bacteria | 875 |
| 55 | Ga0068857_100217057 | 3300005577 | Bacteria | 1746 |
| 56 | Ga0068857_100267634 | 3300005577 | Bacteria | 1570 |
| 57 | Ga0068856_100645486 | 3300005614 | Bacteria | 1079 |
| 58 | Ga0068864_100189462 | 3300005618 | Bacteria | 1885 |
| 59 | Ga0068864_100690266 | 3300005618 | Bacteria | 997 |
| 60 | Ga0068864_101459534 | 3300005618 | Bacteria | 687 |
| 61 | Ga0068851_10045953 | 3300005834 | Bacteria | 2208 |
| 62 | Ga0068863_100153114 | 3300005841 | Bacteria | 2207 |
| 63 | Ga0068863_101009584 | 3300005841 | Bacteria | 835 |
| 64 | Ga0068858_100221497 | 3300005842 | Bacteria | 1792 |
| 65 | Ga0068860_100000058 | 3300005843 | Bacteria | 197181 |
| 66 | Ga0081455_10170677 | 3300005937 | Bacteria | 1657 |
| 67 | Ga0081540_1277834 | 3300005983 | Bacteria | 578 |
| 68 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 69 | Ga0070717_10002555 | 3300006028 | Bacteria | 12833 |
| 70 | Ga0070717_10110607 | 3300006028 | Bacteria | 2343 |
| 71 | Ga0070717_10348221 | 3300006028 | Bacteria | 1324 |
| 72 | Ga0070717_10536467 | 3300006028 | Bacteria | 1059 |
| 73 | Ga0070717_10782681 | 3300006028 | Bacteria | 868 |
| 74 | Ga0070716_100007220 | 3300006173 | Bacteria | 5464 |
| 75 | Ga0070716_100557839 | 3300006173 | Bacteria | 855 |
| 76 | Ga0070712_100032824 | 3300006175 | Bacteria | 3508 |
| 77 | Ga0070712_100186092 | 3300006175 | Bacteria | 1621 |
| 78 | Ga0068871_100337213 | 3300006358 | Bacteria | 1331 |
| 79 | Ga0068871_100379250 | 3300006358 | Bacteria | 1256 |
| 80 | Ga0099794_10435761 | 3300007265 | Bacteria | 686 |
| 81 | Ga0105240_10058646 | 3300009093 | Bacteria | 4806 |
| 82 | Ga0105240_10086231 | 3300009093 | Bacteria | 3845 |
| 83 | Ga0105240_10135022 | 3300009093 | Bacteria | 2955 |
| 84 | Ga0105240_10438394 | 3300009093 | Bacteria | 1464 |
| 85 | Ga0105245_10080528 | 3300009098 | Bacteria | 2975 |
| 86 | Ga0105247_10015905 | 3300009101 | Bacteria | 4505 |
| 87 | Ga0105247_10101798 | 3300009101 | Bacteria | 1837 |
| 88 | Ga0105247_10278113 | 3300009101 | Bacteria | 1154 |
| 89 | Ga0105241_10212893 | 3300009174 | Bacteria | 1620 |
| 90 | Ga0105242_10508321 | 3300009176 | Bacteria | 1147 |
| 91 | Ga0105237_10005643 | 3300009545 | Bacteria | 14090 |
| 92 | Ga0105237_10033600 | 3300009545 | Bacteria | 5197 |
| 93 | Ga0105237_10071273 | 3300009545 | Bacteria | 3470 |
| 94 | Ga0105237_10151993 | 3300009545 | Bacteria | 2311 |
| 95 | Ga0105238_10003526 | 3300009551 | Bacteria | 15592 |
| 96 | Ga0105238_10164278 | 3300009551 | Bacteria | 2196 |
| 97 | Ga0105238_10182046 | 3300009551 | Bacteria | 2078 |
| 98 | Ga0105238_10562471 | 3300009551 | Bacteria | 1145 |
| 99 | Ga0105238_10616998 | 3300009551 | Bacteria | 1093 |
| 100 | Ga0105238_10672549 | 3300009551 | Bacteria | 1046 |
| 101 | Ga0105238_11937755 | 3300009551 | Bacteria | 622 |
| 102 | Ga0105239_10018730 | 3300010375 | Bacteria | 7648 |
| 103 | Ga0105239_10257495 | 3300010375 | Bacteria | 1961 |
| 104 | Ga0105239_11277721 | 3300010375 | Bacteria | 846 |
| 105 | Ga0105239_11724320 | 3300010375 | Bacteria | 725 |
| 106 | Ga0105246_10016910 | 3300011119 | Bacteria | 4628 |
| 107 | Ga0105246_10341466 | 3300011119 | Bacteria | 1224 |
| 108 | Ga0157370_10216497 | 3300013104 | Bacteria | 1775 |
| 109 | Ga0157369_10003890 | 3300013105 | Bacteria | 17720 |
| 110 | Ga0157369_10008785 | 3300013105 | Bacteria | 11576 |
| 111 | Ga0157369_10161928 | 3300013105 | Bacteria | 2362 |
| 112 | Ga0157369_10732759 | 3300013105 | Bacteria | 1017 |
| 113 | Ga0157374_10190296 | 3300013296 | Bacteria | 2007 |
| 114 | Ga0157374_10912966 | 3300013296 | Bacteria | 896 |
| 115 | Ga0163162_10003676 | 3300013306 | Bacteria | 14707 |
| 116 | Ga0163162_10232016 | 3300013306 | Bacteria | 1976 |
| 117 | Ga0157372_10088837 | 3300013307 | Bacteria | 3510 |
| 118 | Ga0157372_10339206 | 3300013307 | Bacteria | 1750 |
| 119 | Ga0157372_11074550 | 3300013307 | Bacteria | 931 |
| 120 | Ga0157375_10152257 | 3300013308 | Bacteria | 2449 |
| 121 | Ga0163163_10028298 | 3300014325 | Bacteria | 5379 |
| 122 | Ga0157377_10066376 | 3300014745 | Bacteria | 2074 |
| 123 | Ga0157376_10093596 | 3300014969 | Bacteria | 2609 |
| 124 | Ga0197907_10871054 | 3300020069 | Bacteria | 776 |
| 125 | Ga0206356_11046210 | 3300020070 | Bacteria | 625 |
| 126 | Ga0206356_11778877 | 3300020070 | Bacteria | 699 |
| 127 | Ga0206349_1644047 | 3300020075 | Bacteria | 776 |
| 128 | Ga0206355_1410402 | 3300020076 | Bacteria | 2023 |
| 129 | Ga0206355_1624809 | 3300020076 | Bacteria | 1061 |
| 130 | Ga0206352_10262384 | 3300020078 | Bacteria | 883 |
| 131 | Ga0206352_10610341 | 3300020078 | Bacteria | 892 |
| 132 | Ga0206352_11309092 | 3300020078 | Bacteria | 651 |
| 133 | Ga0206350_10061001 | 3300020080 | Bacteria | 1127 |
| 134 | Ga0206350_10790842 | 3300020080 | Bacteria | 649 |
| 135 | Ga0206353_11405000 | 3300020082 | Bacteria | 713 |
| 136 | Ga0206353_11805710 | 3300020082 | Bacteria | 1020 |
| 137 | Ga0154015_1456180 | 3300020610 | Bacteria | 759 |
| 138 | Ga0213872_10078806 | 3300021361 | Bacteria | 1481 |
| 139 | Ga0213876_10047846 | 3300021384 | Bacteria | 2261 |
| 140 | Ga0213875_10020039 | 3300021388 | Bacteria | 3211 |
| 141 | Ga0213875_10086980 | 3300021388 | Bacteria | 1458 |
| 142 | Ga0224712_10069896 | 3300022467 | Bacteria | 1422 |
| 143 | Ga0224712_10192606 | 3300022467 | Bacteria | 923 |
| 144 | Ga0224712_10248629 | 3300022467 | Bacteria | 821 |
| 145 | Ga0247551_105764 | 3300023552 | Bacteria | 520 |
| 146 | Ga0207697_10371254 | 3300025315 | Bacteria | 635 |
| 147 | Ga0207692_10073593 | 3300025898 | Bacteria | 1808 |
| 148 | Ga0207692_10369002 | 3300025898 | Bacteria | 888 |
| 149 | Ga0207692_10379631 | 3300025898 | Bacteria | 877 |
| 150 | Ga0207710_10152399 | 3300025900 | Bacteria | 1122 |
| 151 | Ga0207710_10203766 | 3300025900 | Bacteria | 978 |
| 152 | Ga0207647_10153682 | 3300025904 | Bacteria | 1344 |
| 153 | Ga0207699_10148910 | 3300025906 | Bacteria | 1546 |
| 154 | Ga0207699_11091749 | 3300025906 | Bacteria | 591 |
| 155 | Ga0207684_10018833 | 3300025910 | Bacteria | 5906 |
| 156 | Ga0207654_10151251 | 3300025911 | Bacteria | 1490 |
| 157 | Ga0207707_10002249 | 3300025912 | Bacteria | 17455 |
| 158 | Ga0207707_10014023 | 3300025912 | Bacteria | 6986 |
| 159 | Ga0207707_10087345 | 3300025912 | Bacteria | 2725 |
| 160 | Ga0207695_10486341 | 3300025913 | Bacteria | 1116 |
| 161 | Ga0207695_10761252 | 3300025913 | Bacteria | 849 |
| 162 | Ga0207671_10025441 | 3300025914 | Bacteria | 4446 |
| 163 | Ga0207671_10274769 | 3300025914 | Bacteria | 1328 |
| 164 | Ga0207693_10011177 | 3300025915 | Bacteria | 7268 |
| 165 | Ga0207693_10122650 | 3300025915 | Bacteria | 2041 |
| 166 | Ga0207663_10031022 | 3300025916 | Bacteria | 3158 |
| 167 | Ga0207663_10080161 | 3300025916 | Bacteria | 2134 |
| 168 | Ga0207660_10026951 | 3300025917 | Bacteria | 3917 |
| 169 | Ga0207660_10134631 | 3300025917 | Bacteria | 1884 |
| 170 | Ga0207660_10750932 | 3300025917 | Bacteria | 796 |
| 171 | Ga0207660_11035386 | 3300025917 | Bacteria | 669 |
| 172 | Ga0207652_10065070 | 3300025921 | Bacteria | 3156 |
| 173 | Ga0207652_10109024 | 3300025921 | Bacteria | 2454 |
| 174 | Ga0207694_10389258 | 3300025924 | Bacteria | 1158 |
| 175 | Ga0207694_10574160 | 3300025924 | Bacteria | 947 |
| 176 | Ga0207687_10061452 | 3300025927 | Bacteria | 2653 |
| 177 | Ga0207700_10002433 | 3300025928 | Bacteria | 10681 |
| 178 | Ga0207700_10012557 | 3300025928 | Bacteria | 5470 |
| 179 | Ga0207664_10045421 | 3300025929 | Bacteria | 3445 |
| 180 | Ga0207664_10428241 | 3300025929 | Bacteria | 1179 |
| 181 | Ga0207664_11920109 | 3300025929 | Bacteria | 515 |
| 182 | Ga0207665_10090439 | 3300025939 | Bacteria | 2121 |
| 183 | Ga0207665_10108900 | 3300025939 | Bacteria | 1944 |
| 184 | Ga0207661_10000410 | 3300025944 | Bacteria | 27651 |
| 185 | Ga0207661_10073730 | 3300025944 | Bacteria | 2796 |
| 186 | Ga0207661_10591547 | 3300025944 | Bacteria | 1018 |
| 187 | Ga0207661_10650009 | 3300025944 | Bacteria | 969 |
| 188 | Ga0207667_10341231 | 3300025949 | Bacteria | 1529 |
| 189 | Ga0207651_11673379 | 3300025960 | Bacteria | 573 |
| 190 | Ga0207677_10150309 | 3300026023 | Bacteria | 1796 |
| 191 | Ga0207639_10077431 | 3300026041 | Bacteria | 2622 |
| 192 | Ga0207639_10148107 | 3300026041 | Bacteria | 1963 |
| 193 | Ga0207639_10979900 | 3300026041 | Bacteria | 791 |
| 194 | Ga0207678_10014210 | 3300026067 | Bacteria | 7000 |
| 195 | Ga0207678_10533579 | 3300026067 | Bacteria | 1025 |
| 196 | Ga0207702_10591447 | 3300026078 | Bacteria | 1088 |
| 197 | Ga0207641_10658828 | 3300026088 | Bacteria | 1029 |
| 198 | Ga0207641_11653430 | 3300026088 | Bacteria | 642 |
| 199 | Ga0207676_10738202 | 3300026095 | Bacteria | 957 |
| 200 | Ga0207674_10146657 | 3300026116 | Bacteria | 2318 |
| 201 | Ga0207683_10016693 | 3300026121 | Bacteria | 6247 |
| 202 | Ga0207698_10027117 | 3300026142 | Bacteria | 4063 |
| 203 | Ga0207698_11259909 | 3300026142 | Bacteria | 754 |
| 204 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 205 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 206 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 207 | Ga0268266_10400089 | 3300028379 | Bacteria | 1298 |
| 208 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 209 | Ga0307511_10049805 | 3300030521 | Bacteria | 3383 |
| 210 | Ga0265763_1018645 | 3300030763 | Bacteria | 713 |
| 211 | Ga0265763_1048242 | 3300030763 | Bacteria | 530 |
| 212 | Ga0265766_1007200 | 3300030863 | Bacteria | 743 |
| 213 | Ga0265766_1012464 | 3300030863 | Bacteria | 628 |
| 214 | Ga0265772_103947 | 3300030886 | Bacteria | 627 |
| 215 | Ga0265769_110484 | 3300030888 | Bacteria | 635 |
| 216 | Ga0265768_109348 | 3300030963 | Bacteria | 619 |
| 217 | Ga0265768_109393 | 3300030963 | Bacteria | 618 |
| 218 | Ga0265773_1026313 | 3300031018 | Bacteria | 602 |
| 219 | Ga0265339_10005937 | 3300031249 | Bacteria | 8076 |
| 220 | Ga0307513_10573714 | 3300031456 | Bacteria | 839 |
| 221 | Ga0307509_10038177 | 3300031507 | Bacteria | 5241 |
| 222 | Ga0307509_10510023 | 3300031507 | Bacteria | 885 |
| 223 | Ga0310114_117475 | 3300031678 | Bacteria | 655 |
| 224 | Ga0307516_10109129 | 3300031730 | Bacteria | 2573 |
| 225 | Ga0307516_10147601 | 3300031730 | Bacteria | 2116 |
| 226 | Ga0307516_10421154 | 3300031730 | Bacteria | 993 |
| 227 | Ga0307507_10035312 | 3300033179 | Bacteria | 5138 |
| 228 | Ga0373926_0408073 | 3300035083 | Bacteria | 537 |
| 229 | Ga0373934_0064976 | 3300035086 | Bacteria | 1457 |
| 230 | Ga0373940_0203879 | 3300035088 | Bacteria | 651 |
| 231 | Ga0373923_0090427 | 3300035111 | Bacteria | 1338 |
| 232 | Ga0373945_0356243 | 3300035116 | Bacteria | 635 |
| 233 | Ga0373953_0424396 | 3300035117 | Bacteria | 586 |
| 234 | Ga0373954_0043633 | 3300035118 | Bacteria | 2091 |
| 235 | Ga0373946_0111443 | 3300035171 | Bacteria | 1239 |
| 236 | Ga0373955_0051784 | 3300035172 | Bacteria | 2237 |
| 237 | Ga0373955_0305201 | 3300035172 | Bacteria | 960 |
| 238 | Ga0373924_0006062 | 3300035410 | Bacteria | 4316 |
| 239 | Ga0373931_0868021 | 3300035691 | Bacteria | 605 |
| 240 | Ga0373935_0600935 | 3300035692 | Bacteria | 804 |
| 241 | Ga0373927_0007540 | 3300035695 | Bacteria | 7359 |
| 242 | Ga0373927_0163909 | 3300035695 | Bacteria | 1456 |
| 243 | Ga0373927_0277960 | 3300035695 | Bacteria | 1101 |
| 244 | Ga0373933_0000041 | 3300035724 | Bacteria | 79805 |
| 245 | Ga0373933_0318215 | 3300035724 | Bacteria | 1009 |
| 246 | Ga0373933_0442975 | 3300035724 | Bacteria | 849 |
| 247 | Ga0373947_0161160 | 3300035725 | Bacteria | 1451 |
| 248 | Ga0373947_0199246 | 3300035725 | Bacteria | 1309 |
| 249 | Ga0310104_05991 | 3300036242 | Bacteria | 1036 |
| 250 | Ga0310104_15421 | 3300036242 | Bacteria | 592 |
| 251 | Ga0373937_0492596 | 3300036401 | Bacteria | 1164 |
| 252 | Ga0310112_036241 | 3300036458 | Bacteria | 673 |
| 253 | Ga0310112_037313 | 3300036458 | Bacteria | 662 |
| 254 | Ga0372808_017927 | 3300036459 | Bacteria | 1017 |
| 255 | Ga0310109_029386 | 3300036534 | Bacteria | 730 |
| 256 | Ga0310109_030007 | 3300036534 | Bacteria | 722 |
| 257 | Ga0310110_015967 | 3300036535 | Bacteria | 1070 |
| 258 | Ga0373925_0072072 | 3300037068 | Bacteria | 2613 |
| 259 | Ga0373925_0206849 | 3300037068 | Bacteria | 1562 |
| 260 | Ga0395900_0020777 | 3300037418 | Bacteria | 6712 |
| 261 | Ga0395898_0107317 | 3300037466 | Bacteria | 2678 |
| 262 | Ga0436364_1495700 | 3300037853 | Bacteria | 2645 |
| 263 | Ga0436364_1521545 | 3300037853 | Bacteria | 4218 |
| 264 | Ga0395901_0327193 | 3300038443 | Bacteria | 1585 |
| 265 | Ga0436365_0937621 | 3300039437 | Bacteria | 2451 |
| 266 | Ga0436365_0994240 | 3300039437 | Bacteria | 1735 |
| 267 | Ga0436360_0778394 | 3300039438 | Bacteria | 1874 |
| 268 | Ga0436360_0826250 | 3300039438 | Bacteria | 1115 |
| 269 | Ga0436360_1084860 | 3300039438 | Bacteria | 1571 |
| 270 | Ga0436361_1037124 | 3300039447 | Bacteria | 3314 |
| 271 | Ga0436361_1097065 | 3300039447 | Bacteria | 4911 |
| 272 | Ga0436363_0699152 | 3300039450 | Bacteria | 2726 |
| 273 | Ga0436363_1453805 | 3300039450 | Bacteria | 578 |
| 274 | Ga0451795_1523835 | 3300041456 | Bacteria | 504 |
| 275 | Ga0451849_1386904 | 3300041505 | Bacteria | 525 |
| 276 | Ga0451853_0423507 | 3300041512 | Bacteria | 987 |
| 277 | Ga0466969_0172347 | 3300044656 | Bacteria | 992 |
| 278 | Ga0466961_0371511 | 3300044693 | Bacteria | 869 |
| 279 | Ga0466963_0044029 | 3300044694 | Bacteria | 2937 |
| 280 | Ga0466971_0223486 | 3300044719 | Bacteria | 893 |
| 281 | Ga0466957_1431624 | 3300044842 | Bacteria | 503 |
| 282 | Ga0495592_0543966 | 3300046454 | Bacteria | 715 |
| 283 | Ga0495603_0323053 | 3300046455 | Bacteria | 886 |
| 284 | Ga0495603_0839436 | 3300046455 | Bacteria | 523 |
| 285 | Ga0495629_0129936 | 3300046459 | Bacteria | 1755 |
| 286 | Ga0495638_0177726 | 3300046460 | Bacteria | 1217 |
| 287 | Ga0495582_0195270 | 3300046473 | Bacteria | 1155 |
| 288 | Ga0495664_0769276 | 3300046477 | Bacteria | 567 |
| 289 | Ga0495606_0008403 | 3300046507 | Bacteria | 8979 |
| 290 | Ga0495618_0169872 | 3300046514 | Bacteria | 1388 |
| 291 | Ga0495652_0224894 | 3300046529 | Bacteria | 1408 |
| 292 | Ga0495586_0371092 | 3300046535 | Bacteria | 823 |
| 293 | Ga0495587_0465796 | 3300046536 | Bacteria | 700 |
| 294 | Ga0495645_0012692 | 3300046543 | Bacteria | 5942 |
| 295 | Ga0495622_0028887 | 3300046557 | Bacteria | 2591 |
| 296 | Ga0495667_0863218 | 3300046559 | Bacteria | 556 |
| 297 | Ga0495634_0196553 | 3300046642 | Bacteria | 1255 |
| 298 | Ga0495623_0200962 | 3300046679 | Bacteria | 1146 |
| 299 | Ga0495646_0223644 | 3300046680 | Bacteria | 1017 |
| 300 | Ga0495624_0094983 | 3300046690 | Bacteria | 1838 |
| 301 | Ga0495581_0010155 | 3300047315 | Bacteria | 5448 |
| 302 | Ga0495604_0395362 | 3300047317 | Bacteria | 911 |
| 303 | Ga0495674_0061625 | 3300047319 | Bacteria | 3268 |
| 304 | Ga0495680_0320378 | 3300047322 | Bacteria | 1085 |
| 305 | Ga0495680_0997686 | 3300047322 | Bacteria | 535 |
| 306 | Ga0495684_0449145 | 3300047471 | Bacteria | 896 |
| 307 | Ga0495686_0256988 | 3300047472 | Bacteria | 979 |
| 308 | Ga0496100_0018770 | 3300048903 | Bacteria | 4111 |
| 309 | Ga0496101_0032308 | 3300048904 | Bacteria | 3683 |
| 310 | Ga0496102_0003268 | 3300048905 | Bacteria | 13736 |
| 311 | Ga0496102_0435260 | 3300048905 | Bacteria | 1231 |
| 312 | Ga0496103_0271045 | 3300048906 | Bacteria | 1092 |
| 313 | Ga0496104_0103927 | 3300048907 | Bacteria | 2721 |
| 314 | Ga0496105_0044527 | 3300048908 | Bacteria | 3660 |
| 315 | Ga0496106_0000540 | 3300048909 | Bacteria | 26830 |
| 316 | Ga0496106_0009950 | 3300048909 | Bacteria | 7019 |
| 317 | Ga0496107_0011065 | 3300048910 | Bacteria | 6277 |
| 318 | Ga0496108_0245050 | 3300048911 | Bacteria | 1559 |
| 319 | Ga0496109_0032304 | 3300048912 | Bacteria | 4705 |
| 320 | Ga0496110_0476009 | 3300048913 | Bacteria | 1138 |
| 321 | Ga0496111_0127620 | 3300048914 | Bacteria | 1881 |
| 322 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 323 | Ga0496112_0050747 | 3300048915 | Bacteria | 4069 |
| 324 | Ga0496112_0151190 | 3300048915 | Bacteria | 2288 |
| 325 | Ga0496112_0168341 | 3300048915 | Bacteria | 2157 |
| 326 | Ga0496113_0967565 | 3300048916 | Bacteria | 671 |
| 327 | Ga0496114_0026575 | 3300048917 | Bacteria | 4740 |
| 328 | Ga0496115_0001335 | 3300048918 | Bacteria | 17580 |
| 329 | Ga0496115_0211001 | 3300048918 | Bacteria | 1604 |
| 330 | Ga0496117_0087639 | 3300048920 | Bacteria | 2017 |
| 331 | Ga0496117_0133189 | 3300048920 | Bacteria | 1502 |
| 332 | Ga0496118_0006481 | 3300048921 | Bacteria | 12851 |
| 333 | Ga0496118_0161095 | 3300048921 | Bacteria | 1387 |
| 334 | Ga0496119_0157482 | 3300048922 | Bacteria | 1211 |
| 335 | Ga0496120_0059518 | 3300048923 | Bacteria | 2141 |
| 336 | Ga0496120_0238079 | 3300048923 | Bacteria | 861 |
| 337 | Ga0496121_0000456 | 3300048924 | Bacteria | 80536 |
| 338 | Ga0496121_0005356 | 3300048924 | Bacteria | 16491 |
| 339 | Ga0496124_0001010 | 3300048927 | Bacteria | 44569 |
| 340 | Ga0496125_0026319 | 3300048928 | Bacteria | 5305 |
| 341 | Ga0496126_0010869 | 3300048929 | Bacteria | 9486 |
| 342 | Ga0496126_0021384 | 3300048929 | Bacteria | 6318 |
| 343 | Ga0496126_0035874 | 3300048929 | Bacteria | 4642 |
| 344 | Ga0496126_0037772 | 3300048929 | Bacteria | 4502 |
| 345 | Ga0496126_0112404 | 3300048929 | Bacteria | 2371 |
| 346 | Ga0496126_0458166 | 3300048929 | Bacteria | 1025 |
| 347 | Ga0501031_0492882 | 3300049568 | Bacteria | 790 |
| 348 | Ga0501032_0029893 | 3300049569 | Bacteria | 3737 |
| 349 | Ga0501032_0234288 | 3300049569 | Bacteria | 1193 |
| 350 | Ga0501032_0828201 | 3300049569 | Bacteria | 584 |
| 351 | Ga0501033_0013873 | 3300049570 | Bacteria | 6131 |
| 352 | Ga0501037_0008746 | 3300049573 | Bacteria | 7421 |
| 353 | Ga0501038_0140923 | 3300049574 | Bacteria | 1972 |
| 354 | Ga0501039_0101591 | 3300049575 | Bacteria | 2244 |
| 355 | Ga0501039_1598997 | 3300049575 | Bacteria | 500 |
| 356 | Ga0501042_0291495 | 3300049578 | Bacteria | 1179 |
| 357 | Ga0501043_0070101 | 3300049579 | Bacteria | 2753 |
| 358 | Ga0501046_0304009 | 3300049580 | Bacteria | 1164 |
| 359 | Ga0501046_0558530 | 3300049580 | Bacteria | 815 |
| 360 | Ga0501047_0006253 | 3300049581 | Bacteria | 11198 |
| 361 | Ga0501047_0055504 | 3300049581 | Bacteria | 3830 |
| 362 | Ga0501048_0012334 | 3300049582 | Bacteria | 6359 |
| 363 | Ga0501068_0125629 | 3300049584 | Bacteria | 1602 |
| 364 | Ga0501070_0001323 | 3300049586 | Bacteria | 22154 |
| 365 | Ga0501070_0351878 | 3300049586 | Bacteria | 1195 |
| 366 | Ga0501071_0108660 | 3300049587 | Bacteria | 2049 |
| 367 | Ga0501072_0803976 | 3300049588 | Bacteria | 736 |
| 368 | Ga0501073_0066035 | 3300049589 | Bacteria | 2522 |
| 369 | Ga0501073_0342449 | 3300049589 | Bacteria | 1032 |
| 370 | Ga0501074_0047876 | 3300049590 | Bacteria | 3089 |
| 371 | Ga0501074_0114738 | 3300049590 | Bacteria | 1927 |
| 372 | Ga0501079_0189028 | 3300049741 | Bacteria | 1607 |
| 373 | Ga0501079_0931345 | 3300049741 | Bacteria | 684 |
| 374 | Ga0501080_0005584 | 3300049742 | Bacteria | 11238 |
| 375 | Ga0501080_0084317 | 3300049742 | Bacteria | 2952 |
| 376 | Ga0501035_0079019 | 3300049822 | Bacteria | 2906 |
| 377 | Ga0501035_0091301 | 3300049822 | Bacteria | 2680 |
| 378 | Ga0501044_0025974 | 3300049823 | Bacteria | 6204 |
| 379 | Ga0501044_0110279 | 3300049823 | Bacteria | 2760 |
| 380 | Ga0501044_0211670 | 3300049823 | Bacteria | 1892 |
| 381 | Ga0501045_0117270 | 3300049824 | Bacteria | 1976 |
| 382 | nmdc:mga08x19_1017769_c1 | 3300050514 | Bacteria | 588 |
| 383 | Ga0495601_0121995 | 3300053077 | Bacteria | 1693 |
| 384 | Ga0495612_0074345 | 3300053078 | Bacteria | 1421 |
| 385 | Ga0495612_0219527 | 3300053078 | Bacteria | 841 |
| 386 | Ga0500635_0020115 | 3300053080 | Bacteria | 2040 |
| 387 | Ga0495619_0429725 | 3300053085 | Bacteria | 911 |
| 388 | Ga0500647_0270311 | 3300053091 | Bacteria | 739 |
| 389 | Ga0500583_0204578 | 3300053092 | Bacteria | 981 |
| 390 | Ga0500651_0019749 | 3300053093 | Bacteria | 4191 |
| 391 | Ga0500640_003151 | 3300053095 | Bacteria | 5670 |
| 392 | Ga0500648_283575 | 3300053097 | Bacteria | 744 |
| 393 | Ga0500572_000217 | 3300053111 | Bacteria | 20413 |
| 394 | Ga0500592_012679 | 3300053116 | Bacteria | 1349 |
| 395 | Ga0500595_000324 | 3300053119 | Bacteria | 31413 |
| 396 | Ga0500595_008462 | 3300053119 | Bacteria | 4199 |
| 397 | Ga0500608_051766 | 3300053122 | Bacteria | 1972 |
| 398 | Ga0500614_005804 | 3300053123 | Bacteria | 2593 |
| 399 | Ga0500642_0267798 | 3300053130 | Bacteria | 780 |
| 400 | Ga0500559_0008734 | 3300053136 | Bacteria | 4420 |
| 401 | Ga0500559_0082087 | 3300053136 | Bacteria | 1467 |
| 402 | Ga0500568_0063633 | 3300053139 | Bacteria | 1423 |
| 403 | Ga0500573_0015719 | 3300053140 | Bacteria | 4293 |
| 404 | Ga0500603_000507 | 3300053150 | Bacteria | 9880 |
| 405 | Ga0500603_080706 | 3300053150 | Bacteria | 942 |
| 406 | Ga0500622_0043989 | 3300053156 | Bacteria | 2315 |
| 407 | Ga0500627_0051674 | 3300053158 | Bacteria | 1793 |
| 408 | Ga0500630_000537 | 3300053159 | Bacteria | 17060 |
| 409 | Ga0500638_002399 | 3300053162 | Bacteria | 6506 |
| 410 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 411 | Ga0500639_104097 | 3300053163 | Bacteria | 1391 |
| 412 | Ga0500639_119374 | 3300053163 | Bacteria | 1269 |
| 413 | Ga0500639_190281 | 3300053163 | Bacteria | 895 |
| 414 | Ga0500636_0005118 | 3300053177 | Bacteria | 7451 |
| 415 | Ga0500636_0066084 | 3300053177 | Bacteria | 2103 |
| 416 | Ga0500636_0342439 | 3300053177 | Bacteria | 717 |
| 417 | Ga0500637_0030575 | 3300053178 | Bacteria | 2997 |
| 418 | Ga0500570_114053 | 3300053724 | Bacteria | 1086 |
| 419 | Ga0500657_252233 | 3300053728 | Bacteria | 523 |
| 420 | Ga0500609_010225 | 3300053731 | Bacteria | 1263 |
| 421 | Ga0500552_002880 | 3300053733 | Bacteria | 1710 |
| 422 | Ga0500596_000054 | 3300053735 | Bacteria | 15502 |
| 423 | Ga0500596_009222 | 3300053735 | Bacteria | 1545 |
| 424 | Ga0500613_048832 | 3300053738 | Bacteria | 659 |
| 425 | Ga0500661_017471 | 3300055283 | Bacteria | 1282 |
| 426 | Ga0587084_054078 | 3300059477 | Bacteria | 718 |
| 427 | Ga0587084_054184 | 3300059477 | Unclassified | 718 |
| 428 | Ga0587084_066734 | 3300059477 | Bacteria | 671 |
| 429 | Ga0587084_071986 | 3300059477 | Bacteria | 654 |
| 430 | Ga0587084_078600 | 3300059477 | Bacteria | 635 |
| 431 | Ga0587084_081479 | 3300059477 | Bacteria | 628 |
| 432 | Ga0587084_104066 | 3300059477 | Bacteria | 579 |
| 433 | Ga0587093_034508 | 3300059478 | Bacteria | 743 |
| 434 | Ga0587093_048102 | 3300059478 | Bacteria | 666 |
| 435 | Ga0587066_127438 | 3300059490 | Bacteria | 608 |
| 436 | Ga0587066_134447 | 3300059490 | Bacteria | 598 |
| 437 | Ga0587070_074572 | 3300059491 | Bacteria | 731 |
| 438 | Ga0587070_087992 | 3300059491 | Bacteria | 694 |
| 439 | Ga0587070_093125 | 3300059491 | Bacteria | 681 |
| 440 | Ga0587073_0109670 | 3300059492 | Bacteria | 729 |
| 441 | Ga0587073_0136655 | 3300059492 | Bacteria | 679 |
| 442 | Ga0587073_0160695 | 3300059492 | Bacteria | 644 |
| 443 | Ga0587073_0224013 | 3300059492 | Bacteria | 576 |
| 444 | Ga0587077_035721 | 3300059493 | Bacteria | 972 |
| 445 | Ga0587077_038830 | 3300059493 | Bacteria | 946 |
| 446 | Ga0587077_095298 | 3300059493 | Bacteria | 706 |
| 447 | Ga0587077_102719 | 3300059493 | Bacteria | 689 |
| 448 | Ga0587077_107595 | 3300059493 | Bacteria | 678 |
| 449 | Ga0587077_225442 | 3300059493 | Bacteria | 531 |
| 450 | Ga0587080_076140 | 3300059503 | Bacteria | 680 |
| 451 | Ga0587080_091004 | 3300059503 | Bacteria | 640 |
| 452 | Ga0587082_060978 | 3300059504 | Bacteria | 744 |
| 453 | Ga0587082_067651 | 3300059504 | Bacteria | 719 |
| 454 | Ga0587082_096048 | 3300059504 | Bacteria | 639 |
| 455 | Ga0587082_111056 | 3300059504 | Bacteria | 609 |
| 456 | Ga0587083_0058760 | 3300059505 | Bacteria | 861 |
| 457 | Ga0587083_0089912 | 3300059505 | Bacteria | 747 |
| 458 | Ga0587083_0108837 | 3300059505 | Bacteria | 701 |
| 459 | Ga0587083_0121966 | 3300059505 | Bacteria | 674 |
| 460 | Ga0587085_060059 | 3300059506 | Bacteria | 717 |
| 461 | Ga0587085_064318 | 3300059506 | Bacteria | 702 |
| 462 | Ga0587086_041316 | 3300059507 | Bacteria | 715 |
| 463 | Ga0587086_046022 | 3300059507 | Bacteria | 690 |
| 464 | Ga0587086_054685 | 3300059507 | Bacteria | 651 |
| 465 | Ga0587088_093596 | 3300059508 | Bacteria | 662 |
| 466 | Ga0587088_110115 | 3300059508 | Bacteria | 625 |
| 467 | Ga0587088_112016 | 3300059508 | Bacteria | 622 |
| 468 | Ga0587089_052859 | 3300059509 | Bacteria | 656 |
| 469 | Ga0587090_037912 | 3300059510 | Bacteria | 836 |
| 470 | Ga0587090_041629 | 3300059510 | Bacteria | 811 |
| 471 | Ga0587090_069215 | 3300059510 | Bacteria | 686 |
| 472 | Ga0587090_076392 | 3300059510 | Bacteria | 663 |
| 473 | Ga0587090_081153 | 3300059510 | Bacteria | 650 |
| 474 | Ga0587091_085043 | 3300059511 | Bacteria | 717 |
| 475 | Ga0587091_092412 | 3300059511 | Bacteria | 697 |
| 476 | Ga0587091_107501 | 3300059511 | Bacteria | 662 |
| 477 | Ga0587091_123110 | 3300059511 | Bacteria | 632 |
| 478 | Ga0587091_132249 | 3300059511 | Bacteria | 617 |
| 479 | Ga0587092_063300 | 3300059512 | Bacteria | 697 |
| 480 | Ga0587092_063825 | 3300059512 | Bacteria | 695 |
| 481 | Ga0587092_066066 | 3300059512 | Bacteria | 687 |
| 482 | Ga0587094_031515 | 3300059513 | Bacteria | 824 |
| 483 | Ga0587094_046419 | 3300059513 | Bacteria | 723 |
| 484 | Ga0587094_062714 | 3300059513 | Bacteria | 654 |
| 485 | Ga0587095_020831 | 3300059514 | Bacteria | 629 |
| 486 | Ga0587098_043890 | 3300059604 | Bacteria | 659 |
| 487 | Ga0587106_075782 | 3300059605 | Bacteria | 646 |
| 488 | Ga0587125_016778 | 3300059607 | Bacteria | 825 |
| 489 | Ga0587125_026775 | 3300059607 | Bacteria | 715 |
| 490 | Ga0587101_017282 | 3300059623 | Bacteria | 998 |
| 491 | Ga0587101_019396 | 3300059623 | Bacteria | 963 |
| 492 | Ga0587101_020050 | 3300059623 | Bacteria | 953 |
| 493 | Ga0587101_044907 | 3300059623 | Bacteria | 742 |
| 494 | Ga0587101_045682 | 3300059623 | Bacteria | 738 |
| 495 | Ga0587101_053898 | 3300059623 | Bacteria | 700 |
| 496 | Ga0587101_065572 | 3300059623 | Bacteria | 658 |
| 497 | Ga0587101_088554 | 3300059623 | Bacteria | 598 |
| 498 | Ga0587109_042855 | 3300059624 | Bacteria | 903 |
| 499 | Ga0587109_114947 | 3300059624 | Bacteria | 633 |
| 500 | Ga0587109_170916 | 3300059624 | Bacteria | 550 |
| 501 | Ga0587109_207908 | 3300059624 | Bacteria | 513 |
| 502 | Ga0587115_042178 | 3300059626 | Bacteria | 716 |
| 503 | Ga0587115_064286 | 3300059626 | Bacteria | 621 |
| 504 | Ga0587115_094356 | 3300059626 | Bacteria | 547 |
| 505 | Ga0587117_051767 | 3300059627 | Bacteria | 683 |
| 506 | Ga0587117_062129 | 3300059627 | Bacteria | 644 |
| 507 | Ga0587117_074480 | 3300059627 | Bacteria | 608 |
| 508 | Ga0587127_019325 | 3300059629 | Bacteria | 594 |
| 509 | Ga0587128_053608 | 3300059630 | Bacteria | 743 |
| 510 | Ga0587128_067427 | 3300059630 | Bacteria | 690 |
| 511 | Ga0587128_085614 | 3300059630 | Bacteria | 638 |
| 512 | Ga0587128_090632 | 3300059630 | Bacteria | 627 |
| 513 | Ga0587062_041722 | 3300059639 | Bacteria | 747 |
| 514 | Ga0587062_045782 | 3300059639 | Bacteria | 725 |
| 515 | Ga0587062_046038 | 3300059639 | Bacteria | 724 |
| 516 | Ga0587062_048139 | 3300059639 | Bacteria | 714 |
| 517 | Ga0587062_060680 | 3300059639 | Bacteria | 663 |
| 518 | Ga0587062_062424 | 3300059639 | Bacteria | 657 |
| 519 | Ga0587067_048932 | 3300059640 | Bacteria | 849 |
| 520 | Ga0587068_066538 | 3300059641 | Bacteria | 703 |
| 521 | Ga0587068_067412 | 3300059641 | Bacteria | 700 |
| 522 | Ga0587068_079191 | 3300059641 | Bacteria | 661 |
| 523 | Ga0587068_112594 | 3300059641 | Bacteria | 583 |
| 524 | Ga0587069_055820 | 3300059642 | Bacteria | 715 |
| 525 | Ga0587069_058545 | 3300059642 | Bacteria | 704 |
| 526 | Ga0587069_073453 | 3300059642 | Bacteria | 654 |
| 527 | Ga0587069_077778 | 3300059642 | Bacteria | 642 |
| 528 | Ga0587069_102436 | 3300059642 | Bacteria | 586 |
| 529 | Ga0587072_046549 | 3300059643 | Bacteria | 858 |
| 530 | Ga0587072_094146 | 3300059643 | Bacteria | 664 |
| 531 | Ga0587075_038274 | 3300059644 | Bacteria | 793 |
| 532 | Ga0587075_046875 | 3300059644 | Bacteria | 743 |
| 533 | Ga0587075_047895 | 3300059644 | Bacteria | 737 |
| 534 | Ga0587075_052123 | 3300059644 | Bacteria | 717 |
| 535 | Ga0587076_038044 | 3300059645 | Bacteria | 887 |
| 536 | Ga0587076_062267 | 3300059645 | Bacteria | 755 |
| 537 | Ga0587076_062879 | 3300059645 | Bacteria | 752 |
| 538 | Ga0587076_069391 | 3300059645 | Bacteria | 728 |
| 539 | Ga0587076_075824 | 3300059645 | Bacteria | 708 |
| 540 | Ga0587076_084357 | 3300059645 | Bacteria | 683 |
| 541 | Ga0587076_099261 | 3300059645 | Bacteria | 648 |
| 542 | Ga0587078_017655 | 3300059646 | Bacteria | 877 |
| 543 | Ga0587078_028494 | 3300059646 | Bacteria | 742 |
| 544 | Ga0587078_038909 | 3300059646 | Bacteria | 666 |
| 545 | Ga0587078_041935 | 3300059646 | Bacteria | 649 |
| 546 | Ga0587079_050411 | 3300059647 | Bacteria | 872 |
| 547 | Ga0587079_111768 | 3300059647 | Bacteria | 665 |
| 548 | Ga0587079_112734 | 3300059647 | Bacteria | 663 |
| 549 | Ga0587079_134131 | 3300059647 | Bacteria | 625 |
| 550 | Ga0587079_144478 | 3300059647 | Bacteria | 609 |
| 551 | Ga0587079_154532 | 3300059647 | Bacteria | 596 |
| 552 | Ga0587079_160676 | 3300059647 | Bacteria | 588 |
| 553 | Ga0587100_006875 | 3300059648 | Bacteria | 886 |
| 554 | Ga0587100_015195 | 3300059648 | Bacteria | 702 |
| 555 | Ga0587100_018176 | 3300059648 | Bacteria | 665 |
| 556 | Ga0587100_019016 | 3300059648 | Bacteria | 656 |
| 557 | Ga0587102_020847 | 3300059649 | Bacteria | 739 |
| 558 | Ga0587107_077875 | 3300059652 | Bacteria | 618 |
| 559 | Ga0587110_043554 | 3300059654 | Bacteria | 583 |
| 560 | Ga0587119_073084 | 3300059658 | Bacteria | 547 |
| 561 | Ga0587124_012095 | 3300059660 | Bacteria | 792 |
| 562 | Ga0587124_023362 | 3300059660 | Bacteria | 645 |
| 563 | Ga0587071_031911 | 3300060344 | Bacteria | 1019 |
| 564 | Ga0587071_033342 | 3300060344 | Bacteria | 1002 |
| 565 | Ga0587071_056039 | 3300060344 | Bacteria | 827 |
| 566 | Ga0587071_075486 | 3300060344 | Bacteria | 742 |
| 567 | Ga0587071_091763 | 3300060344 | Bacteria | 691 |
| 568 | Ga0587071_142972 | 3300060344 | Bacteria | 589 |
| 569 | Ga0587111_0100415 | 3300060346 | Bacteria | 720 |
| 570 | Ga0587111_0106677 | 3300060346 | Bacteria | 705 |
| 571 | Ga0587111_0109278 | 3300060346 | Bacteria | 699 |
| 572 | Ga0587111_0112122 | 3300060346 | Bacteria | 692 |
| 573 | Ga0587111_0128620 | 3300060346 | Bacteria | 660 |
| 574 | Ga0466962_0238251 | 3300061719 | Bacteria | 893 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026095 | Ga0207676_10738202 | Ga0207676_107382021 | 108 |
| 2 | iso_pu_bacteria | 2513237104 | 2513718641 | 110 |
| 3 | 3300039438 | Ga0436360_0778394 | Ga0436360_0778394_1003_1356 | 111 |
| 4 | 3300039447 | Ga0436361_1037124 | Ga0436361_1037124_2622_2975 | 111 |
| 5 | iso_pu_bacteria | 2513237141 | 2513889166 | 112 |
| 6 | 3300005435 | Ga0070714_100223687 | Ga0070714_1002236873 | 113 |
| 7 | 3300005436 | Ga0070713_100066052 | Ga0070713_1000660524 | 113 |
| 8 | 3300006028 | Ga0070717_10002555 | Ga0070717_1000255510 | 113 |
| 9 | 3300006173 | Ga0070716_100007220 | Ga0070716_1000072209 | 113 |
| 10 | 3300025928 | Ga0207700_10012557 | Ga0207700_100125578 | 113 |
| 11 | 3300025929 | Ga0207664_10428241 | Ga0207664_104282412 | 113 |
| 12 | 3300025939 | Ga0207665_10108900 | Ga0207665_101089001 | 113 |
| 13 | 3300026023 | Ga0207677_10150309 | Ga0207677_101503091 | 113 |
| 14 | 3300005467 | Ga0070706_100993100 | Ga0070706_1009931002 | 114 |
| 15 | 3300035724 | Ga0373933_0000041 | Ga0373933_0000041_20314_20679 | 114 |
| 16 | 3300059490 | Ga0587066_127438 | Ga0587066_127438_108_482 | 114 |
| 17 | 3300005334 | Ga0068869_101134631 | Ga0068869_1011346311 | 115 |
| 18 | 3300005337 | Ga0070682_100142354 | Ga0070682_1001423542 | 115 |
| 19 | 3300005338 | Ga0068868_100028867 | Ga0068868_1000288673 | 115 |
| 20 | 3300005338 | Ga0068868_100655689 | Ga0068868_1006556891 | 115 |
| 21 | 3300005344 | Ga0070661_100415203 | Ga0070661_1004152031 | 115 |
| 22 | 3300005355 | Ga0070671_100429000 | Ga0070671_1004290002 | 115 |
| 23 | 3300005364 | Ga0070673_101845832 | Ga0070673_1018458321 | 115 |
| 24 | 3300005434 | Ga0070709_10013858 | Ga0070709_100138586 | 115 |
| 25 | 3300005436 | Ga0070713_100039476 | Ga0070713_1000394764 | 115 |
| 26 | 3300005437 | Ga0070710_10077714 | Ga0070710_100777145 | 115 |
| 27 | 3300005439 | Ga0070711_100094825 | Ga0070711_1000948254 | 115 |
| 28 | 3300005455 | Ga0070663_100009083 | Ga0070663_1000090835 | 115 |
| 29 | 3300005539 | Ga0068853_100244002 | Ga0068853_1002440022 | 115 |
| 30 | 3300005548 | Ga0070665_100092705 | Ga0070665_1000927052 | 115 |
| 31 | 3300005614 | Ga0068856_100645486 | Ga0068856_1006454862 | 115 |
| 32 | 3300005618 | Ga0068864_100189462 | Ga0068864_1001894622 | 115 |
| 33 | 3300005618 | Ga0068864_100690266 | Ga0068864_1006902662 | 115 |
| 34 | 3300005618 | Ga0068864_101459534 | Ga0068864_1014595342 | 115 |
| 35 | 3300005834 | Ga0068851_10045953 | Ga0068851_100459532 | 115 |
| 36 | 3300005841 | Ga0068863_100153114 | Ga0068863_1001531144 | 115 |
| 37 | 3300005841 | Ga0068863_101009584 | Ga0068863_1010095842 | 115 |
| 38 | 3300005842 | Ga0068858_100221497 | Ga0068858_1002214973 | 115 |
| 39 | 3300005843 | Ga0068860_100000058 | Ga0068860_100000058210 | 115 |
| 40 | 3300005983 | Ga0081540_1277834 | Ga0081540_12778341 | 115 |
| 41 | 3300006028 | Ga0070717_10110607 | Ga0070717_101106072 | 115 |
| 42 | 3300006028 | Ga0070717_10348221 | Ga0070717_103482212 | 115 |
| 43 | 3300006175 | Ga0070712_100032824 | Ga0070712_1000328246 | 115 |
| 44 | 3300006358 | Ga0068871_100337213 | Ga0068871_1003372132 | 115 |
| 45 | 3300006358 | Ga0068871_100379250 | Ga0068871_1003792502 | 115 |
| 46 | 3300009098 | Ga0105245_10080528 | Ga0105245_100805282 | 115 |
| 47 | 3300009101 | Ga0105247_10015905 | Ga0105247_100159056 | 115 |
| 48 | 3300009101 | Ga0105247_10101798 | Ga0105247_101017982 | 115 |
| 49 | 3300009101 | Ga0105247_10278113 | Ga0105247_102781133 | 115 |
| 50 | 3300009176 | Ga0105242_10508321 | Ga0105242_105083211 | 115 |
| 51 | 3300009545 | Ga0105237_10005643 | Ga0105237_100056434 | 115 |
| 52 | 3300010375 | Ga0105239_10018730 | Ga0105239_100187305 | 115 |
| 53 | 3300010375 | Ga0105239_10257495 | Ga0105239_102574952 | 115 |
| 54 | 3300011119 | Ga0105246_10016910 | Ga0105246_100169105 | 115 |
| 55 | 3300011119 | Ga0105246_10341466 | Ga0105246_103414664 | 115 |
| 56 | 3300013296 | Ga0157374_10912966 | Ga0157374_109129662 | 115 |
| 57 | 3300013306 | Ga0163162_10003676 | Ga0163162_100036765 | 115 |
| 58 | 3300013308 | Ga0157375_10152257 | Ga0157375_101522573 | 115 |
| 59 | 3300014325 | Ga0163163_10028298 | Ga0163163_100282983 | 115 |
| 60 | 3300014745 | Ga0157377_10066376 | Ga0157377_100663762 | 115 |
| 61 | 3300014969 | Ga0157376_10093596 | Ga0157376_100935962 | 115 |
| 62 | 3300023552 | Ga0247551_105764 | Ga0247551_1057641 | 115 |
| 63 | 3300025315 | Ga0207697_10371254 | Ga0207697_103712542 | 115 |
| 64 | 3300025898 | Ga0207692_10073593 | Ga0207692_100735934 | 115 |
| 65 | 3300025900 | Ga0207710_10152399 | Ga0207710_101523992 | 115 |
| 66 | 3300025900 | Ga0207710_10203766 | Ga0207710_102037661 | 115 |
| 67 | 3300025906 | Ga0207699_10148910 | Ga0207699_101489102 | 115 |
| 68 | 3300025915 | Ga0207693_10011177 | Ga0207693_100111772 | 115 |
| 69 | 3300025916 | Ga0207663_10080161 | Ga0207663_100801614 | 115 |
| 70 | 3300025927 | Ga0207687_10061452 | Ga0207687_100614521 | 115 |
| 71 | 3300025960 | Ga0207651_11673379 | Ga0207651_116733791 | 115 |
| 72 | 3300026041 | Ga0207639_10979900 | Ga0207639_109799001 | 115 |
| 73 | 3300026067 | Ga0207678_10014210 | Ga0207678_100142107 | 115 |
| 74 | 3300026078 | Ga0207702_10591447 | Ga0207702_105914472 | 115 |
| 75 | 3300026088 | Ga0207641_10658828 | Ga0207641_106588282 | 115 |
| 76 | 3300026088 | Ga0207641_11653430 | Ga0207641_116534301 | 115 |
| 77 | 3300026121 | Ga0207683_10016693 | Ga0207683_100166932 | 115 |
| 78 | 3300026142 | Ga0207698_10027117 | Ga0207698_100271172 | 115 |
| 79 | 3300028381 | Ga0268264_10000022 | Ga0268264_10000022453 | 115 |
| 80 | 3300030521 | Ga0307511_10049805 | Ga0307511_100498052 | 115 |
| 81 | 3300030763 | Ga0265763_1018645 | Ga0265763_10186451 | 115 |
| 82 | 3300030763 | Ga0265763_1048242 | Ga0265763_10482422 | 115 |
| 83 | 3300030886 | Ga0265772_103947 | Ga0265772_1039472 | 115 |
| 84 | 3300030888 | Ga0265769_110484 | Ga0265769_1104841 | 115 |
| 85 | 3300030963 | Ga0265768_109348 | Ga0265768_1093482 | 115 |
| 86 | 3300030963 | Ga0265768_109393 | Ga0265768_1093932 | 115 |
| 87 | 3300031018 | Ga0265773_1026313 | Ga0265773_10263131 | 115 |
| 88 | 3300031507 | Ga0307509_10038177 | Ga0307509_100381774 | 115 |
| 89 | 3300031507 | Ga0307509_10510023 | Ga0307509_105100232 | 115 |
| 90 | 3300031678 | Ga0310114_117475 | Ga0310114_1174752 | 115 |
| 91 | 3300031730 | Ga0307516_10109129 | Ga0307516_101091294 | 115 |
| 92 | 3300031730 | Ga0307516_10147601 | Ga0307516_101476013 | 115 |
| 93 | 3300031730 | Ga0307516_10421154 | Ga0307516_104211542 | 115 |
| 94 | 3300033179 | Ga0307507_10035312 | Ga0307507_100353124 | 115 |
| 95 | 3300035083 | Ga0373926_0408073 | Ga0373926_0408073_10_378 | 115 |
| 96 | 3300035088 | Ga0373940_0203879 | Ga0373940_0203879_120_488 | 115 |
| 97 | 3300035695 | Ga0373927_0007540 | Ga0373927_0007540_4677_5045 | 115 |
| 98 | 3300035724 | Ga0373933_0318215 | Ga0373933_0318215_253_621 | 115 |
| 99 | 3300035725 | Ga0373947_0161160 | Ga0373947_0161160_49_417 | 115 |
| 100 | 3300036242 | Ga0310104_05991 | Ga0310104_05991_231_596 | 115 |
| 101 | 3300036242 | Ga0310104_15421 | Ga0310104_15421_125_490 | 115 |
| 102 | 3300036458 | Ga0310112_036241 | Ga0310112_036241_236_601 | 115 |
| 103 | 3300036458 | Ga0310112_037313 | Ga0310112_037313_233_598 | 115 |
| 104 | 3300036459 | Ga0372808_017927 | Ga0372808_017927_421_786 | 115 |
| 105 | 3300036534 | Ga0310109_029386 | Ga0310109_029386_128_493 | 115 |
| 106 | 3300036534 | Ga0310109_030007 | Ga0310109_030007_122_487 | 115 |
| 107 | 3300036535 | Ga0310110_015967 | Ga0310110_015967_232_597 | 115 |
| 108 | 3300037068 | Ga0373925_0206849 | Ga0373925_0206849_1130_1498 | 115 |
| 109 | 3300039438 | Ga0436360_1084860 | Ga0436360_1084860_1003_1368 | 115 |
| 110 | 3300039447 | Ga0436361_1097065 | Ga0436361_1097065_67_432 | 115 |
| 111 | 3300041456 | Ga0451795_1523835 | Ga0451795_1523835_47_415 | 115 |
| 112 | 3300041505 | Ga0451849_1386904 | Ga0451849_1386904_55_423 | 115 |
| 113 | 3300041512 | Ga0451853_0423507 | Ga0451853_0423507_217_621 | 115 |
| 114 | 3300046455 | Ga0495603_0323053 | Ga0495603_0323053_383_787 | 115 |
| 115 | 3300046557 | Ga0495622_0028887 | Ga0495622_0028887_2159_2527 | 115 |
| 116 | 3300047322 | Ga0495680_0997686 | Ga0495680_0997686_142_510 | 115 |
| 117 | 3300048903 | Ga0496100_0018770 | Ga0496100_0018770_3613_4017 | 115 |
| 118 | 3300048904 | Ga0496101_0032308 | Ga0496101_0032308_2270_2674 | 115 |
| 119 | 3300048905 | Ga0496102_0003268 | Ga0496102_0003268_4421_4825 | 115 |
| 120 | 3300048905 | Ga0496102_0435260 | Ga0496102_0435260_75_443 | 115 |
| 121 | 3300048906 | Ga0496103_0271045 | Ga0496103_0271045_366_734 | 115 |
| 122 | 3300048907 | Ga0496104_0103927 | Ga0496104_0103927_1971_2375 | 115 |
| 123 | 3300048908 | Ga0496105_0044527 | Ga0496105_0044527_2979_3383 | 115 |
| 124 | 3300048909 | Ga0496106_0000540 | Ga0496106_0000540_19488_19856 | 115 |
| 125 | 3300048909 | Ga0496106_0009950 | Ga0496106_0009950_709_1113 | 115 |
| 126 | 3300048910 | Ga0496107_0011065 | Ga0496107_0011065_3422_3826 | 115 |
| 127 | 3300048911 | Ga0496108_0245050 | Ga0496108_0245050_635_1003 | 115 |
| 128 | 3300048912 | Ga0496109_0032304 | Ga0496109_0032304_26_430 | 115 |
| 129 | 3300048914 | Ga0496111_0127620 | Ga0496111_0127620_278_682 | 115 |
| 130 | 3300048915 | Ga0496112_0151190 | Ga0496112_0151190_566_970 | 115 |
| 131 | 3300048916 | Ga0496113_0967565 | Ga0496113_0967565_186_590 | 115 |
| 132 | 3300048917 | Ga0496114_0026575 | Ga0496114_0026575_3137_3541 | 115 |
| 133 | 3300048918 | Ga0496115_0001335 | Ga0496115_0001335_12661_13065 | 115 |
| 134 | 3300048920 | Ga0496117_0133189 | Ga0496117_0133189_996_1364 | 115 |
| 135 | 3300048921 | Ga0496118_0006481 | Ga0496118_0006481_5111_5479 | 115 |
| 136 | 3300048922 | Ga0496119_0157482 | Ga0496119_0157482_315_683 | 115 |
| 137 | 3300048923 | Ga0496120_0059518 | Ga0496120_0059518_818_1186 | 115 |
| 138 | 3300048924 | Ga0496121_0000456 | Ga0496121_0000456_35126_35494 | 115 |
| 139 | 3300048927 | Ga0496124_0001010 | Ga0496124_0001010_640_1008 | 115 |
| 140 | 3300048928 | Ga0496125_0026319 | Ga0496125_0026319_4468_4836 | 115 |
| 141 | 3300048929 | Ga0496126_0010869 | Ga0496126_0010869_4321_4689 | 115 |
| 142 | 3300048929 | Ga0496126_0037772 | Ga0496126_0037772_2417_2791 | 115 |
| 143 | 3300048929 | Ga0496126_0458166 | Ga0496126_0458166_146_514 | 115 |
| 144 | 3300053080 | Ga0500635_0020115 | Ga0500635_0020115_999_1367 | 115 |
| 145 | 3300053097 | Ga0500648_283575 | Ga0500648_283575_89_457 | 115 |
| 146 | 3300053136 | Ga0500559_0082087 | Ga0500559_0082087_205_573 | 115 |
| 147 | 3300053140 | Ga0500573_0015719 | Ga0500573_0015719_1439_1807 | 115 |
| 148 | 3300053150 | Ga0500603_080706 | Ga0500603_080706_227_595 | 115 |
| 149 | 3300053163 | Ga0500639_190281 | Ga0500639_190281_227_595 | 115 |
| 150 | 3300053177 | Ga0500636_0066084 | Ga0500636_0066084_862_1230 | 115 |
| 151 | 3300053177 | Ga0500636_0342439 | Ga0500636_0342439_325_693 | 115 |
| 152 | 3300053178 | Ga0500637_0030575 | Ga0500637_0030575_2246_2614 | 115 |
| 153 | 3300053733 | Ga0500552_002880 | Ga0500552_002880_876_1244 | 115 |
| 154 | 3300053735 | Ga0500596_009222 | Ga0500596_009222_879_1247 | 115 |
| 155 | 3300053738 | Ga0500613_048832 | Ga0500613_048832_277_645 | 115 |
| 156 | 3300059477 | Ga0587084_071986 | Ga0587084_071986_38_442 | 115 |
| 157 | 3300005329 | Ga0070683_100703220 | Ga0070683_1007032202 | 116 |
| 158 | 3300005337 | Ga0070682_101101482 | Ga0070682_1011014821 | 116 |
| 159 | 3300005439 | Ga0070711_100348100 | Ga0070711_1003481002 | 116 |
| 160 | 3300005458 | Ga0070681_10011972 | Ga0070681_100119726 | 116 |
| 161 | 3300005467 | Ga0070706_100013118 | Ga0070706_1000131185 | 116 |
| 162 | 3300005471 | Ga0070698_100723160 | Ga0070698_1007231602 | 116 |
| 163 | 3300005536 | Ga0070697_100112753 | Ga0070697_1001127532 | 116 |
| 164 | 3300005937 | Ga0081455_10170677 | Ga0081455_101706774 | 116 |
| 165 | 3300006028 | Ga0070717_10782681 | Ga0070717_107826812 | 116 |
| 166 | 3300007265 | Ga0099794_10435761 | Ga0099794_104357612 | 116 |
| 167 | 3300009551 | Ga0105238_11937755 | Ga0105238_119377551 | 116 |
| 168 | 3300020078 | Ga0206352_10262384 | Ga0206352_102623842 | 116 |
| 169 | 3300021361 | Ga0213872_10078806 | Ga0213872_100788062 | 116 |
| 170 | 3300025906 | Ga0207699_11091749 | Ga0207699_110917491 | 116 |
| 171 | 3300025910 | Ga0207684_10018833 | Ga0207684_100188339 | 116 |
| 172 | 3300025912 | Ga0207707_10014023 | Ga0207707_100140232 | 116 |
| 173 | 3300025944 | Ga0207661_10591547 | Ga0207661_105915472 | 116 |
| 174 | 3300025949 | Ga0207667_10341231 | Ga0207667_103412313 | 116 |
| 175 | 3300039450 | Ga0436363_0699152 | Ga0436363_0699152_971_1345 | 116 |
| 176 | 3300039450 | Ga0436363_1453805 | Ga0436363_1453805_144_509 | 116 |
| 177 | 3300048915 | Ga0496112_0050747 | Ga0496112_0050747_25_399 | 116 |
| 178 | 3300049568 | Ga0501031_0492882 | Ga0501031_0492882_177_545 | 116 |
| 179 | 3300049569 | Ga0501032_0029893 | Ga0501032_0029893_2080_2448 | 116 |
| 180 | 3300049569 | Ga0501032_0234288 | Ga0501032_0234288_221_589 | 116 |
| 181 | 3300049570 | Ga0501033_0013873 | Ga0501033_0013873_4706_5074 | 116 |
| 182 | 3300049573 | Ga0501037_0008746 | Ga0501037_0008746_4759_5127 | 116 |
| 183 | 3300049574 | Ga0501038_0140923 | Ga0501038_0140923_1056_1424 | 116 |
| 184 | 3300049575 | Ga0501039_0101591 | Ga0501039_0101591_848_1216 | 116 |
| 185 | 3300049578 | Ga0501042_0291495 | Ga0501042_0291495_754_1122 | 116 |
| 186 | 3300049579 | Ga0501043_0070101 | Ga0501043_0070101_1468_1836 | 116 |
| 187 | 3300049580 | Ga0501046_0304009 | Ga0501046_0304009_466_834 | 116 |
| 188 | 3300049581 | Ga0501047_0055504 | Ga0501047_0055504_629_997 | 116 |
| 189 | 3300049582 | Ga0501048_0012334 | Ga0501048_0012334_5656_6024 | 116 |
| 190 | 3300049584 | Ga0501068_0125629 | Ga0501068_0125629_311_679 | 116 |
| 191 | 3300049586 | Ga0501070_0351878 | Ga0501070_0351878_425_793 | 116 |
| 192 | 3300049587 | Ga0501071_0108660 | Ga0501071_0108660_1132_1500 | 116 |
| 193 | 3300049588 | Ga0501072_0803976 | Ga0501072_0803976_228_596 | 116 |
| 194 | 3300049589 | Ga0501073_0342449 | Ga0501073_0342449_524_892 | 116 |
| 195 | 3300049590 | Ga0501074_0114738 | Ga0501074_0114738_282_650 | 116 |
| 196 | 3300049741 | Ga0501079_0189028 | Ga0501079_0189028_1042_1410 | 116 |
| 197 | 3300049742 | Ga0501080_0084317 | Ga0501080_0084317_446_814 | 116 |
| 198 | 3300049822 | Ga0501035_0079019 | Ga0501035_0079019_1295_1663 | 116 |
| 199 | 3300049822 | Ga0501035_0091301 | Ga0501035_0091301_478_846 | 116 |
| 200 | 3300049823 | Ga0501044_0110279 | Ga0501044_0110279_1594_1962 | 116 |
| 201 | 3300049823 | Ga0501044_0211670 | Ga0501044_0211670_1058_1426 | 116 |
| 202 | 3300049824 | Ga0501045_0117270 | Ga0501045_0117270_1281_1649 | 116 |
| 203 | 3300053091 | Ga0500647_0270311 | Ga0500647_0270311_141_512 | 116 |
| 204 | 3300053095 | Ga0500640_003151 | Ga0500640_003151_3649_4065 | 116 |
| 205 | 3300053111 | Ga0500572_000217 | Ga0500572_000217_9974_10390 | 116 |
| 206 | 3300053122 | Ga0500608_051766 | Ga0500608_051766_982_1398 | 116 |
| 207 | 3300053123 | Ga0500614_005804 | Ga0500614_005804_1327_1743 | 116 |
| 208 | 3300053136 | Ga0500559_0008734 | Ga0500559_0008734_3250_3666 | 116 |
| 209 | 3300053150 | Ga0500603_000507 | Ga0500603_000507_9387_9803 | 116 |
| 210 | 3300053159 | Ga0500630_000537 | Ga0500630_000537_2481_2897 | 116 |
| 211 | 3300053162 | Ga0500638_002399 | Ga0500638_002399_1060_1476 | 116 |
| 212 | 3300053163 | Ga0500639_000001 | Ga0500639_000001_9823_10239 | 116 |
| 213 | 3300053163 | Ga0500639_104097 | Ga0500639_104097_111_527 | 116 |
| 214 | 3300053163 | Ga0500639_119374 | Ga0500639_119374_655_1071 | 116 |
| 215 | 3300053728 | Ga0500657_252233 | Ga0500657_252233_67_483 | 116 |
| 216 | 3300053735 | Ga0500596_000054 | Ga0500596_000054_9347_9763 | 116 |
| 217 | 3300055283 | Ga0500661_017471 | Ga0500661_017471_27_398 | 116 |
| 218 | 3300059477 | Ga0587084_054078 | Ga0587084_054078_109_483 | 116 |
| 219 | 3300059478 | Ga0587093_048102 | Ga0587093_048102_231_605 | 116 |
| 220 | 3300059492 | Ga0587073_0109670 | Ga0587073_0109670_127_498 | 116 |
| 221 | 3300059493 | Ga0587077_102719 | Ga0587077_102719_78_452 | 116 |
| 222 | 3300059493 | Ga0587077_225442 | Ga0587077_225442_46_420 | 116 |
| 223 | 3300059504 | Ga0587082_096048 | Ga0587082_096048_30_401 | 116 |
| 224 | 3300059505 | Ga0587083_0058760 | Ga0587083_0058760_283_657 | 116 |
| 225 | 3300059506 | Ga0587085_064318 | Ga0587085_064318_241_615 | 116 |
| 226 | 3300059507 | Ga0587086_041316 | Ga0587086_041316_270_644 | 116 |
| 227 | 3300059508 | Ga0587088_093596 | Ga0587088_093596_34_405 | 116 |
| 228 | 3300059510 | Ga0587090_041629 | Ga0587090_041629_188_601 | 116 |
| 229 | 3300059511 | Ga0587091_085043 | Ga0587091_085043_102_476 | 116 |
| 230 | 3300059511 | Ga0587091_092412 | Ga0587091_092412_240_614 | 116 |
| 231 | 3300059513 | Ga0587094_031515 | Ga0587094_031515_270_644 | 116 |
| 232 | 3300059513 | Ga0587094_062714 | Ga0587094_062714_234_608 | 116 |
| 233 | 3300059514 | Ga0587095_020831 | Ga0587095_020831_231_605 | 116 |
| 234 | 3300059607 | Ga0587125_026775 | Ga0587125_026775_105_479 | 116 |
| 235 | 3300059623 | Ga0587101_053898 | Ga0587101_053898_214_585 | 116 |
| 236 | 3300059623 | Ga0587101_065572 | Ga0587101_065572_48_422 | 116 |
| 237 | 3300059624 | Ga0587109_207908 | Ga0587109_207908_118_492 | 116 |
| 238 | 3300059626 | Ga0587115_042178 | Ga0587115_042178_95_475 | 116 |
| 239 | 3300059629 | Ga0587127_019325 | Ga0587127_019325_32_403 | 116 |
| 240 | 3300059639 | Ga0587062_045782 | Ga0587062_045782_111_485 | 116 |
| 241 | 3300059641 | Ga0587068_066538 | Ga0587068_066538_230_604 | 116 |
| 242 | 3300059641 | Ga0587068_079191 | Ga0587068_079191_242_616 | 116 |
| 243 | 3300059642 | Ga0587069_055820 | Ga0587069_055820_102_476 | 116 |
| 244 | 3300059645 | Ga0587076_084357 | Ga0587076_084357_71_451 | 116 |
| 245 | 3300059647 | Ga0587079_050411 | Ga0587079_050411_259_633 | 116 |
| 246 | 3300059647 | Ga0587079_134131 | Ga0587079_134131_22_393 | 116 |
| 247 | 3300059647 | Ga0587079_144478 | Ga0587079_144478_214_594 | 116 |
| 248 | 3300059654 | Ga0587110_043554 | Ga0587110_043554_192_566 | 116 |
| 249 | 3300059660 | Ga0587124_012095 | Ga0587124_012095_182_556 | 116 |
| 250 | 3300060344 | Ga0587071_031911 | Ga0587071_031911_227_601 | 116 |
| 251 | 3300060346 | Ga0587111_0106677 | Ga0587111_0106677_238_618 | 116 |
| 252 | 3300060346 | Ga0587111_0112122 | Ga0587111_0112122_48_455 | 116 |
| 253 | 3300005548 | Ga0070665_100433818 | Ga0070665_1004338182 | 117 |
| 254 | 3300009545 | Ga0105237_10033600 | Ga0105237_100336006 | 117 |
| 255 | 3300009551 | Ga0105238_10003526 | Ga0105238_1000352611 | 117 |
| 256 | 3300013105 | Ga0157369_10732759 | Ga0157369_107327592 | 117 |
| 257 | 3300013296 | Ga0157374_10190296 | Ga0157374_101902962 | 117 |
| 258 | 3300013306 | Ga0163162_10232016 | Ga0163162_102320162 | 117 |
| 259 | 3300025929 | Ga0207664_11920109 | Ga0207664_119201091 | 117 |
| 260 | 3300025944 | Ga0207661_10650009 | Ga0207661_106500092 | 117 |
| 261 | 3300028379 | Ga0268266_10400089 | Ga0268266_104000892 | 117 |
| 262 | 3300039437 | Ga0436365_0994240 | Ga0436365_0994240_717_1100 | 117 |
| 263 | 3300048918 | Ga0496115_0211001 | Ga0496115_0211001_843_1217 | 117 |
| 264 | 3300059477 | Ga0587084_078600 | Ga0587084_078600_239_622 | 117 |
| 265 | 3300059477 | Ga0587084_104066 | Ga0587084_104066_151_534 | 117 |
| 266 | 3300059490 | Ga0587066_134447 | Ga0587066_134447_124_507 | 117 |
| 267 | 3300059491 | Ga0587070_074572 | Ga0587070_074572_114_497 | 117 |
| 268 | 3300059491 | Ga0587070_093125 | Ga0587070_093125_230_613 | 117 |
| 269 | 3300059492 | Ga0587073_0224013 | Ga0587073_0224013_36_419 | 117 |
| 270 | 3300059493 | Ga0587077_095298 | Ga0587077_095298_89_472 | 117 |
| 271 | 3300059503 | Ga0587080_076140 | Ga0587080_076140_59_442 | 117 |
| 272 | 3300059504 | Ga0587082_111056 | Ga0587082_111056_30_413 | 117 |
| 273 | 3300059508 | Ga0587088_110115 | Ga0587088_110115_189_614 | 117 |
| 274 | 3300059508 | Ga0587088_112016 | Ga0587088_112016_12_395 | 117 |
| 275 | 3300059513 | Ga0587094_046419 | Ga0587094_046419_190_615 | 117 |
| 276 | 3300059605 | Ga0587106_075782 | Ga0587106_075782_172_588 | 117 |
| 277 | 3300059623 | Ga0587101_020050 | Ga0587101_020050_336_719 | 117 |
| 278 | 3300059623 | Ga0587101_045682 | Ga0587101_045682_125_541 | 117 |
| 279 | 3300059624 | Ga0587109_170916 | Ga0587109_170916_126_509 | 117 |
| 280 | 3300059627 | Ga0587117_074480 | Ga0587117_074480_40_423 | 117 |
| 281 | 3300059639 | Ga0587062_041722 | Ga0587062_041722_147_521 | 117 |
| 282 | 3300059639 | Ga0587062_062424 | Ga0587062_062424_238_621 | 117 |
| 283 | 3300059640 | Ga0587067_048932 | Ga0587067_048932_231_614 | 117 |
| 284 | 3300059641 | Ga0587068_112594 | Ga0587068_112594_40_423 | 117 |
| 285 | 3300059642 | Ga0587069_073453 | Ga0587069_073453_37_420 | 117 |
| 286 | 3300059642 | Ga0587069_077778 | Ga0587069_077778_189_572 | 117 |
| 287 | 3300059644 | Ga0587075_047895 | Ga0587075_047895_239_622 | 117 |
| 288 | 3300059645 | Ga0587076_062879 | Ga0587076_062879_173_556 | 117 |
| 289 | 3300059645 | Ga0587076_099261 | Ga0587076_099261_187_612 | 117 |
| 290 | 3300059646 | Ga0587078_017655 | Ga0587078_017655_230_613 | 117 |
| 291 | 3300059646 | Ga0587078_038909 | Ga0587078_038909_54_470 | 117 |
| 292 | 3300059647 | Ga0587079_112734 | Ga0587079_112734_198_614 | 117 |
| 293 | 3300059648 | Ga0587100_006875 | Ga0587100_006875_265_648 | 117 |
| 294 | 3300059648 | Ga0587100_018176 | Ga0587100_018176_199_615 | 117 |
| 295 | 3300059652 | Ga0587107_077875 | Ga0587107_077875_222_605 | 117 |
| 296 | 3300059658 | Ga0587119_073084 | Ga0587119_073084_92_466 | 117 |
| 297 | 3300060346 | Ga0587111_0128620 | Ga0587111_0128620_45_428 | 117 |
| 298 | 3300003323 | rootH1_10201677 | rootH1_102016772 | 118 |
| 299 | 3300004800 | Ga0058861_10037956 | Ga0058861_100379562 | 118 |
| 300 | 3300005327 | Ga0070658_11262258 | Ga0070658_112622581 | 118 |
| 301 | 3300005329 | Ga0070683_100024847 | Ga0070683_1000248477 | 118 |
| 302 | 3300005329 | Ga0070683_100201833 | Ga0070683_1002018333 | 118 |
| 303 | 3300005336 | Ga0070680_100012602 | Ga0070680_1000126023 | 118 |
| 304 | 3300005337 | Ga0070682_100076497 | Ga0070682_1000764973 | 118 |
| 305 | 3300005341 | Ga0070691_10123850 | Ga0070691_101238502 | 118 |
| 306 | 3300005434 | Ga0070709_10004487 | Ga0070709_1000448711 | 118 |
| 307 | 3300005434 | Ga0070709_10159977 | Ga0070709_101599774 | 118 |
| 308 | 3300005435 | Ga0070714_100061575 | Ga0070714_1000615754 | 118 |
| 309 | 3300005436 | Ga0070713_100091479 | Ga0070713_1000914794 | 118 |
| 310 | 3300005437 | Ga0070710_10036825 | Ga0070710_100368253 | 118 |
| 311 | 3300005437 | Ga0070710_10699552 | Ga0070710_106995522 | 118 |
| 312 | 3300005455 | Ga0070663_100391067 | Ga0070663_1003910672 | 118 |
| 313 | 3300005458 | Ga0070681_10010590 | Ga0070681_100105905 | 118 |
| 314 | 3300005458 | Ga0070681_10080599 | Ga0070681_100805993 | 118 |
| 315 | 3300005530 | Ga0070679_100044917 | Ga0070679_1000449172 | 118 |
| 316 | 3300005530 | Ga0070679_100276174 | Ga0070679_1002761744 | 118 |
| 317 | 3300005535 | Ga0070684_100009632 | Ga0070684_1000096328 | 118 |
| 318 | 3300005535 | Ga0070684_100015331 | Ga0070684_1000153314 | 118 |
| 319 | 3300005539 | Ga0068853_100124531 | Ga0068853_1001245311 | 118 |
| 320 | 3300005539 | Ga0068853_100424239 | Ga0068853_1004242393 | 118 |
| 321 | 3300005563 | Ga0068855_100112704 | Ga0068855_1001127045 | 118 |
| 322 | 3300005563 | Ga0068855_100580630 | Ga0068855_1005806303 | 118 |
| 323 | 3300005563 | Ga0068855_101007445 | Ga0068855_1010074452 | 118 |
| 324 | 3300005577 | Ga0068857_100267634 | Ga0068857_1002676342 | 118 |
| 325 | 3300006028 | Ga0070717_10536467 | Ga0070717_105364672 | 118 |
| 326 | 3300006173 | Ga0070716_100557839 | Ga0070716_1005578391 | 118 |
| 327 | 3300006175 | Ga0070712_100186092 | Ga0070712_1001860922 | 118 |
| 328 | 3300009093 | Ga0105240_10058646 | Ga0105240_100586465 | 118 |
| 329 | 3300009093 | Ga0105240_10086231 | Ga0105240_100862314 | 118 |
| 330 | 3300009093 | Ga0105240_10135022 | Ga0105240_101350224 | 118 |
| 331 | 3300009093 | Ga0105240_10438394 | Ga0105240_104383943 | 118 |
| 332 | 3300009174 | Ga0105241_10212893 | Ga0105241_102128934 | 118 |
| 333 | 3300009545 | Ga0105237_10151993 | Ga0105237_101519933 | 118 |
| 334 | 3300009551 | Ga0105238_10164278 | Ga0105238_101642783 | 118 |
| 335 | 3300009551 | Ga0105238_10182046 | Ga0105238_101820463 | 118 |
| 336 | 3300009551 | Ga0105238_10562471 | Ga0105238_105624711 | 118 |
| 337 | 3300009551 | Ga0105238_10616998 | Ga0105238_106169981 | 118 |
| 338 | 3300010375 | Ga0105239_11277721 | Ga0105239_112777212 | 118 |
| 339 | 3300010375 | Ga0105239_11724320 | Ga0105239_117243202 | 118 |
| 340 | 3300013104 | Ga0157370_10216497 | Ga0157370_102164974 | 118 |
| 341 | 3300013105 | Ga0157369_10003890 | Ga0157369_1000389015 | 118 |
| 342 | 3300013105 | Ga0157369_10008785 | Ga0157369_100087853 | 118 |
| 343 | 3300013105 | Ga0157369_10161928 | Ga0157369_101619283 | 118 |
| 344 | 3300013307 | Ga0157372_10088837 | Ga0157372_100888373 | 118 |
| 345 | 3300013307 | Ga0157372_10339206 | Ga0157372_103392063 | 118 |
| 346 | 3300013307 | Ga0157372_11074550 | Ga0157372_110745501 | 118 |
| 347 | 3300020069 | Ga0197907_10871054 | Ga0197907_108710542 | 118 |
| 348 | 3300020070 | Ga0206356_11778877 | Ga0206356_117788772 | 118 |
| 349 | 3300020075 | Ga0206349_1644047 | Ga0206349_16440472 | 118 |
| 350 | 3300020076 | Ga0206355_1410402 | Ga0206355_14104022 | 118 |
| 351 | 3300020076 | Ga0206355_1624809 | Ga0206355_16248092 | 118 |
| 352 | 3300020078 | Ga0206352_10610341 | Ga0206352_106103412 | 118 |
| 353 | 3300020078 | Ga0206352_11309092 | Ga0206352_113090922 | 118 |
| 354 | 3300020080 | Ga0206350_10061001 | Ga0206350_100610012 | 118 |
| 355 | 3300020080 | Ga0206350_10790842 | Ga0206350_107908422 | 118 |
| 356 | 3300020082 | Ga0206353_11405000 | Ga0206353_114050001 | 118 |
| 357 | 3300020082 | Ga0206353_11805710 | Ga0206353_118057102 | 118 |
| 358 | 3300020610 | Ga0154015_1456180 | Ga0154015_14561802 | 118 |
| 359 | 3300021384 | Ga0213876_10047846 | Ga0213876_100478463 | 118 |
| 360 | 3300021388 | Ga0213875_10020039 | Ga0213875_100200394 | 118 |
| 361 | 3300021388 | Ga0213875_10086980 | Ga0213875_100869802 | 118 |
| 362 | 3300022467 | Ga0224712_10069896 | Ga0224712_100698962 | 118 |
| 363 | 3300022467 | Ga0224712_10192606 | Ga0224712_101926062 | 118 |
| 364 | 3300022467 | Ga0224712_10248629 | Ga0224712_102486292 | 118 |
| 365 | 3300025898 | Ga0207692_10369002 | Ga0207692_103690021 | 118 |
| 366 | 3300025898 | Ga0207692_10379631 | Ga0207692_103796312 | 118 |
| 367 | 3300025904 | Ga0207647_10153682 | Ga0207647_101536823 | 118 |
| 368 | 3300025911 | Ga0207654_10151251 | Ga0207654_101512513 | 118 |
| 369 | 3300025912 | Ga0207707_10002249 | Ga0207707_1000224913 | 118 |
| 370 | 3300025912 | Ga0207707_10087345 | Ga0207707_100873453 | 118 |
| 371 | 3300025913 | Ga0207695_10486341 | Ga0207695_104863412 | 118 |
| 372 | 3300025913 | Ga0207695_10761252 | Ga0207695_107612522 | 118 |
| 373 | 3300025914 | Ga0207671_10274769 | Ga0207671_102747691 | 118 |
| 374 | 3300025915 | Ga0207693_10122650 | Ga0207693_101226502 | 118 |
| 375 | 3300025916 | Ga0207663_10031022 | Ga0207663_100310224 | 118 |
| 376 | 3300025917 | Ga0207660_10026951 | Ga0207660_100269513 | 118 |
| 377 | 3300025917 | Ga0207660_10134631 | Ga0207660_101346313 | 118 |
| 378 | 3300025917 | Ga0207660_10750932 | Ga0207660_107509322 | 118 |
| 379 | 3300025917 | Ga0207660_11035386 | Ga0207660_110353861 | 118 |
| 380 | 3300025921 | Ga0207652_10065070 | Ga0207652_100650703 | 118 |
| 381 | 3300025921 | Ga0207652_10109024 | Ga0207652_101090241 | 118 |
| 382 | 3300025924 | Ga0207694_10389258 | Ga0207694_103892581 | 118 |
| 383 | 3300025928 | Ga0207700_10002433 | Ga0207700_100024333 | 118 |
| 384 | 3300025929 | Ga0207664_10045421 | Ga0207664_100454214 | 118 |
| 385 | 3300025939 | Ga0207665_10090439 | Ga0207665_100904393 | 118 |
| 386 | 3300025944 | Ga0207661_10000410 | Ga0207661_1000041028 | 118 |
| 387 | 3300025944 | Ga0207661_10073730 | Ga0207661_100737303 | 118 |
| 388 | 3300026041 | Ga0207639_10077431 | Ga0207639_100774314 | 118 |
| 389 | 3300026041 | Ga0207639_10148107 | Ga0207639_101481071 | 118 |
| 390 | 3300026067 | Ga0207678_10533579 | Ga0207678_105335791 | 118 |
| 391 | 3300026142 | Ga0207698_11259909 | Ga0207698_112599092 | 118 |
| 392 | 3300030863 | Ga0265766_1007200 | Ga0265766_10072001 | 118 |
| 393 | 3300035086 | Ga0373934_0064976 | Ga0373934_0064976_972_1349 | 118 |
| 394 | 3300035111 | Ga0373923_0090427 | Ga0373923_0090427_872_1249 | 118 |
| 395 | 3300035116 | Ga0373945_0356243 | Ga0373945_0356243_209_586 | 118 |
| 396 | 3300035117 | Ga0373953_0424396 | Ga0373953_0424396_108_485 | 118 |
| 397 | 3300035118 | Ga0373954_0043633 | Ga0373954_0043633_443_820 | 118 |
| 398 | 3300035171 | Ga0373946_0111443 | Ga0373946_0111443_776_1153 | 118 |
| 399 | 3300035172 | Ga0373955_0051784 | Ga0373955_0051784_220_597 | 118 |
| 400 | 3300035172 | Ga0373955_0305201 | Ga0373955_0305201_543_920 | 118 |
| 401 | 3300035410 | Ga0373924_0006062 | Ga0373924_0006062_2890_3267 | 118 |
| 402 | 3300035691 | Ga0373931_0868021 | Ga0373931_0868021_54_431 | 118 |
| 403 | 3300035692 | Ga0373935_0600935 | Ga0373935_0600935_101_478 | 118 |
| 404 | 3300035695 | Ga0373927_0163909 | Ga0373927_0163909_1001_1378 | 118 |
| 405 | 3300035724 | Ga0373933_0442975 | Ga0373933_0442975_321_698 | 118 |
| 406 | 3300035725 | Ga0373947_0199246 | Ga0373947_0199246_138_515 | 118 |
| 407 | 3300036401 | Ga0373937_0492596 | Ga0373937_0492596_428_805 | 118 |
| 408 | 3300037068 | Ga0373925_0072072 | Ga0373925_0072072_350_727 | 118 |
| 409 | 3300037418 | Ga0395900_0020777 | Ga0395900_0020777_5337_5714 | 118 |
| 410 | 3300037466 | Ga0395898_0107317 | Ga0395898_0107317_170_547 | 118 |
| 411 | 3300037853 | Ga0436364_1495700 | Ga0436364_1495700_1842_2219 | 118 |
| 412 | 3300037853 | Ga0436364_1521545 | Ga0436364_1521545_1770_2147 | 118 |
| 413 | 3300038443 | Ga0395901_0327193 | Ga0395901_0327193_468_854 | 118 |
| 414 | 3300039437 | Ga0436365_0937621 | Ga0436365_0937621_1357_1734 | 118 |
| 415 | 3300039438 | Ga0436360_0826250 | Ga0436360_0826250_678_1055 | 118 |
| 416 | 3300044656 | Ga0466969_0172347 | Ga0466969_0172347_24_401 | 118 |
| 417 | 3300044693 | Ga0466961_0371511 | Ga0466961_0371511_381_758 | 118 |
| 418 | 3300044719 | Ga0466971_0223486 | Ga0466971_0223486_395_772 | 118 |
| 419 | 3300046454 | Ga0495592_0543966 | Ga0495592_0543966_192_569 | 118 |
| 420 | 3300046455 | Ga0495603_0839436 | Ga0495603_0839436_117_494 | 118 |
| 421 | 3300046459 | Ga0495629_0129936 | Ga0495629_0129936_360_737 | 118 |
| 422 | 3300046473 | Ga0495582_0195270 | Ga0495582_0195270_66_443 | 118 |
| 423 | 3300046514 | Ga0495618_0169872 | Ga0495618_0169872_326_703 | 118 |
| 424 | 3300046529 | Ga0495652_0224894 | Ga0495652_0224894_282_659 | 118 |
| 425 | 3300046535 | Ga0495586_0371092 | Ga0495586_0371092_128_505 | 118 |
| 426 | 3300046536 | Ga0495587_0465796 | Ga0495587_0465796_282_659 | 118 |
| 427 | 3300046543 | Ga0495645_0012692 | Ga0495645_0012692_2141_2518 | 118 |
| 428 | 3300046642 | Ga0495634_0196553 | Ga0495634_0196553_152_529 | 118 |
| 429 | 3300046679 | Ga0495623_0200962 | Ga0495623_0200962_91_468 | 118 |
| 430 | 3300046680 | Ga0495646_0223644 | Ga0495646_0223644_152_529 | 118 |
| 431 | 3300046690 | Ga0495624_0094983 | Ga0495624_0094983_1172_1549 | 118 |
| 432 | 3300047315 | Ga0495581_0010155 | Ga0495581_0010155_4361_4738 | 118 |
| 433 | 3300047317 | Ga0495604_0395362 | Ga0495604_0395362_344_721 | 118 |
| 434 | 3300047319 | Ga0495674_0061625 | Ga0495674_0061625_1083_1460 | 118 |
| 435 | 3300047322 | Ga0495680_0320378 | Ga0495680_0320378_400_777 | 118 |
| 436 | 3300047471 | Ga0495684_0449145 | Ga0495684_0449145_286_663 | 118 |
| 437 | 3300048929 | Ga0496126_0035874 | Ga0496126_0035874_1153_1530 | 118 |
| 438 | 3300049569 | Ga0501032_0828201 | Ga0501032_0828201_11_388 | 118 |
| 439 | 3300049575 | Ga0501039_1598997 | Ga0501039_1598997_88_465 | 118 |
| 440 | 3300049580 | Ga0501046_0558530 | Ga0501046_0558530_416_793 | 118 |
| 441 | 3300049581 | Ga0501047_0006253 | Ga0501047_0006253_343_720 | 118 |
| 442 | 3300049586 | Ga0501070_0001323 | Ga0501070_0001323_5964_6341 | 118 |
| 443 | 3300049589 | Ga0501073_0066035 | Ga0501073_0066035_1834_2211 | 118 |
| 444 | 3300049590 | Ga0501074_0047876 | Ga0501074_0047876_174_584 | 118 |
| 445 | 3300049741 | Ga0501079_0931345 | Ga0501079_0931345_32_409 | 118 |
| 446 | 3300049742 | Ga0501080_0005584 | Ga0501080_0005584_6378_6755 | 118 |
| 447 | 3300049823 | Ga0501044_0025974 | Ga0501044_0025974_3589_3966 | 118 |
| 448 | 3300050514 | nmdc:mga08x19_1017769_c1 | nmdc:mga08x19_1017769_c1_155_532 | 118 |
| 449 | 3300053077 | Ga0495601_0121995 | Ga0495601_0121995_369_746 | 118 |
| 450 | 3300053078 | Ga0495612_0074345 | Ga0495612_0074345_411_788 | 118 |
| 451 | 3300053078 | Ga0495612_0219527 | Ga0495612_0219527_302_679 | 118 |
| 452 | 3300053085 | Ga0495619_0429725 | Ga0495619_0429725_126_503 | 118 |
| 453 | 3300059477 | Ga0587084_081479 | Ga0587084_081479_102_479 | 118 |
| 454 | 3300059491 | Ga0587070_087992 | Ga0587070_087992_82_459 | 118 |
| 455 | 3300059492 | Ga0587073_0136655 | Ga0587073_0136655_28_414 | 118 |
| 456 | 3300059493 | Ga0587077_038830 | Ga0587077_038830_241_618 | 118 |
| 457 | 3300059493 | Ga0587077_107595 | Ga0587077_107595_62_439 | 118 |
| 458 | 3300059504 | Ga0587082_067651 | Ga0587082_067651_230_616 | 118 |
| 459 | 3300059505 | Ga0587083_0108837 | Ga0587083_0108837_82_459 | 118 |
| 460 | 3300059505 | Ga0587083_0121966 | Ga0587083_0121966_54_482 | 118 |
| 461 | 3300059507 | Ga0587086_054685 | Ga0587086_054685_230_607 | 118 |
| 462 | 3300059510 | Ga0587090_037912 | Ga0587090_037912_238_615 | 118 |
| 463 | 3300059512 | Ga0587092_063300 | Ga0587092_063300_94_471 | 118 |
| 464 | 3300059623 | Ga0587101_019396 | Ga0587101_019396_238_624 | 118 |
| 465 | 3300059624 | Ga0587109_114947 | Ga0587109_114947_30_407 | 118 |
| 466 | 3300059627 | Ga0587117_051767 | Ga0587117_051767_132_518 | 118 |
| 467 | 3300059630 | Ga0587128_053608 | Ga0587128_053608_126_503 | 118 |
| 468 | 3300059630 | Ga0587128_085614 | Ga0587128_085614_65_451 | 118 |
| 469 | 3300059630 | Ga0587128_090632 | Ga0587128_090632_34_411 | 118 |
| 470 | 3300059639 | Ga0587062_060680 | Ga0587062_060680_215_601 | 118 |
| 471 | 3300059642 | Ga0587069_058545 | Ga0587069_058545_231_617 | 118 |
| 472 | 3300059643 | Ga0587072_094146 | Ga0587072_094146_232_618 | 118 |
| 473 | 3300059644 | Ga0587075_046875 | Ga0587075_046875_200_628 | 118 |
| 474 | 3300059644 | Ga0587075_052123 | Ga0587075_052123_214_591 | 118 |
| 475 | 3300059645 | Ga0587076_038044 | Ga0587076_038044_240_617 | 118 |
| 476 | 3300059645 | Ga0587076_062267 | Ga0587076_062267_229_606 | 118 |
| 477 | 3300059645 | Ga0587076_075824 | Ga0587076_075824_211_597 | 118 |
| 478 | 3300059646 | Ga0587078_028494 | Ga0587078_028494_130_507 | 118 |
| 479 | 3300059646 | Ga0587078_041935 | Ga0587078_041935_32_409 | 118 |
| 480 | 3300059648 | Ga0587100_015195 | Ga0587100_015195_106_492 | 118 |
| 481 | 3300059660 | Ga0587124_023362 | Ga0587124_023362_33_419 | 118 |
| 482 | 3300060344 | Ga0587071_033342 | Ga0587071_033342_181_609 | 118 |
| 483 | 3300060344 | Ga0587071_056039 | Ga0587071_056039_232_609 | 118 |
| 484 | 3300060344 | Ga0587071_075486 | Ga0587071_075486_130_507 | 118 |
| 485 | 3300060344 | Ga0587071_142972 | Ga0587071_142972_173_550 | 118 |
| 486 | 3300060346 | Ga0587111_0109278 | Ga0587111_0109278_232_609 | 118 |
| 487 | 3300061719 | Ga0466962_0238251 | Ga0466962_0238251_43_420 | 118 |
| 488 | 3300003320 | rootH2_10106806 | rootH2_101068064 | 119 |
| 489 | 3300005577 | Ga0068857_100217057 | Ga0068857_1002170572 | 119 |
| 490 | 3300009545 | Ga0105237_10071273 | Ga0105237_100712732 | 119 |
| 491 | 3300020070 | Ga0206356_11046210 | Ga0206356_110462101 | 119 |
| 492 | 3300025914 | Ga0207671_10025441 | Ga0207671_100254415 | 119 |
| 493 | 3300026116 | Ga0207674_10146657 | Ga0207674_101466574 | 119 |
| 494 | 3300035695 | Ga0373927_0277960 | Ga0373927_0277960_653_1033 | 119 |
| 495 | 3300044694 | Ga0466963_0044029 | Ga0466963_0044029_1117_1530 | 119 |
| 496 | 3300044842 | Ga0466957_1431624 | Ga0466957_1431624_70_450 | 119 |
| 497 | 3300048929 | Ga0496126_0021384 | Ga0496126_0021384_2924_3304 | 119 |
| 498 | 3300059477 | Ga0587084_066734 | Ga0587084_066734_50_430 | 119 |
| 499 | 3300059478 | Ga0587093_034508 | Ga0587093_034508_239_619 | 119 |
| 500 | 3300059492 | Ga0587073_0160695 | Ga0587073_0160695_38_418 | 119 |
| 501 | 3300059493 | Ga0587077_035721 | Ga0587077_035721_268_681 | 119 |
| 502 | 3300059503 | Ga0587080_091004 | Ga0587080_091004_238_618 | 119 |
| 503 | 3300059504 | Ga0587082_060978 | Ga0587082_060978_240_620 | 119 |
| 504 | 3300059505 | Ga0587083_0089912 | Ga0587083_0089912_239_619 | 119 |
| 505 | 3300059506 | Ga0587085_060059 | Ga0587085_060059_96_476 | 119 |
| 506 | 3300059507 | Ga0587086_046022 | Ga0587086_046022_96_476 | 119 |
| 507 | 3300059509 | Ga0587089_052859 | Ga0587089_052859_239_619 | 119 |
| 508 | 3300059510 | Ga0587090_069215 | Ga0587090_069215_236_616 | 119 |
| 509 | 3300059510 | Ga0587090_076392 | Ga0587090_076392_209_622 | 119 |
| 510 | 3300059510 | Ga0587090_081153 | Ga0587090_081153_227_607 | 119 |
| 511 | 3300059511 | Ga0587091_107501 | Ga0587091_107501_240_620 | 119 |
| 512 | 3300059511 | Ga0587091_123110 | Ga0587091_123110_17_406 | 119 |
| 513 | 3300059512 | Ga0587092_066066 | Ga0587092_066066_239_619 | 119 |
| 514 | 3300059604 | Ga0587098_043890 | Ga0587098_043890_234_614 | 119 |
| 515 | 3300059607 | Ga0587125_016778 | Ga0587125_016778_210_623 | 119 |
| 516 | 3300059623 | Ga0587101_017282 | Ga0587101_017282_377_757 | 119 |
| 517 | 3300059623 | Ga0587101_044907 | Ga0587101_044907_136_516 | 119 |
| 518 | 3300059624 | Ga0587109_042855 | Ga0587109_042855_282_662 | 119 |
| 519 | 3300059626 | Ga0587115_064286 | Ga0587115_064286_28_408 | 119 |
| 520 | 3300059626 | Ga0587115_094356 | Ga0587115_094356_79_459 | 119 |
| 521 | 3300059627 | Ga0587117_062129 | Ga0587117_062129_226_606 | 119 |
| 522 | 3300059630 | Ga0587128_067427 | Ga0587128_067427_75_455 | 119 |
| 523 | 3300059639 | Ga0587062_048139 | Ga0587062_048139_92_472 | 119 |
| 524 | 3300059641 | Ga0587068_067412 | Ga0587068_067412_239_619 | 119 |
| 525 | 3300059643 | Ga0587072_046549 | Ga0587072_046549_237_617 | 119 |
| 526 | 3300059644 | Ga0587075_038274 | Ga0587075_038274_181_561 | 119 |
| 527 | 3300059647 | Ga0587079_111768 | Ga0587079_111768_242_631 | 119 |
| 528 | 3300059647 | Ga0587079_154532 | Ga0587079_154532_166_546 | 119 |
| 529 | 3300059647 | Ga0587079_160676 | Ga0587079_160676_166_546 | 119 |
| 530 | 3300059648 | Ga0587100_019016 | Ga0587100_019016_234_614 | 119 |
| 531 | 3300059649 | Ga0587102_020847 | Ga0587102_020847_128_508 | 119 |
| 532 | 3300060344 | Ga0587071_091763 | Ga0587071_091763_77_457 | 119 |
| 533 | 3300031249 | Ga0265339_10005937 | Ga0265339_100059377 | 120 |
| 534 | 3300046460 | Ga0495638_0177726 | Ga0495638_0177726_125_487 | 120 |
| 535 | 3300047472 | Ga0495686_0256988 | Ga0495686_0256988_549_911 | 120 |
| 536 | 3300048913 | Ga0496110_0476009 | Ga0496110_0476009_565_957 | 120 |
| 537 | 3300048915 | Ga0496112_0168341 | Ga0496112_0168341_1332_1724 | 120 |
| 538 | 3300048920 | Ga0496117_0087639 | Ga0496117_0087639_370_732 | 120 |
| 539 | 3300048921 | Ga0496118_0161095 | Ga0496118_0161095_715_1077 | 120 |
| 540 | 3300048923 | Ga0496120_0238079 | Ga0496120_0238079_28_390 | 120 |
| 541 | 3300048924 | Ga0496121_0005356 | Ga0496121_0005356_8777_9139 | 120 |
| 542 | 3300048929 | Ga0496126_0112404 | Ga0496126_0112404_644_1006 | 120 |
| 543 | 3300053092 | Ga0500583_0204578 | Ga0500583_0204578_271_633 | 120 |
| 544 | 3300053093 | Ga0500651_0019749 | Ga0500651_0019749_1584_1946 | 120 |
| 545 | 3300053116 | Ga0500592_012679 | Ga0500592_012679_712_1074 | 120 |
| 546 | 3300053119 | Ga0500595_000324 | Ga0500595_000324_24267_24629 | 120 |
| 547 | 3300053119 | Ga0500595_008462 | Ga0500595_008462_3178_3540 | 120 |
| 548 | 3300053130 | Ga0500642_0267798 | Ga0500642_0267798_216_578 | 120 |
| 549 | 3300053139 | Ga0500568_0063633 | Ga0500568_0063633_966_1328 | 120 |
| 550 | 3300053156 | Ga0500622_0043989 | Ga0500622_0043989_1694_2056 | 120 |
| 551 | 3300053158 | Ga0500627_0051674 | Ga0500627_0051674_1362_1724 | 120 |
| 552 | 3300053731 | Ga0500609_010225 | Ga0500609_010225_306_668 | 120 |
| 553 | 3300059477 | Ga0587084_054184 | Ga0587084_054184_234_596 | 120 |
| 554 | 3300059512 | Ga0587092_063825 | Ga0587092_063825_234_626 | 120 |
| 555 | 3300059639 | Ga0587062_046038 | Ga0587062_046038_91_483 | 120 |
| 556 | 3300059645 | Ga0587076_069391 | Ga0587076_069391_116_502 | 120 |
| 557 | 3300005327 | Ga0070658_10055755 | Ga0070658_100557552 | 121 |
| 558 | 3300030863 | Ga0265766_1012464 | Ga0265766_10124642 | 121 |
| 559 | 3300046477 | Ga0495664_0769276 | Ga0495664_0769276_154_522 | 121 |
| 560 | 3300046559 | Ga0495667_0863218 | Ga0495667_0863218_20_388 | 121 |
| 561 | 3300053177 | Ga0500636_0005118 | Ga0500636_0005118_4439_4807 | 121 |
| 562 | 3300059511 | Ga0587091_132249 | Ga0587091_132249_22_390 | 121 |
| 563 | 3300060346 | Ga0587111_0100415 | Ga0587111_0100415_246_614 | 121 |
| 564 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003593 | 122 |
| 565 | 3300027361 | Ga0209489_100003 | Ga0209489_100003644 | 122 |
| 566 | 3300027363 | Ga0209700_100003 | Ga0209700_100003644 | 122 |
| 567 | 3300053724 | Ga0500570_114053 | Ga0500570_114053_675_1043 | 122 |
| 568 | 3300059623 | Ga0587101_088554 | Ga0587101_088554_71_442 | 123 |
| 569 | 3300059642 | Ga0587069_102436 | Ga0587069_102436_18_437 | 123 |
| 570 | 3300003203 | JGI25406J46586_10000104 | JGI25406J46586_1000010425 | 124 |
| 571 | 3300005985 | Ga0081539_10000273 | Ga0081539_10000273117 | 124 |
| 572 | 3300009551 | Ga0105238_10672549 | Ga0105238_106725493 | 124 |
| 573 | 3300025924 | Ga0207694_10574160 | Ga0207694_105741602 | 124 |
| 574 | 3300031456 | Ga0307513_10573714 | Ga0307513_105737142 | 124 |
| 575 | 3300046507 | Ga0495606_0008403 | Ga0495606_0008403_677_1051 | 124 |
| 576 | 3300048915 | Ga0496112_0000021 | Ga0496112_0000021_114947_115321 | 124 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6roc-assembly1.cif.gz_A | crystal structure of borrelia burgdorferi outer surface protein bba69, mutant leu214met (se-met data) | 0.3013 | 21 | 115 |
| 5ud6-assembly1.cif.gz_B | crystal structure of dhdps from cyanidioschyzon merolae with lysine bound | 0.2859 | 33 | 109 |
| 7qbd-assembly2.cif.gz_B | tc:cd320 in complex with nanobody tc-nb26 | 0.2653 | 34 | 122 |
| 3qc9-assembly2.cif.gz_C | crystal structure of cross-linked bovine grk1 t8c/n480c double mutant complexed with adp and mg | 0.2527 | 19 | 113 |
| 7sqc-assembly1.cif.gz_2L | ciliary c1 central pair apparatus isolated from chlamydomonas reinhardtii | 0.2504 | 4 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9Y149_1_73_1.10.246.20 | Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain | 0.6225 | 26 | 103 | 1.10.246.20 |
| af_Q9Y149_1_73_1.10.246.20 | Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain | 0.5874 | 26 | 103 | 1.10.246.20 |
| af_Q8IEE5_502_911_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.5859 | 22 | 63 | 3.40.50.300 |
| af_Q8II85_1121_1232_1.10.472.30 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain | 0.4704 | 25 | 101 | 1.10.472.30 |
| af_Q0WVQ3_63_166_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.4442 | 34 | 110 | 1.10.472.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5HZU4-F1-model_v4 | HdeA/HdeB family protein | 0.9767 | 29 | 123 |
|
| AF-A0A1I4NNI5-F1-model_v4 | deleted | 0.9032 | 25 | 121 |
|
| AF-M4Z9K7-F1-model_v4 | Uncharacterized protein | 0.8992 | 45 | 121 |
|
| AF-M4Z9K7-F1-model_v4 | Uncharacterized protein | 0.8882 | 45 | 121 |
|
| AF-A0A370R703-F1-model_v4 | deleted | 0.8802 | 19 | 121 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar