F465504

General Info

Members Datasets Scaffolds Average Seq Length
576 313 574 125

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10562471|Ga0105238_105624711
Length 141
Sequence LPRVEAESVKVACKAIMFLRICAAGVVSILALNQSAHAQASLQMRAAMHLSDPRSEFVRQCAPHMLGRWAHPEEVCGCLHDHAAAVVDDTDLRLALLRGISETGVPTIENGWVPASKQSEIGPTFTKIAKPTLQCMFEPAK

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
110 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
111 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
145 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
146 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
147 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
158 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
241 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
244 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
245 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
246 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
247 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
254 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
257 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
258 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
259 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
260 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
261 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
262 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
263 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
264 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
265 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
266 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
267 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere
268 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
269 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.53
Metatranscriptomes 32.12
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.77
Nodule 0.87
Rhizoplane 3.99
Rhizosphere 80.21
Stem 0
Stem Tuber 0
Unclassified 8.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000104 3300003203 Bacteria 37774
2 rootH2_10106806 3300003320 Bacteria 3198
3 rootH1_10201677 3300003323 Bacteria 2090
4 Ga0058861_10037956 3300004800 Bacteria 801
5 Ga0070658_10055755 3300005327 Bacteria 3211
6 Ga0070658_11262258 3300005327 Bacteria 642
7 Ga0070683_100024847 3300005329 Bacteria 5372
8 Ga0070683_100201833 3300005329 Bacteria 1888
9 Ga0070683_100703220 3300005329 Bacteria 968
10 Ga0068869_101134631 3300005334 Bacteria 685
11 Ga0070680_100012602 3300005336 Bacteria 6573
12 Ga0070682_100076497 3300005337 Bacteria 2155
13 Ga0070682_100142354 3300005337 Bacteria 1636
14 Ga0070682_101101482 3300005337 Bacteria 665
15 Ga0068868_100028867 3300005338 Bacteria 4246
16 Ga0068868_100655689 3300005338 Bacteria 935
17 Ga0070691_10123850 3300005341 Bacteria 1304
18 Ga0070661_100415203 3300005344 Bacteria 1066
19 Ga0070671_100429000 3300005355 Bacteria 1133
20 Ga0070673_101845832 3300005364 Bacteria 573
21 Ga0070709_10004487 3300005434 Bacteria 7531
22 Ga0070709_10013858 3300005434 Bacteria 4545
23 Ga0070709_10159977 3300005434 Bacteria 1565
24 Ga0070714_100061575 3300005435 Bacteria 3224
25 Ga0070714_100223687 3300005435 Bacteria 1731
26 Ga0070713_100039476 3300005436 Bacteria 3832
27 Ga0070713_100066052 3300005436 Bacteria 3041
28 Ga0070713_100091479 3300005436 Bacteria 2617
29 Ga0070710_10036825 3300005437 Bacteria 2677
30 Ga0070710_10077714 3300005437 Bacteria 1930
31 Ga0070710_10699552 3300005437 Bacteria 715
32 Ga0070711_100094825 3300005439 Bacteria 2158
33 Ga0070711_100348100 3300005439 Bacteria 1191
34 Ga0070663_100009083 3300005455 Bacteria 6142
35 Ga0070663_100391067 3300005455 Bacteria 1135
36 Ga0070681_10010590 3300005458 Bacteria 9110
37 Ga0070681_10011972 3300005458 Bacteria 8602
38 Ga0070681_10080599 3300005458 Bacteria 3211
39 Ga0070706_100013118 3300005467 Bacteria 7665
40 Ga0070706_100993100 3300005467 Bacteria 774
41 Ga0070698_100723160 3300005471 Bacteria 938
42 Ga0070679_100044917 3300005530 Bacteria 4402
43 Ga0070679_100276174 3300005530 Bacteria 1633
44 Ga0070684_100009632 3300005535 Bacteria 7616
45 Ga0070684_100015331 3300005535 Bacteria 6238
46 Ga0070697_100112753 3300005536 Bacteria 2268
47 Ga0068853_100124531 3300005539 Bacteria 2302
48 Ga0068853_100244002 3300005539 Bacteria 1647
49 Ga0068853_100424239 3300005539 Bacteria 1247
50 Ga0070665_100092705 3300005548 Bacteria 3025
51 Ga0070665_100433818 3300005548 Bacteria 1323
52 Ga0068855_100112704 3300005563 Bacteria 3121
53 Ga0068855_100580630 3300005563 Bacteria 1211
54 Ga0068855_101007445 3300005563 Bacteria 875
55 Ga0068857_100217057 3300005577 Bacteria 1746
56 Ga0068857_100267634 3300005577 Bacteria 1570
57 Ga0068856_100645486 3300005614 Bacteria 1079
58 Ga0068864_100189462 3300005618 Bacteria 1885
59 Ga0068864_100690266 3300005618 Bacteria 997
60 Ga0068864_101459534 3300005618 Bacteria 687
61 Ga0068851_10045953 3300005834 Bacteria 2208
62 Ga0068863_100153114 3300005841 Bacteria 2207
63 Ga0068863_101009584 3300005841 Bacteria 835
64 Ga0068858_100221497 3300005842 Bacteria 1792
65 Ga0068860_100000058 3300005843 Bacteria 197181
66 Ga0081455_10170677 3300005937 Bacteria 1657
67 Ga0081540_1277834 3300005983 Bacteria 578
68 Ga0081539_10000273 3300005985 Bacteria 117936
69 Ga0070717_10002555 3300006028 Bacteria 12833
70 Ga0070717_10110607 3300006028 Bacteria 2343
71 Ga0070717_10348221 3300006028 Bacteria 1324
72 Ga0070717_10536467 3300006028 Bacteria 1059
73 Ga0070717_10782681 3300006028 Bacteria 868
74 Ga0070716_100007220 3300006173 Bacteria 5464
75 Ga0070716_100557839 3300006173 Bacteria 855
76 Ga0070712_100032824 3300006175 Bacteria 3508
77 Ga0070712_100186092 3300006175 Bacteria 1621
78 Ga0068871_100337213 3300006358 Bacteria 1331
79 Ga0068871_100379250 3300006358 Bacteria 1256
80 Ga0099794_10435761 3300007265 Bacteria 686
81 Ga0105240_10058646 3300009093 Bacteria 4806
82 Ga0105240_10086231 3300009093 Bacteria 3845
83 Ga0105240_10135022 3300009093 Bacteria 2955
84 Ga0105240_10438394 3300009093 Bacteria 1464
85 Ga0105245_10080528 3300009098 Bacteria 2975
86 Ga0105247_10015905 3300009101 Bacteria 4505
87 Ga0105247_10101798 3300009101 Bacteria 1837
88 Ga0105247_10278113 3300009101 Bacteria 1154
89 Ga0105241_10212893 3300009174 Bacteria 1620
90 Ga0105242_10508321 3300009176 Bacteria 1147
91 Ga0105237_10005643 3300009545 Bacteria 14090
92 Ga0105237_10033600 3300009545 Bacteria 5197
93 Ga0105237_10071273 3300009545 Bacteria 3470
94 Ga0105237_10151993 3300009545 Bacteria 2311
95 Ga0105238_10003526 3300009551 Bacteria 15592
96 Ga0105238_10164278 3300009551 Bacteria 2196
97 Ga0105238_10182046 3300009551 Bacteria 2078
98 Ga0105238_10562471 3300009551 Bacteria 1145
99 Ga0105238_10616998 3300009551 Bacteria 1093
100 Ga0105238_10672549 3300009551 Bacteria 1046
101 Ga0105238_11937755 3300009551 Bacteria 622
102 Ga0105239_10018730 3300010375 Bacteria 7648
103 Ga0105239_10257495 3300010375 Bacteria 1961
104 Ga0105239_11277721 3300010375 Bacteria 846
105 Ga0105239_11724320 3300010375 Bacteria 725
106 Ga0105246_10016910 3300011119 Bacteria 4628
107 Ga0105246_10341466 3300011119 Bacteria 1224
108 Ga0157370_10216497 3300013104 Bacteria 1775
109 Ga0157369_10003890 3300013105 Bacteria 17720
110 Ga0157369_10008785 3300013105 Bacteria 11576
111 Ga0157369_10161928 3300013105 Bacteria 2362
112 Ga0157369_10732759 3300013105 Bacteria 1017
113 Ga0157374_10190296 3300013296 Bacteria 2007
114 Ga0157374_10912966 3300013296 Bacteria 896
115 Ga0163162_10003676 3300013306 Bacteria 14707
116 Ga0163162_10232016 3300013306 Bacteria 1976
117 Ga0157372_10088837 3300013307 Bacteria 3510
118 Ga0157372_10339206 3300013307 Bacteria 1750
119 Ga0157372_11074550 3300013307 Bacteria 931
120 Ga0157375_10152257 3300013308 Bacteria 2449
121 Ga0163163_10028298 3300014325 Bacteria 5379
122 Ga0157377_10066376 3300014745 Bacteria 2074
123 Ga0157376_10093596 3300014969 Bacteria 2609
124 Ga0197907_10871054 3300020069 Bacteria 776
125 Ga0206356_11046210 3300020070 Bacteria 625
126 Ga0206356_11778877 3300020070 Bacteria 699
127 Ga0206349_1644047 3300020075 Bacteria 776
128 Ga0206355_1410402 3300020076 Bacteria 2023
129 Ga0206355_1624809 3300020076 Bacteria 1061
130 Ga0206352_10262384 3300020078 Bacteria 883
131 Ga0206352_10610341 3300020078 Bacteria 892
132 Ga0206352_11309092 3300020078 Bacteria 651
133 Ga0206350_10061001 3300020080 Bacteria 1127
134 Ga0206350_10790842 3300020080 Bacteria 649
135 Ga0206353_11405000 3300020082 Bacteria 713
136 Ga0206353_11805710 3300020082 Bacteria 1020
137 Ga0154015_1456180 3300020610 Bacteria 759
138 Ga0213872_10078806 3300021361 Bacteria 1481
139 Ga0213876_10047846 3300021384 Bacteria 2261
140 Ga0213875_10020039 3300021388 Bacteria 3211
141 Ga0213875_10086980 3300021388 Bacteria 1458
142 Ga0224712_10069896 3300022467 Bacteria 1422
143 Ga0224712_10192606 3300022467 Bacteria 923
144 Ga0224712_10248629 3300022467 Bacteria 821
145 Ga0247551_105764 3300023552 Bacteria 520
146 Ga0207697_10371254 3300025315 Bacteria 635
147 Ga0207692_10073593 3300025898 Bacteria 1808
148 Ga0207692_10369002 3300025898 Bacteria 888
149 Ga0207692_10379631 3300025898 Bacteria 877
150 Ga0207710_10152399 3300025900 Bacteria 1122
151 Ga0207710_10203766 3300025900 Bacteria 978
152 Ga0207647_10153682 3300025904 Bacteria 1344
153 Ga0207699_10148910 3300025906 Bacteria 1546
154 Ga0207699_11091749 3300025906 Bacteria 591
155 Ga0207684_10018833 3300025910 Bacteria 5906
156 Ga0207654_10151251 3300025911 Bacteria 1490
157 Ga0207707_10002249 3300025912 Bacteria 17455
158 Ga0207707_10014023 3300025912 Bacteria 6986
159 Ga0207707_10087345 3300025912 Bacteria 2725
160 Ga0207695_10486341 3300025913 Bacteria 1116
161 Ga0207695_10761252 3300025913 Bacteria 849
162 Ga0207671_10025441 3300025914 Bacteria 4446
163 Ga0207671_10274769 3300025914 Bacteria 1328
164 Ga0207693_10011177 3300025915 Bacteria 7268
165 Ga0207693_10122650 3300025915 Bacteria 2041
166 Ga0207663_10031022 3300025916 Bacteria 3158
167 Ga0207663_10080161 3300025916 Bacteria 2134
168 Ga0207660_10026951 3300025917 Bacteria 3917
169 Ga0207660_10134631 3300025917 Bacteria 1884
170 Ga0207660_10750932 3300025917 Bacteria 796
171 Ga0207660_11035386 3300025917 Bacteria 669
172 Ga0207652_10065070 3300025921 Bacteria 3156
173 Ga0207652_10109024 3300025921 Bacteria 2454
174 Ga0207694_10389258 3300025924 Bacteria 1158
175 Ga0207694_10574160 3300025924 Bacteria 947
176 Ga0207687_10061452 3300025927 Bacteria 2653
177 Ga0207700_10002433 3300025928 Bacteria 10681
178 Ga0207700_10012557 3300025928 Bacteria 5470
179 Ga0207664_10045421 3300025929 Bacteria 3445
180 Ga0207664_10428241 3300025929 Bacteria 1179
181 Ga0207664_11920109 3300025929 Bacteria 515
182 Ga0207665_10090439 3300025939 Bacteria 2121
183 Ga0207665_10108900 3300025939 Bacteria 1944
184 Ga0207661_10000410 3300025944 Bacteria 27651
185 Ga0207661_10073730 3300025944 Bacteria 2796
186 Ga0207661_10591547 3300025944 Bacteria 1018
187 Ga0207661_10650009 3300025944 Bacteria 969
188 Ga0207667_10341231 3300025949 Bacteria 1529
189 Ga0207651_11673379 3300025960 Bacteria 573
190 Ga0207677_10150309 3300026023 Bacteria 1796
191 Ga0207639_10077431 3300026041 Bacteria 2622
192 Ga0207639_10148107 3300026041 Bacteria 1963
193 Ga0207639_10979900 3300026041 Bacteria 791
194 Ga0207678_10014210 3300026067 Bacteria 7000
195 Ga0207678_10533579 3300026067 Bacteria 1025
196 Ga0207702_10591447 3300026078 Bacteria 1088
197 Ga0207641_10658828 3300026088 Bacteria 1029
198 Ga0207641_11653430 3300026088 Bacteria 642
199 Ga0207676_10738202 3300026095 Bacteria 957
200 Ga0207674_10146657 3300026116 Bacteria 2318
201 Ga0207683_10016693 3300026121 Bacteria 6247
202 Ga0207698_10027117 3300026142 Bacteria 4063
203 Ga0207698_11259909 3300026142 Bacteria 754
204 Ga0209589_1000003 3300027357 Bacteria 629130
205 Ga0209489_100003 3300027361 Bacteria 663105
206 Ga0209700_100003 3300027363 Bacteria 663105
207 Ga0268266_10400089 3300028379 Bacteria 1298
208 Ga0268264_10000022 3300028381 Bacteria 476624
209 Ga0307511_10049805 3300030521 Bacteria 3383
210 Ga0265763_1018645 3300030763 Bacteria 713
211 Ga0265763_1048242 3300030763 Bacteria 530
212 Ga0265766_1007200 3300030863 Bacteria 743
213 Ga0265766_1012464 3300030863 Bacteria 628
214 Ga0265772_103947 3300030886 Bacteria 627
215 Ga0265769_110484 3300030888 Bacteria 635
216 Ga0265768_109348 3300030963 Bacteria 619
217 Ga0265768_109393 3300030963 Bacteria 618
218 Ga0265773_1026313 3300031018 Bacteria 602
219 Ga0265339_10005937 3300031249 Bacteria 8076
220 Ga0307513_10573714 3300031456 Bacteria 839
221 Ga0307509_10038177 3300031507 Bacteria 5241
222 Ga0307509_10510023 3300031507 Bacteria 885
223 Ga0310114_117475 3300031678 Bacteria 655
224 Ga0307516_10109129 3300031730 Bacteria 2573
225 Ga0307516_10147601 3300031730 Bacteria 2116
226 Ga0307516_10421154 3300031730 Bacteria 993
227 Ga0307507_10035312 3300033179 Bacteria 5138
228 Ga0373926_0408073 3300035083 Bacteria 537
229 Ga0373934_0064976 3300035086 Bacteria 1457
230 Ga0373940_0203879 3300035088 Bacteria 651
231 Ga0373923_0090427 3300035111 Bacteria 1338
232 Ga0373945_0356243 3300035116 Bacteria 635
233 Ga0373953_0424396 3300035117 Bacteria 586
234 Ga0373954_0043633 3300035118 Bacteria 2091
235 Ga0373946_0111443 3300035171 Bacteria 1239
236 Ga0373955_0051784 3300035172 Bacteria 2237
237 Ga0373955_0305201 3300035172 Bacteria 960
238 Ga0373924_0006062 3300035410 Bacteria 4316
239 Ga0373931_0868021 3300035691 Bacteria 605
240 Ga0373935_0600935 3300035692 Bacteria 804
241 Ga0373927_0007540 3300035695 Bacteria 7359
242 Ga0373927_0163909 3300035695 Bacteria 1456
243 Ga0373927_0277960 3300035695 Bacteria 1101
244 Ga0373933_0000041 3300035724 Bacteria 79805
245 Ga0373933_0318215 3300035724 Bacteria 1009
246 Ga0373933_0442975 3300035724 Bacteria 849
247 Ga0373947_0161160 3300035725 Bacteria 1451
248 Ga0373947_0199246 3300035725 Bacteria 1309
249 Ga0310104_05991 3300036242 Bacteria 1036
250 Ga0310104_15421 3300036242 Bacteria 592
251 Ga0373937_0492596 3300036401 Bacteria 1164
252 Ga0310112_036241 3300036458 Bacteria 673
253 Ga0310112_037313 3300036458 Bacteria 662
254 Ga0372808_017927 3300036459 Bacteria 1017
255 Ga0310109_029386 3300036534 Bacteria 730
256 Ga0310109_030007 3300036534 Bacteria 722
257 Ga0310110_015967 3300036535 Bacteria 1070
258 Ga0373925_0072072 3300037068 Bacteria 2613
259 Ga0373925_0206849 3300037068 Bacteria 1562
260 Ga0395900_0020777 3300037418 Bacteria 6712
261 Ga0395898_0107317 3300037466 Bacteria 2678
262 Ga0436364_1495700 3300037853 Bacteria 2645
263 Ga0436364_1521545 3300037853 Bacteria 4218
264 Ga0395901_0327193 3300038443 Bacteria 1585
265 Ga0436365_0937621 3300039437 Bacteria 2451
266 Ga0436365_0994240 3300039437 Bacteria 1735
267 Ga0436360_0778394 3300039438 Bacteria 1874
268 Ga0436360_0826250 3300039438 Bacteria 1115
269 Ga0436360_1084860 3300039438 Bacteria 1571
270 Ga0436361_1037124 3300039447 Bacteria 3314
271 Ga0436361_1097065 3300039447 Bacteria 4911
272 Ga0436363_0699152 3300039450 Bacteria 2726
273 Ga0436363_1453805 3300039450 Bacteria 578
274 Ga0451795_1523835 3300041456 Bacteria 504
275 Ga0451849_1386904 3300041505 Bacteria 525
276 Ga0451853_0423507 3300041512 Bacteria 987
277 Ga0466969_0172347 3300044656 Bacteria 992
278 Ga0466961_0371511 3300044693 Bacteria 869
279 Ga0466963_0044029 3300044694 Bacteria 2937
280 Ga0466971_0223486 3300044719 Bacteria 893
281 Ga0466957_1431624 3300044842 Bacteria 503
282 Ga0495592_0543966 3300046454 Bacteria 715
283 Ga0495603_0323053 3300046455 Bacteria 886
284 Ga0495603_0839436 3300046455 Bacteria 523
285 Ga0495629_0129936 3300046459 Bacteria 1755
286 Ga0495638_0177726 3300046460 Bacteria 1217
287 Ga0495582_0195270 3300046473 Bacteria 1155
288 Ga0495664_0769276 3300046477 Bacteria 567
289 Ga0495606_0008403 3300046507 Bacteria 8979
290 Ga0495618_0169872 3300046514 Bacteria 1388
291 Ga0495652_0224894 3300046529 Bacteria 1408
292 Ga0495586_0371092 3300046535 Bacteria 823
293 Ga0495587_0465796 3300046536 Bacteria 700
294 Ga0495645_0012692 3300046543 Bacteria 5942
295 Ga0495622_0028887 3300046557 Bacteria 2591
296 Ga0495667_0863218 3300046559 Bacteria 556
297 Ga0495634_0196553 3300046642 Bacteria 1255
298 Ga0495623_0200962 3300046679 Bacteria 1146
299 Ga0495646_0223644 3300046680 Bacteria 1017
300 Ga0495624_0094983 3300046690 Bacteria 1838
301 Ga0495581_0010155 3300047315 Bacteria 5448
302 Ga0495604_0395362 3300047317 Bacteria 911
303 Ga0495674_0061625 3300047319 Bacteria 3268
304 Ga0495680_0320378 3300047322 Bacteria 1085
305 Ga0495680_0997686 3300047322 Bacteria 535
306 Ga0495684_0449145 3300047471 Bacteria 896
307 Ga0495686_0256988 3300047472 Bacteria 979
308 Ga0496100_0018770 3300048903 Bacteria 4111
309 Ga0496101_0032308 3300048904 Bacteria 3683
310 Ga0496102_0003268 3300048905 Bacteria 13736
311 Ga0496102_0435260 3300048905 Bacteria 1231
312 Ga0496103_0271045 3300048906 Bacteria 1092
313 Ga0496104_0103927 3300048907 Bacteria 2721
314 Ga0496105_0044527 3300048908 Bacteria 3660
315 Ga0496106_0000540 3300048909 Bacteria 26830
316 Ga0496106_0009950 3300048909 Bacteria 7019
317 Ga0496107_0011065 3300048910 Bacteria 6277
318 Ga0496108_0245050 3300048911 Bacteria 1559
319 Ga0496109_0032304 3300048912 Bacteria 4705
320 Ga0496110_0476009 3300048913 Bacteria 1138
321 Ga0496111_0127620 3300048914 Bacteria 1881
322 Ga0496112_0000021 3300048915 Bacteria 156561
323 Ga0496112_0050747 3300048915 Bacteria 4069
324 Ga0496112_0151190 3300048915 Bacteria 2288
325 Ga0496112_0168341 3300048915 Bacteria 2157
326 Ga0496113_0967565 3300048916 Bacteria 671
327 Ga0496114_0026575 3300048917 Bacteria 4740
328 Ga0496115_0001335 3300048918 Bacteria 17580
329 Ga0496115_0211001 3300048918 Bacteria 1604
330 Ga0496117_0087639 3300048920 Bacteria 2017
331 Ga0496117_0133189 3300048920 Bacteria 1502
332 Ga0496118_0006481 3300048921 Bacteria 12851
333 Ga0496118_0161095 3300048921 Bacteria 1387
334 Ga0496119_0157482 3300048922 Bacteria 1211
335 Ga0496120_0059518 3300048923 Bacteria 2141
336 Ga0496120_0238079 3300048923 Bacteria 861
337 Ga0496121_0000456 3300048924 Bacteria 80536
338 Ga0496121_0005356 3300048924 Bacteria 16491
339 Ga0496124_0001010 3300048927 Bacteria 44569
340 Ga0496125_0026319 3300048928 Bacteria 5305
341 Ga0496126_0010869 3300048929 Bacteria 9486
342 Ga0496126_0021384 3300048929 Bacteria 6318
343 Ga0496126_0035874 3300048929 Bacteria 4642
344 Ga0496126_0037772 3300048929 Bacteria 4502
345 Ga0496126_0112404 3300048929 Bacteria 2371
346 Ga0496126_0458166 3300048929 Bacteria 1025
347 Ga0501031_0492882 3300049568 Bacteria 790
348 Ga0501032_0029893 3300049569 Bacteria 3737
349 Ga0501032_0234288 3300049569 Bacteria 1193
350 Ga0501032_0828201 3300049569 Bacteria 584
351 Ga0501033_0013873 3300049570 Bacteria 6131
352 Ga0501037_0008746 3300049573 Bacteria 7421
353 Ga0501038_0140923 3300049574 Bacteria 1972
354 Ga0501039_0101591 3300049575 Bacteria 2244
355 Ga0501039_1598997 3300049575 Bacteria 500
356 Ga0501042_0291495 3300049578 Bacteria 1179
357 Ga0501043_0070101 3300049579 Bacteria 2753
358 Ga0501046_0304009 3300049580 Bacteria 1164
359 Ga0501046_0558530 3300049580 Bacteria 815
360 Ga0501047_0006253 3300049581 Bacteria 11198
361 Ga0501047_0055504 3300049581 Bacteria 3830
362 Ga0501048_0012334 3300049582 Bacteria 6359
363 Ga0501068_0125629 3300049584 Bacteria 1602
364 Ga0501070_0001323 3300049586 Bacteria 22154
365 Ga0501070_0351878 3300049586 Bacteria 1195
366 Ga0501071_0108660 3300049587 Bacteria 2049
367 Ga0501072_0803976 3300049588 Bacteria 736
368 Ga0501073_0066035 3300049589 Bacteria 2522
369 Ga0501073_0342449 3300049589 Bacteria 1032
370 Ga0501074_0047876 3300049590 Bacteria 3089
371 Ga0501074_0114738 3300049590 Bacteria 1927
372 Ga0501079_0189028 3300049741 Bacteria 1607
373 Ga0501079_0931345 3300049741 Bacteria 684
374 Ga0501080_0005584 3300049742 Bacteria 11238
375 Ga0501080_0084317 3300049742 Bacteria 2952
376 Ga0501035_0079019 3300049822 Bacteria 2906
377 Ga0501035_0091301 3300049822 Bacteria 2680
378 Ga0501044_0025974 3300049823 Bacteria 6204
379 Ga0501044_0110279 3300049823 Bacteria 2760
380 Ga0501044_0211670 3300049823 Bacteria 1892
381 Ga0501045_0117270 3300049824 Bacteria 1976
382 nmdc:mga08x19_1017769_c1 3300050514 Bacteria 588
383 Ga0495601_0121995 3300053077 Bacteria 1693
384 Ga0495612_0074345 3300053078 Bacteria 1421
385 Ga0495612_0219527 3300053078 Bacteria 841
386 Ga0500635_0020115 3300053080 Bacteria 2040
387 Ga0495619_0429725 3300053085 Bacteria 911
388 Ga0500647_0270311 3300053091 Bacteria 739
389 Ga0500583_0204578 3300053092 Bacteria 981
390 Ga0500651_0019749 3300053093 Bacteria 4191
391 Ga0500640_003151 3300053095 Bacteria 5670
392 Ga0500648_283575 3300053097 Bacteria 744
393 Ga0500572_000217 3300053111 Bacteria 20413
394 Ga0500592_012679 3300053116 Bacteria 1349
395 Ga0500595_000324 3300053119 Bacteria 31413
396 Ga0500595_008462 3300053119 Bacteria 4199
397 Ga0500608_051766 3300053122 Bacteria 1972
398 Ga0500614_005804 3300053123 Bacteria 2593
399 Ga0500642_0267798 3300053130 Bacteria 780
400 Ga0500559_0008734 3300053136 Bacteria 4420
401 Ga0500559_0082087 3300053136 Bacteria 1467
402 Ga0500568_0063633 3300053139 Bacteria 1423
403 Ga0500573_0015719 3300053140 Bacteria 4293
404 Ga0500603_000507 3300053150 Bacteria 9880
405 Ga0500603_080706 3300053150 Bacteria 942
406 Ga0500622_0043989 3300053156 Bacteria 2315
407 Ga0500627_0051674 3300053158 Bacteria 1793
408 Ga0500630_000537 3300053159 Bacteria 17060
409 Ga0500638_002399 3300053162 Bacteria 6506
410 Ga0500639_000001 3300053163 Bacteria 244795
411 Ga0500639_104097 3300053163 Bacteria 1391
412 Ga0500639_119374 3300053163 Bacteria 1269
413 Ga0500639_190281 3300053163 Bacteria 895
414 Ga0500636_0005118 3300053177 Bacteria 7451
415 Ga0500636_0066084 3300053177 Bacteria 2103
416 Ga0500636_0342439 3300053177 Bacteria 717
417 Ga0500637_0030575 3300053178 Bacteria 2997
418 Ga0500570_114053 3300053724 Bacteria 1086
419 Ga0500657_252233 3300053728 Bacteria 523
420 Ga0500609_010225 3300053731 Bacteria 1263
421 Ga0500552_002880 3300053733 Bacteria 1710
422 Ga0500596_000054 3300053735 Bacteria 15502
423 Ga0500596_009222 3300053735 Bacteria 1545
424 Ga0500613_048832 3300053738 Bacteria 659
425 Ga0500661_017471 3300055283 Bacteria 1282
426 Ga0587084_054078 3300059477 Bacteria 718
427 Ga0587084_054184 3300059477 Unclassified 718
428 Ga0587084_066734 3300059477 Bacteria 671
429 Ga0587084_071986 3300059477 Bacteria 654
430 Ga0587084_078600 3300059477 Bacteria 635
431 Ga0587084_081479 3300059477 Bacteria 628
432 Ga0587084_104066 3300059477 Bacteria 579
433 Ga0587093_034508 3300059478 Bacteria 743
434 Ga0587093_048102 3300059478 Bacteria 666
435 Ga0587066_127438 3300059490 Bacteria 608
436 Ga0587066_134447 3300059490 Bacteria 598
437 Ga0587070_074572 3300059491 Bacteria 731
438 Ga0587070_087992 3300059491 Bacteria 694
439 Ga0587070_093125 3300059491 Bacteria 681
440 Ga0587073_0109670 3300059492 Bacteria 729
441 Ga0587073_0136655 3300059492 Bacteria 679
442 Ga0587073_0160695 3300059492 Bacteria 644
443 Ga0587073_0224013 3300059492 Bacteria 576
444 Ga0587077_035721 3300059493 Bacteria 972
445 Ga0587077_038830 3300059493 Bacteria 946
446 Ga0587077_095298 3300059493 Bacteria 706
447 Ga0587077_102719 3300059493 Bacteria 689
448 Ga0587077_107595 3300059493 Bacteria 678
449 Ga0587077_225442 3300059493 Bacteria 531
450 Ga0587080_076140 3300059503 Bacteria 680
451 Ga0587080_091004 3300059503 Bacteria 640
452 Ga0587082_060978 3300059504 Bacteria 744
453 Ga0587082_067651 3300059504 Bacteria 719
454 Ga0587082_096048 3300059504 Bacteria 639
455 Ga0587082_111056 3300059504 Bacteria 609
456 Ga0587083_0058760 3300059505 Bacteria 861
457 Ga0587083_0089912 3300059505 Bacteria 747
458 Ga0587083_0108837 3300059505 Bacteria 701
459 Ga0587083_0121966 3300059505 Bacteria 674
460 Ga0587085_060059 3300059506 Bacteria 717
461 Ga0587085_064318 3300059506 Bacteria 702
462 Ga0587086_041316 3300059507 Bacteria 715
463 Ga0587086_046022 3300059507 Bacteria 690
464 Ga0587086_054685 3300059507 Bacteria 651
465 Ga0587088_093596 3300059508 Bacteria 662
466 Ga0587088_110115 3300059508 Bacteria 625
467 Ga0587088_112016 3300059508 Bacteria 622
468 Ga0587089_052859 3300059509 Bacteria 656
469 Ga0587090_037912 3300059510 Bacteria 836
470 Ga0587090_041629 3300059510 Bacteria 811
471 Ga0587090_069215 3300059510 Bacteria 686
472 Ga0587090_076392 3300059510 Bacteria 663
473 Ga0587090_081153 3300059510 Bacteria 650
474 Ga0587091_085043 3300059511 Bacteria 717
475 Ga0587091_092412 3300059511 Bacteria 697
476 Ga0587091_107501 3300059511 Bacteria 662
477 Ga0587091_123110 3300059511 Bacteria 632
478 Ga0587091_132249 3300059511 Bacteria 617
479 Ga0587092_063300 3300059512 Bacteria 697
480 Ga0587092_063825 3300059512 Bacteria 695
481 Ga0587092_066066 3300059512 Bacteria 687
482 Ga0587094_031515 3300059513 Bacteria 824
483 Ga0587094_046419 3300059513 Bacteria 723
484 Ga0587094_062714 3300059513 Bacteria 654
485 Ga0587095_020831 3300059514 Bacteria 629
486 Ga0587098_043890 3300059604 Bacteria 659
487 Ga0587106_075782 3300059605 Bacteria 646
488 Ga0587125_016778 3300059607 Bacteria 825
489 Ga0587125_026775 3300059607 Bacteria 715
490 Ga0587101_017282 3300059623 Bacteria 998
491 Ga0587101_019396 3300059623 Bacteria 963
492 Ga0587101_020050 3300059623 Bacteria 953
493 Ga0587101_044907 3300059623 Bacteria 742
494 Ga0587101_045682 3300059623 Bacteria 738
495 Ga0587101_053898 3300059623 Bacteria 700
496 Ga0587101_065572 3300059623 Bacteria 658
497 Ga0587101_088554 3300059623 Bacteria 598
498 Ga0587109_042855 3300059624 Bacteria 903
499 Ga0587109_114947 3300059624 Bacteria 633
500 Ga0587109_170916 3300059624 Bacteria 550
501 Ga0587109_207908 3300059624 Bacteria 513
502 Ga0587115_042178 3300059626 Bacteria 716
503 Ga0587115_064286 3300059626 Bacteria 621
504 Ga0587115_094356 3300059626 Bacteria 547
505 Ga0587117_051767 3300059627 Bacteria 683
506 Ga0587117_062129 3300059627 Bacteria 644
507 Ga0587117_074480 3300059627 Bacteria 608
508 Ga0587127_019325 3300059629 Bacteria 594
509 Ga0587128_053608 3300059630 Bacteria 743
510 Ga0587128_067427 3300059630 Bacteria 690
511 Ga0587128_085614 3300059630 Bacteria 638
512 Ga0587128_090632 3300059630 Bacteria 627
513 Ga0587062_041722 3300059639 Bacteria 747
514 Ga0587062_045782 3300059639 Bacteria 725
515 Ga0587062_046038 3300059639 Bacteria 724
516 Ga0587062_048139 3300059639 Bacteria 714
517 Ga0587062_060680 3300059639 Bacteria 663
518 Ga0587062_062424 3300059639 Bacteria 657
519 Ga0587067_048932 3300059640 Bacteria 849
520 Ga0587068_066538 3300059641 Bacteria 703
521 Ga0587068_067412 3300059641 Bacteria 700
522 Ga0587068_079191 3300059641 Bacteria 661
523 Ga0587068_112594 3300059641 Bacteria 583
524 Ga0587069_055820 3300059642 Bacteria 715
525 Ga0587069_058545 3300059642 Bacteria 704
526 Ga0587069_073453 3300059642 Bacteria 654
527 Ga0587069_077778 3300059642 Bacteria 642
528 Ga0587069_102436 3300059642 Bacteria 586
529 Ga0587072_046549 3300059643 Bacteria 858
530 Ga0587072_094146 3300059643 Bacteria 664
531 Ga0587075_038274 3300059644 Bacteria 793
532 Ga0587075_046875 3300059644 Bacteria 743
533 Ga0587075_047895 3300059644 Bacteria 737
534 Ga0587075_052123 3300059644 Bacteria 717
535 Ga0587076_038044 3300059645 Bacteria 887
536 Ga0587076_062267 3300059645 Bacteria 755
537 Ga0587076_062879 3300059645 Bacteria 752
538 Ga0587076_069391 3300059645 Bacteria 728
539 Ga0587076_075824 3300059645 Bacteria 708
540 Ga0587076_084357 3300059645 Bacteria 683
541 Ga0587076_099261 3300059645 Bacteria 648
542 Ga0587078_017655 3300059646 Bacteria 877
543 Ga0587078_028494 3300059646 Bacteria 742
544 Ga0587078_038909 3300059646 Bacteria 666
545 Ga0587078_041935 3300059646 Bacteria 649
546 Ga0587079_050411 3300059647 Bacteria 872
547 Ga0587079_111768 3300059647 Bacteria 665
548 Ga0587079_112734 3300059647 Bacteria 663
549 Ga0587079_134131 3300059647 Bacteria 625
550 Ga0587079_144478 3300059647 Bacteria 609
551 Ga0587079_154532 3300059647 Bacteria 596
552 Ga0587079_160676 3300059647 Bacteria 588
553 Ga0587100_006875 3300059648 Bacteria 886
554 Ga0587100_015195 3300059648 Bacteria 702
555 Ga0587100_018176 3300059648 Bacteria 665
556 Ga0587100_019016 3300059648 Bacteria 656
557 Ga0587102_020847 3300059649 Bacteria 739
558 Ga0587107_077875 3300059652 Bacteria 618
559 Ga0587110_043554 3300059654 Bacteria 583
560 Ga0587119_073084 3300059658 Bacteria 547
561 Ga0587124_012095 3300059660 Bacteria 792
562 Ga0587124_023362 3300059660 Bacteria 645
563 Ga0587071_031911 3300060344 Bacteria 1019
564 Ga0587071_033342 3300060344 Bacteria 1002
565 Ga0587071_056039 3300060344 Bacteria 827
566 Ga0587071_075486 3300060344 Bacteria 742
567 Ga0587071_091763 3300060344 Bacteria 691
568 Ga0587071_142972 3300060344 Bacteria 589
569 Ga0587111_0100415 3300060346 Bacteria 720
570 Ga0587111_0106677 3300060346 Bacteria 705
571 Ga0587111_0109278 3300060346 Bacteria 699
572 Ga0587111_0112122 3300060346 Bacteria 692
573 Ga0587111_0128620 3300060346 Bacteria 660
574 Ga0466962_0238251 3300061719 Bacteria 893

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026095 Ga0207676_10738202 Ga0207676_107382021 108
2 iso_pu_bacteria 2513237104 2513718641 110
3 3300039438 Ga0436360_0778394 Ga0436360_0778394_1003_1356 111
4 3300039447 Ga0436361_1037124 Ga0436361_1037124_2622_2975 111
5 iso_pu_bacteria 2513237141 2513889166 112
6 3300005435 Ga0070714_100223687 Ga0070714_1002236873 113
7 3300005436 Ga0070713_100066052 Ga0070713_1000660524 113
8 3300006028 Ga0070717_10002555 Ga0070717_1000255510 113
9 3300006173 Ga0070716_100007220 Ga0070716_1000072209 113
10 3300025928 Ga0207700_10012557 Ga0207700_100125578 113
11 3300025929 Ga0207664_10428241 Ga0207664_104282412 113
12 3300025939 Ga0207665_10108900 Ga0207665_101089001 113
13 3300026023 Ga0207677_10150309 Ga0207677_101503091 113
14 3300005467 Ga0070706_100993100 Ga0070706_1009931002 114
15 3300035724 Ga0373933_0000041 Ga0373933_0000041_20314_20679 114
16 3300059490 Ga0587066_127438 Ga0587066_127438_108_482 114
17 3300005334 Ga0068869_101134631 Ga0068869_1011346311 115
18 3300005337 Ga0070682_100142354 Ga0070682_1001423542 115
19 3300005338 Ga0068868_100028867 Ga0068868_1000288673 115
20 3300005338 Ga0068868_100655689 Ga0068868_1006556891 115
21 3300005344 Ga0070661_100415203 Ga0070661_1004152031 115
22 3300005355 Ga0070671_100429000 Ga0070671_1004290002 115
23 3300005364 Ga0070673_101845832 Ga0070673_1018458321 115
24 3300005434 Ga0070709_10013858 Ga0070709_100138586 115
25 3300005436 Ga0070713_100039476 Ga0070713_1000394764 115
26 3300005437 Ga0070710_10077714 Ga0070710_100777145 115
27 3300005439 Ga0070711_100094825 Ga0070711_1000948254 115
28 3300005455 Ga0070663_100009083 Ga0070663_1000090835 115
29 3300005539 Ga0068853_100244002 Ga0068853_1002440022 115
30 3300005548 Ga0070665_100092705 Ga0070665_1000927052 115
31 3300005614 Ga0068856_100645486 Ga0068856_1006454862 115
32 3300005618 Ga0068864_100189462 Ga0068864_1001894622 115
33 3300005618 Ga0068864_100690266 Ga0068864_1006902662 115
34 3300005618 Ga0068864_101459534 Ga0068864_1014595342 115
35 3300005834 Ga0068851_10045953 Ga0068851_100459532 115
36 3300005841 Ga0068863_100153114 Ga0068863_1001531144 115
37 3300005841 Ga0068863_101009584 Ga0068863_1010095842 115
38 3300005842 Ga0068858_100221497 Ga0068858_1002214973 115
39 3300005843 Ga0068860_100000058 Ga0068860_100000058210 115
40 3300005983 Ga0081540_1277834 Ga0081540_12778341 115
41 3300006028 Ga0070717_10110607 Ga0070717_101106072 115
42 3300006028 Ga0070717_10348221 Ga0070717_103482212 115
43 3300006175 Ga0070712_100032824 Ga0070712_1000328246 115
44 3300006358 Ga0068871_100337213 Ga0068871_1003372132 115
45 3300006358 Ga0068871_100379250 Ga0068871_1003792502 115
46 3300009098 Ga0105245_10080528 Ga0105245_100805282 115
47 3300009101 Ga0105247_10015905 Ga0105247_100159056 115
48 3300009101 Ga0105247_10101798 Ga0105247_101017982 115
49 3300009101 Ga0105247_10278113 Ga0105247_102781133 115
50 3300009176 Ga0105242_10508321 Ga0105242_105083211 115
51 3300009545 Ga0105237_10005643 Ga0105237_100056434 115
52 3300010375 Ga0105239_10018730 Ga0105239_100187305 115
53 3300010375 Ga0105239_10257495 Ga0105239_102574952 115
54 3300011119 Ga0105246_10016910 Ga0105246_100169105 115
55 3300011119 Ga0105246_10341466 Ga0105246_103414664 115
56 3300013296 Ga0157374_10912966 Ga0157374_109129662 115
57 3300013306 Ga0163162_10003676 Ga0163162_100036765 115
58 3300013308 Ga0157375_10152257 Ga0157375_101522573 115
59 3300014325 Ga0163163_10028298 Ga0163163_100282983 115
60 3300014745 Ga0157377_10066376 Ga0157377_100663762 115
61 3300014969 Ga0157376_10093596 Ga0157376_100935962 115
62 3300023552 Ga0247551_105764 Ga0247551_1057641 115
63 3300025315 Ga0207697_10371254 Ga0207697_103712542 115
64 3300025898 Ga0207692_10073593 Ga0207692_100735934 115
65 3300025900 Ga0207710_10152399 Ga0207710_101523992 115
66 3300025900 Ga0207710_10203766 Ga0207710_102037661 115
67 3300025906 Ga0207699_10148910 Ga0207699_101489102 115
68 3300025915 Ga0207693_10011177 Ga0207693_100111772 115
69 3300025916 Ga0207663_10080161 Ga0207663_100801614 115
70 3300025927 Ga0207687_10061452 Ga0207687_100614521 115
71 3300025960 Ga0207651_11673379 Ga0207651_116733791 115
72 3300026041 Ga0207639_10979900 Ga0207639_109799001 115
73 3300026067 Ga0207678_10014210 Ga0207678_100142107 115
74 3300026078 Ga0207702_10591447 Ga0207702_105914472 115
75 3300026088 Ga0207641_10658828 Ga0207641_106588282 115
76 3300026088 Ga0207641_11653430 Ga0207641_116534301 115
77 3300026121 Ga0207683_10016693 Ga0207683_100166932 115
78 3300026142 Ga0207698_10027117 Ga0207698_100271172 115
79 3300028381 Ga0268264_10000022 Ga0268264_10000022453 115
80 3300030521 Ga0307511_10049805 Ga0307511_100498052 115
81 3300030763 Ga0265763_1018645 Ga0265763_10186451 115
82 3300030763 Ga0265763_1048242 Ga0265763_10482422 115
83 3300030886 Ga0265772_103947 Ga0265772_1039472 115
84 3300030888 Ga0265769_110484 Ga0265769_1104841 115
85 3300030963 Ga0265768_109348 Ga0265768_1093482 115
86 3300030963 Ga0265768_109393 Ga0265768_1093932 115
87 3300031018 Ga0265773_1026313 Ga0265773_10263131 115
88 3300031507 Ga0307509_10038177 Ga0307509_100381774 115
89 3300031507 Ga0307509_10510023 Ga0307509_105100232 115
90 3300031678 Ga0310114_117475 Ga0310114_1174752 115
91 3300031730 Ga0307516_10109129 Ga0307516_101091294 115
92 3300031730 Ga0307516_10147601 Ga0307516_101476013 115
93 3300031730 Ga0307516_10421154 Ga0307516_104211542 115
94 3300033179 Ga0307507_10035312 Ga0307507_100353124 115
95 3300035083 Ga0373926_0408073 Ga0373926_0408073_10_378 115
96 3300035088 Ga0373940_0203879 Ga0373940_0203879_120_488 115
97 3300035695 Ga0373927_0007540 Ga0373927_0007540_4677_5045 115
98 3300035724 Ga0373933_0318215 Ga0373933_0318215_253_621 115
99 3300035725 Ga0373947_0161160 Ga0373947_0161160_49_417 115
100 3300036242 Ga0310104_05991 Ga0310104_05991_231_596 115
101 3300036242 Ga0310104_15421 Ga0310104_15421_125_490 115
102 3300036458 Ga0310112_036241 Ga0310112_036241_236_601 115
103 3300036458 Ga0310112_037313 Ga0310112_037313_233_598 115
104 3300036459 Ga0372808_017927 Ga0372808_017927_421_786 115
105 3300036534 Ga0310109_029386 Ga0310109_029386_128_493 115
106 3300036534 Ga0310109_030007 Ga0310109_030007_122_487 115
107 3300036535 Ga0310110_015967 Ga0310110_015967_232_597 115
108 3300037068 Ga0373925_0206849 Ga0373925_0206849_1130_1498 115
109 3300039438 Ga0436360_1084860 Ga0436360_1084860_1003_1368 115
110 3300039447 Ga0436361_1097065 Ga0436361_1097065_67_432 115
111 3300041456 Ga0451795_1523835 Ga0451795_1523835_47_415 115
112 3300041505 Ga0451849_1386904 Ga0451849_1386904_55_423 115
113 3300041512 Ga0451853_0423507 Ga0451853_0423507_217_621 115
114 3300046455 Ga0495603_0323053 Ga0495603_0323053_383_787 115
115 3300046557 Ga0495622_0028887 Ga0495622_0028887_2159_2527 115
116 3300047322 Ga0495680_0997686 Ga0495680_0997686_142_510 115
117 3300048903 Ga0496100_0018770 Ga0496100_0018770_3613_4017 115
118 3300048904 Ga0496101_0032308 Ga0496101_0032308_2270_2674 115
119 3300048905 Ga0496102_0003268 Ga0496102_0003268_4421_4825 115
120 3300048905 Ga0496102_0435260 Ga0496102_0435260_75_443 115
121 3300048906 Ga0496103_0271045 Ga0496103_0271045_366_734 115
122 3300048907 Ga0496104_0103927 Ga0496104_0103927_1971_2375 115
123 3300048908 Ga0496105_0044527 Ga0496105_0044527_2979_3383 115
124 3300048909 Ga0496106_0000540 Ga0496106_0000540_19488_19856 115
125 3300048909 Ga0496106_0009950 Ga0496106_0009950_709_1113 115
126 3300048910 Ga0496107_0011065 Ga0496107_0011065_3422_3826 115
127 3300048911 Ga0496108_0245050 Ga0496108_0245050_635_1003 115
128 3300048912 Ga0496109_0032304 Ga0496109_0032304_26_430 115
129 3300048914 Ga0496111_0127620 Ga0496111_0127620_278_682 115
130 3300048915 Ga0496112_0151190 Ga0496112_0151190_566_970 115
131 3300048916 Ga0496113_0967565 Ga0496113_0967565_186_590 115
132 3300048917 Ga0496114_0026575 Ga0496114_0026575_3137_3541 115
133 3300048918 Ga0496115_0001335 Ga0496115_0001335_12661_13065 115
134 3300048920 Ga0496117_0133189 Ga0496117_0133189_996_1364 115
135 3300048921 Ga0496118_0006481 Ga0496118_0006481_5111_5479 115
136 3300048922 Ga0496119_0157482 Ga0496119_0157482_315_683 115
137 3300048923 Ga0496120_0059518 Ga0496120_0059518_818_1186 115
138 3300048924 Ga0496121_0000456 Ga0496121_0000456_35126_35494 115
139 3300048927 Ga0496124_0001010 Ga0496124_0001010_640_1008 115
140 3300048928 Ga0496125_0026319 Ga0496125_0026319_4468_4836 115
141 3300048929 Ga0496126_0010869 Ga0496126_0010869_4321_4689 115
142 3300048929 Ga0496126_0037772 Ga0496126_0037772_2417_2791 115
143 3300048929 Ga0496126_0458166 Ga0496126_0458166_146_514 115
144 3300053080 Ga0500635_0020115 Ga0500635_0020115_999_1367 115
145 3300053097 Ga0500648_283575 Ga0500648_283575_89_457 115
146 3300053136 Ga0500559_0082087 Ga0500559_0082087_205_573 115
147 3300053140 Ga0500573_0015719 Ga0500573_0015719_1439_1807 115
148 3300053150 Ga0500603_080706 Ga0500603_080706_227_595 115
149 3300053163 Ga0500639_190281 Ga0500639_190281_227_595 115
150 3300053177 Ga0500636_0066084 Ga0500636_0066084_862_1230 115
151 3300053177 Ga0500636_0342439 Ga0500636_0342439_325_693 115
152 3300053178 Ga0500637_0030575 Ga0500637_0030575_2246_2614 115
153 3300053733 Ga0500552_002880 Ga0500552_002880_876_1244 115
154 3300053735 Ga0500596_009222 Ga0500596_009222_879_1247 115
155 3300053738 Ga0500613_048832 Ga0500613_048832_277_645 115
156 3300059477 Ga0587084_071986 Ga0587084_071986_38_442 115
157 3300005329 Ga0070683_100703220 Ga0070683_1007032202 116
158 3300005337 Ga0070682_101101482 Ga0070682_1011014821 116
159 3300005439 Ga0070711_100348100 Ga0070711_1003481002 116
160 3300005458 Ga0070681_10011972 Ga0070681_100119726 116
161 3300005467 Ga0070706_100013118 Ga0070706_1000131185 116
162 3300005471 Ga0070698_100723160 Ga0070698_1007231602 116
163 3300005536 Ga0070697_100112753 Ga0070697_1001127532 116
164 3300005937 Ga0081455_10170677 Ga0081455_101706774 116
165 3300006028 Ga0070717_10782681 Ga0070717_107826812 116
166 3300007265 Ga0099794_10435761 Ga0099794_104357612 116
167 3300009551 Ga0105238_11937755 Ga0105238_119377551 116
168 3300020078 Ga0206352_10262384 Ga0206352_102623842 116
169 3300021361 Ga0213872_10078806 Ga0213872_100788062 116
170 3300025906 Ga0207699_11091749 Ga0207699_110917491 116
171 3300025910 Ga0207684_10018833 Ga0207684_100188339 116
172 3300025912 Ga0207707_10014023 Ga0207707_100140232 116
173 3300025944 Ga0207661_10591547 Ga0207661_105915472 116
174 3300025949 Ga0207667_10341231 Ga0207667_103412313 116
175 3300039450 Ga0436363_0699152 Ga0436363_0699152_971_1345 116
176 3300039450 Ga0436363_1453805 Ga0436363_1453805_144_509 116
177 3300048915 Ga0496112_0050747 Ga0496112_0050747_25_399 116
178 3300049568 Ga0501031_0492882 Ga0501031_0492882_177_545 116
179 3300049569 Ga0501032_0029893 Ga0501032_0029893_2080_2448 116
180 3300049569 Ga0501032_0234288 Ga0501032_0234288_221_589 116
181 3300049570 Ga0501033_0013873 Ga0501033_0013873_4706_5074 116
182 3300049573 Ga0501037_0008746 Ga0501037_0008746_4759_5127 116
183 3300049574 Ga0501038_0140923 Ga0501038_0140923_1056_1424 116
184 3300049575 Ga0501039_0101591 Ga0501039_0101591_848_1216 116
185 3300049578 Ga0501042_0291495 Ga0501042_0291495_754_1122 116
186 3300049579 Ga0501043_0070101 Ga0501043_0070101_1468_1836 116
187 3300049580 Ga0501046_0304009 Ga0501046_0304009_466_834 116
188 3300049581 Ga0501047_0055504 Ga0501047_0055504_629_997 116
189 3300049582 Ga0501048_0012334 Ga0501048_0012334_5656_6024 116
190 3300049584 Ga0501068_0125629 Ga0501068_0125629_311_679 116
191 3300049586 Ga0501070_0351878 Ga0501070_0351878_425_793 116
192 3300049587 Ga0501071_0108660 Ga0501071_0108660_1132_1500 116
193 3300049588 Ga0501072_0803976 Ga0501072_0803976_228_596 116
194 3300049589 Ga0501073_0342449 Ga0501073_0342449_524_892 116
195 3300049590 Ga0501074_0114738 Ga0501074_0114738_282_650 116
196 3300049741 Ga0501079_0189028 Ga0501079_0189028_1042_1410 116
197 3300049742 Ga0501080_0084317 Ga0501080_0084317_446_814 116
198 3300049822 Ga0501035_0079019 Ga0501035_0079019_1295_1663 116
199 3300049822 Ga0501035_0091301 Ga0501035_0091301_478_846 116
200 3300049823 Ga0501044_0110279 Ga0501044_0110279_1594_1962 116
201 3300049823 Ga0501044_0211670 Ga0501044_0211670_1058_1426 116
202 3300049824 Ga0501045_0117270 Ga0501045_0117270_1281_1649 116
203 3300053091 Ga0500647_0270311 Ga0500647_0270311_141_512 116
204 3300053095 Ga0500640_003151 Ga0500640_003151_3649_4065 116
205 3300053111 Ga0500572_000217 Ga0500572_000217_9974_10390 116
206 3300053122 Ga0500608_051766 Ga0500608_051766_982_1398 116
207 3300053123 Ga0500614_005804 Ga0500614_005804_1327_1743 116
208 3300053136 Ga0500559_0008734 Ga0500559_0008734_3250_3666 116
209 3300053150 Ga0500603_000507 Ga0500603_000507_9387_9803 116
210 3300053159 Ga0500630_000537 Ga0500630_000537_2481_2897 116
211 3300053162 Ga0500638_002399 Ga0500638_002399_1060_1476 116
212 3300053163 Ga0500639_000001 Ga0500639_000001_9823_10239 116
213 3300053163 Ga0500639_104097 Ga0500639_104097_111_527 116
214 3300053163 Ga0500639_119374 Ga0500639_119374_655_1071 116
215 3300053728 Ga0500657_252233 Ga0500657_252233_67_483 116
216 3300053735 Ga0500596_000054 Ga0500596_000054_9347_9763 116
217 3300055283 Ga0500661_017471 Ga0500661_017471_27_398 116
218 3300059477 Ga0587084_054078 Ga0587084_054078_109_483 116
219 3300059478 Ga0587093_048102 Ga0587093_048102_231_605 116
220 3300059492 Ga0587073_0109670 Ga0587073_0109670_127_498 116
221 3300059493 Ga0587077_102719 Ga0587077_102719_78_452 116
222 3300059493 Ga0587077_225442 Ga0587077_225442_46_420 116
223 3300059504 Ga0587082_096048 Ga0587082_096048_30_401 116
224 3300059505 Ga0587083_0058760 Ga0587083_0058760_283_657 116
225 3300059506 Ga0587085_064318 Ga0587085_064318_241_615 116
226 3300059507 Ga0587086_041316 Ga0587086_041316_270_644 116
227 3300059508 Ga0587088_093596 Ga0587088_093596_34_405 116
228 3300059510 Ga0587090_041629 Ga0587090_041629_188_601 116
229 3300059511 Ga0587091_085043 Ga0587091_085043_102_476 116
230 3300059511 Ga0587091_092412 Ga0587091_092412_240_614 116
231 3300059513 Ga0587094_031515 Ga0587094_031515_270_644 116
232 3300059513 Ga0587094_062714 Ga0587094_062714_234_608 116
233 3300059514 Ga0587095_020831 Ga0587095_020831_231_605 116
234 3300059607 Ga0587125_026775 Ga0587125_026775_105_479 116
235 3300059623 Ga0587101_053898 Ga0587101_053898_214_585 116
236 3300059623 Ga0587101_065572 Ga0587101_065572_48_422 116
237 3300059624 Ga0587109_207908 Ga0587109_207908_118_492 116
238 3300059626 Ga0587115_042178 Ga0587115_042178_95_475 116
239 3300059629 Ga0587127_019325 Ga0587127_019325_32_403 116
240 3300059639 Ga0587062_045782 Ga0587062_045782_111_485 116
241 3300059641 Ga0587068_066538 Ga0587068_066538_230_604 116
242 3300059641 Ga0587068_079191 Ga0587068_079191_242_616 116
243 3300059642 Ga0587069_055820 Ga0587069_055820_102_476 116
244 3300059645 Ga0587076_084357 Ga0587076_084357_71_451 116
245 3300059647 Ga0587079_050411 Ga0587079_050411_259_633 116
246 3300059647 Ga0587079_134131 Ga0587079_134131_22_393 116
247 3300059647 Ga0587079_144478 Ga0587079_144478_214_594 116
248 3300059654 Ga0587110_043554 Ga0587110_043554_192_566 116
249 3300059660 Ga0587124_012095 Ga0587124_012095_182_556 116
250 3300060344 Ga0587071_031911 Ga0587071_031911_227_601 116
251 3300060346 Ga0587111_0106677 Ga0587111_0106677_238_618 116
252 3300060346 Ga0587111_0112122 Ga0587111_0112122_48_455 116
253 3300005548 Ga0070665_100433818 Ga0070665_1004338182 117
254 3300009545 Ga0105237_10033600 Ga0105237_100336006 117
255 3300009551 Ga0105238_10003526 Ga0105238_1000352611 117
256 3300013105 Ga0157369_10732759 Ga0157369_107327592 117
257 3300013296 Ga0157374_10190296 Ga0157374_101902962 117
258 3300013306 Ga0163162_10232016 Ga0163162_102320162 117
259 3300025929 Ga0207664_11920109 Ga0207664_119201091 117
260 3300025944 Ga0207661_10650009 Ga0207661_106500092 117
261 3300028379 Ga0268266_10400089 Ga0268266_104000892 117
262 3300039437 Ga0436365_0994240 Ga0436365_0994240_717_1100 117
263 3300048918 Ga0496115_0211001 Ga0496115_0211001_843_1217 117
264 3300059477 Ga0587084_078600 Ga0587084_078600_239_622 117
265 3300059477 Ga0587084_104066 Ga0587084_104066_151_534 117
266 3300059490 Ga0587066_134447 Ga0587066_134447_124_507 117
267 3300059491 Ga0587070_074572 Ga0587070_074572_114_497 117
268 3300059491 Ga0587070_093125 Ga0587070_093125_230_613 117
269 3300059492 Ga0587073_0224013 Ga0587073_0224013_36_419 117
270 3300059493 Ga0587077_095298 Ga0587077_095298_89_472 117
271 3300059503 Ga0587080_076140 Ga0587080_076140_59_442 117
272 3300059504 Ga0587082_111056 Ga0587082_111056_30_413 117
273 3300059508 Ga0587088_110115 Ga0587088_110115_189_614 117
274 3300059508 Ga0587088_112016 Ga0587088_112016_12_395 117
275 3300059513 Ga0587094_046419 Ga0587094_046419_190_615 117
276 3300059605 Ga0587106_075782 Ga0587106_075782_172_588 117
277 3300059623 Ga0587101_020050 Ga0587101_020050_336_719 117
278 3300059623 Ga0587101_045682 Ga0587101_045682_125_541 117
279 3300059624 Ga0587109_170916 Ga0587109_170916_126_509 117
280 3300059627 Ga0587117_074480 Ga0587117_074480_40_423 117
281 3300059639 Ga0587062_041722 Ga0587062_041722_147_521 117
282 3300059639 Ga0587062_062424 Ga0587062_062424_238_621 117
283 3300059640 Ga0587067_048932 Ga0587067_048932_231_614 117
284 3300059641 Ga0587068_112594 Ga0587068_112594_40_423 117
285 3300059642 Ga0587069_073453 Ga0587069_073453_37_420 117
286 3300059642 Ga0587069_077778 Ga0587069_077778_189_572 117
287 3300059644 Ga0587075_047895 Ga0587075_047895_239_622 117
288 3300059645 Ga0587076_062879 Ga0587076_062879_173_556 117
289 3300059645 Ga0587076_099261 Ga0587076_099261_187_612 117
290 3300059646 Ga0587078_017655 Ga0587078_017655_230_613 117
291 3300059646 Ga0587078_038909 Ga0587078_038909_54_470 117
292 3300059647 Ga0587079_112734 Ga0587079_112734_198_614 117
293 3300059648 Ga0587100_006875 Ga0587100_006875_265_648 117
294 3300059648 Ga0587100_018176 Ga0587100_018176_199_615 117
295 3300059652 Ga0587107_077875 Ga0587107_077875_222_605 117
296 3300059658 Ga0587119_073084 Ga0587119_073084_92_466 117
297 3300060346 Ga0587111_0128620 Ga0587111_0128620_45_428 117
298 3300003323 rootH1_10201677 rootH1_102016772 118
299 3300004800 Ga0058861_10037956 Ga0058861_100379562 118
300 3300005327 Ga0070658_11262258 Ga0070658_112622581 118
301 3300005329 Ga0070683_100024847 Ga0070683_1000248477 118
302 3300005329 Ga0070683_100201833 Ga0070683_1002018333 118
303 3300005336 Ga0070680_100012602 Ga0070680_1000126023 118
304 3300005337 Ga0070682_100076497 Ga0070682_1000764973 118
305 3300005341 Ga0070691_10123850 Ga0070691_101238502 118
306 3300005434 Ga0070709_10004487 Ga0070709_1000448711 118
307 3300005434 Ga0070709_10159977 Ga0070709_101599774 118
308 3300005435 Ga0070714_100061575 Ga0070714_1000615754 118
309 3300005436 Ga0070713_100091479 Ga0070713_1000914794 118
310 3300005437 Ga0070710_10036825 Ga0070710_100368253 118
311 3300005437 Ga0070710_10699552 Ga0070710_106995522 118
312 3300005455 Ga0070663_100391067 Ga0070663_1003910672 118
313 3300005458 Ga0070681_10010590 Ga0070681_100105905 118
314 3300005458 Ga0070681_10080599 Ga0070681_100805993 118
315 3300005530 Ga0070679_100044917 Ga0070679_1000449172 118
316 3300005530 Ga0070679_100276174 Ga0070679_1002761744 118
317 3300005535 Ga0070684_100009632 Ga0070684_1000096328 118
318 3300005535 Ga0070684_100015331 Ga0070684_1000153314 118
319 3300005539 Ga0068853_100124531 Ga0068853_1001245311 118
320 3300005539 Ga0068853_100424239 Ga0068853_1004242393 118
321 3300005563 Ga0068855_100112704 Ga0068855_1001127045 118
322 3300005563 Ga0068855_100580630 Ga0068855_1005806303 118
323 3300005563 Ga0068855_101007445 Ga0068855_1010074452 118
324 3300005577 Ga0068857_100267634 Ga0068857_1002676342 118
325 3300006028 Ga0070717_10536467 Ga0070717_105364672 118
326 3300006173 Ga0070716_100557839 Ga0070716_1005578391 118
327 3300006175 Ga0070712_100186092 Ga0070712_1001860922 118
328 3300009093 Ga0105240_10058646 Ga0105240_100586465 118
329 3300009093 Ga0105240_10086231 Ga0105240_100862314 118
330 3300009093 Ga0105240_10135022 Ga0105240_101350224 118
331 3300009093 Ga0105240_10438394 Ga0105240_104383943 118
332 3300009174 Ga0105241_10212893 Ga0105241_102128934 118
333 3300009545 Ga0105237_10151993 Ga0105237_101519933 118
334 3300009551 Ga0105238_10164278 Ga0105238_101642783 118
335 3300009551 Ga0105238_10182046 Ga0105238_101820463 118
336 3300009551 Ga0105238_10562471 Ga0105238_105624711 118
337 3300009551 Ga0105238_10616998 Ga0105238_106169981 118
338 3300010375 Ga0105239_11277721 Ga0105239_112777212 118
339 3300010375 Ga0105239_11724320 Ga0105239_117243202 118
340 3300013104 Ga0157370_10216497 Ga0157370_102164974 118
341 3300013105 Ga0157369_10003890 Ga0157369_1000389015 118
342 3300013105 Ga0157369_10008785 Ga0157369_100087853 118
343 3300013105 Ga0157369_10161928 Ga0157369_101619283 118
344 3300013307 Ga0157372_10088837 Ga0157372_100888373 118
345 3300013307 Ga0157372_10339206 Ga0157372_103392063 118
346 3300013307 Ga0157372_11074550 Ga0157372_110745501 118
347 3300020069 Ga0197907_10871054 Ga0197907_108710542 118
348 3300020070 Ga0206356_11778877 Ga0206356_117788772 118
349 3300020075 Ga0206349_1644047 Ga0206349_16440472 118
350 3300020076 Ga0206355_1410402 Ga0206355_14104022 118
351 3300020076 Ga0206355_1624809 Ga0206355_16248092 118
352 3300020078 Ga0206352_10610341 Ga0206352_106103412 118
353 3300020078 Ga0206352_11309092 Ga0206352_113090922 118
354 3300020080 Ga0206350_10061001 Ga0206350_100610012 118
355 3300020080 Ga0206350_10790842 Ga0206350_107908422 118
356 3300020082 Ga0206353_11405000 Ga0206353_114050001 118
357 3300020082 Ga0206353_11805710 Ga0206353_118057102 118
358 3300020610 Ga0154015_1456180 Ga0154015_14561802 118
359 3300021384 Ga0213876_10047846 Ga0213876_100478463 118
360 3300021388 Ga0213875_10020039 Ga0213875_100200394 118
361 3300021388 Ga0213875_10086980 Ga0213875_100869802 118
362 3300022467 Ga0224712_10069896 Ga0224712_100698962 118
363 3300022467 Ga0224712_10192606 Ga0224712_101926062 118
364 3300022467 Ga0224712_10248629 Ga0224712_102486292 118
365 3300025898 Ga0207692_10369002 Ga0207692_103690021 118
366 3300025898 Ga0207692_10379631 Ga0207692_103796312 118
367 3300025904 Ga0207647_10153682 Ga0207647_101536823 118
368 3300025911 Ga0207654_10151251 Ga0207654_101512513 118
369 3300025912 Ga0207707_10002249 Ga0207707_1000224913 118
370 3300025912 Ga0207707_10087345 Ga0207707_100873453 118
371 3300025913 Ga0207695_10486341 Ga0207695_104863412 118
372 3300025913 Ga0207695_10761252 Ga0207695_107612522 118
373 3300025914 Ga0207671_10274769 Ga0207671_102747691 118
374 3300025915 Ga0207693_10122650 Ga0207693_101226502 118
375 3300025916 Ga0207663_10031022 Ga0207663_100310224 118
376 3300025917 Ga0207660_10026951 Ga0207660_100269513 118
377 3300025917 Ga0207660_10134631 Ga0207660_101346313 118
378 3300025917 Ga0207660_10750932 Ga0207660_107509322 118
379 3300025917 Ga0207660_11035386 Ga0207660_110353861 118
380 3300025921 Ga0207652_10065070 Ga0207652_100650703 118
381 3300025921 Ga0207652_10109024 Ga0207652_101090241 118
382 3300025924 Ga0207694_10389258 Ga0207694_103892581 118
383 3300025928 Ga0207700_10002433 Ga0207700_100024333 118
384 3300025929 Ga0207664_10045421 Ga0207664_100454214 118
385 3300025939 Ga0207665_10090439 Ga0207665_100904393 118
386 3300025944 Ga0207661_10000410 Ga0207661_1000041028 118
387 3300025944 Ga0207661_10073730 Ga0207661_100737303 118
388 3300026041 Ga0207639_10077431 Ga0207639_100774314 118
389 3300026041 Ga0207639_10148107 Ga0207639_101481071 118
390 3300026067 Ga0207678_10533579 Ga0207678_105335791 118
391 3300026142 Ga0207698_11259909 Ga0207698_112599092 118
392 3300030863 Ga0265766_1007200 Ga0265766_10072001 118
393 3300035086 Ga0373934_0064976 Ga0373934_0064976_972_1349 118
394 3300035111 Ga0373923_0090427 Ga0373923_0090427_872_1249 118
395 3300035116 Ga0373945_0356243 Ga0373945_0356243_209_586 118
396 3300035117 Ga0373953_0424396 Ga0373953_0424396_108_485 118
397 3300035118 Ga0373954_0043633 Ga0373954_0043633_443_820 118
398 3300035171 Ga0373946_0111443 Ga0373946_0111443_776_1153 118
399 3300035172 Ga0373955_0051784 Ga0373955_0051784_220_597 118
400 3300035172 Ga0373955_0305201 Ga0373955_0305201_543_920 118
401 3300035410 Ga0373924_0006062 Ga0373924_0006062_2890_3267 118
402 3300035691 Ga0373931_0868021 Ga0373931_0868021_54_431 118
403 3300035692 Ga0373935_0600935 Ga0373935_0600935_101_478 118
404 3300035695 Ga0373927_0163909 Ga0373927_0163909_1001_1378 118
405 3300035724 Ga0373933_0442975 Ga0373933_0442975_321_698 118
406 3300035725 Ga0373947_0199246 Ga0373947_0199246_138_515 118
407 3300036401 Ga0373937_0492596 Ga0373937_0492596_428_805 118
408 3300037068 Ga0373925_0072072 Ga0373925_0072072_350_727 118
409 3300037418 Ga0395900_0020777 Ga0395900_0020777_5337_5714 118
410 3300037466 Ga0395898_0107317 Ga0395898_0107317_170_547 118
411 3300037853 Ga0436364_1495700 Ga0436364_1495700_1842_2219 118
412 3300037853 Ga0436364_1521545 Ga0436364_1521545_1770_2147 118
413 3300038443 Ga0395901_0327193 Ga0395901_0327193_468_854 118
414 3300039437 Ga0436365_0937621 Ga0436365_0937621_1357_1734 118
415 3300039438 Ga0436360_0826250 Ga0436360_0826250_678_1055 118
416 3300044656 Ga0466969_0172347 Ga0466969_0172347_24_401 118
417 3300044693 Ga0466961_0371511 Ga0466961_0371511_381_758 118
418 3300044719 Ga0466971_0223486 Ga0466971_0223486_395_772 118
419 3300046454 Ga0495592_0543966 Ga0495592_0543966_192_569 118
420 3300046455 Ga0495603_0839436 Ga0495603_0839436_117_494 118
421 3300046459 Ga0495629_0129936 Ga0495629_0129936_360_737 118
422 3300046473 Ga0495582_0195270 Ga0495582_0195270_66_443 118
423 3300046514 Ga0495618_0169872 Ga0495618_0169872_326_703 118
424 3300046529 Ga0495652_0224894 Ga0495652_0224894_282_659 118
425 3300046535 Ga0495586_0371092 Ga0495586_0371092_128_505 118
426 3300046536 Ga0495587_0465796 Ga0495587_0465796_282_659 118
427 3300046543 Ga0495645_0012692 Ga0495645_0012692_2141_2518 118
428 3300046642 Ga0495634_0196553 Ga0495634_0196553_152_529 118
429 3300046679 Ga0495623_0200962 Ga0495623_0200962_91_468 118
430 3300046680 Ga0495646_0223644 Ga0495646_0223644_152_529 118
431 3300046690 Ga0495624_0094983 Ga0495624_0094983_1172_1549 118
432 3300047315 Ga0495581_0010155 Ga0495581_0010155_4361_4738 118
433 3300047317 Ga0495604_0395362 Ga0495604_0395362_344_721 118
434 3300047319 Ga0495674_0061625 Ga0495674_0061625_1083_1460 118
435 3300047322 Ga0495680_0320378 Ga0495680_0320378_400_777 118
436 3300047471 Ga0495684_0449145 Ga0495684_0449145_286_663 118
437 3300048929 Ga0496126_0035874 Ga0496126_0035874_1153_1530 118
438 3300049569 Ga0501032_0828201 Ga0501032_0828201_11_388 118
439 3300049575 Ga0501039_1598997 Ga0501039_1598997_88_465 118
440 3300049580 Ga0501046_0558530 Ga0501046_0558530_416_793 118
441 3300049581 Ga0501047_0006253 Ga0501047_0006253_343_720 118
442 3300049586 Ga0501070_0001323 Ga0501070_0001323_5964_6341 118
443 3300049589 Ga0501073_0066035 Ga0501073_0066035_1834_2211 118
444 3300049590 Ga0501074_0047876 Ga0501074_0047876_174_584 118
445 3300049741 Ga0501079_0931345 Ga0501079_0931345_32_409 118
446 3300049742 Ga0501080_0005584 Ga0501080_0005584_6378_6755 118
447 3300049823 Ga0501044_0025974 Ga0501044_0025974_3589_3966 118
448 3300050514 nmdc:mga08x19_1017769_c1 nmdc:mga08x19_1017769_c1_155_532 118
449 3300053077 Ga0495601_0121995 Ga0495601_0121995_369_746 118
450 3300053078 Ga0495612_0074345 Ga0495612_0074345_411_788 118
451 3300053078 Ga0495612_0219527 Ga0495612_0219527_302_679 118
452 3300053085 Ga0495619_0429725 Ga0495619_0429725_126_503 118
453 3300059477 Ga0587084_081479 Ga0587084_081479_102_479 118
454 3300059491 Ga0587070_087992 Ga0587070_087992_82_459 118
455 3300059492 Ga0587073_0136655 Ga0587073_0136655_28_414 118
456 3300059493 Ga0587077_038830 Ga0587077_038830_241_618 118
457 3300059493 Ga0587077_107595 Ga0587077_107595_62_439 118
458 3300059504 Ga0587082_067651 Ga0587082_067651_230_616 118
459 3300059505 Ga0587083_0108837 Ga0587083_0108837_82_459 118
460 3300059505 Ga0587083_0121966 Ga0587083_0121966_54_482 118
461 3300059507 Ga0587086_054685 Ga0587086_054685_230_607 118
462 3300059510 Ga0587090_037912 Ga0587090_037912_238_615 118
463 3300059512 Ga0587092_063300 Ga0587092_063300_94_471 118
464 3300059623 Ga0587101_019396 Ga0587101_019396_238_624 118
465 3300059624 Ga0587109_114947 Ga0587109_114947_30_407 118
466 3300059627 Ga0587117_051767 Ga0587117_051767_132_518 118
467 3300059630 Ga0587128_053608 Ga0587128_053608_126_503 118
468 3300059630 Ga0587128_085614 Ga0587128_085614_65_451 118
469 3300059630 Ga0587128_090632 Ga0587128_090632_34_411 118
470 3300059639 Ga0587062_060680 Ga0587062_060680_215_601 118
471 3300059642 Ga0587069_058545 Ga0587069_058545_231_617 118
472 3300059643 Ga0587072_094146 Ga0587072_094146_232_618 118
473 3300059644 Ga0587075_046875 Ga0587075_046875_200_628 118
474 3300059644 Ga0587075_052123 Ga0587075_052123_214_591 118
475 3300059645 Ga0587076_038044 Ga0587076_038044_240_617 118
476 3300059645 Ga0587076_062267 Ga0587076_062267_229_606 118
477 3300059645 Ga0587076_075824 Ga0587076_075824_211_597 118
478 3300059646 Ga0587078_028494 Ga0587078_028494_130_507 118
479 3300059646 Ga0587078_041935 Ga0587078_041935_32_409 118
480 3300059648 Ga0587100_015195 Ga0587100_015195_106_492 118
481 3300059660 Ga0587124_023362 Ga0587124_023362_33_419 118
482 3300060344 Ga0587071_033342 Ga0587071_033342_181_609 118
483 3300060344 Ga0587071_056039 Ga0587071_056039_232_609 118
484 3300060344 Ga0587071_075486 Ga0587071_075486_130_507 118
485 3300060344 Ga0587071_142972 Ga0587071_142972_173_550 118
486 3300060346 Ga0587111_0109278 Ga0587111_0109278_232_609 118
487 3300061719 Ga0466962_0238251 Ga0466962_0238251_43_420 118
488 3300003320 rootH2_10106806 rootH2_101068064 119
489 3300005577 Ga0068857_100217057 Ga0068857_1002170572 119
490 3300009545 Ga0105237_10071273 Ga0105237_100712732 119
491 3300020070 Ga0206356_11046210 Ga0206356_110462101 119
492 3300025914 Ga0207671_10025441 Ga0207671_100254415 119
493 3300026116 Ga0207674_10146657 Ga0207674_101466574 119
494 3300035695 Ga0373927_0277960 Ga0373927_0277960_653_1033 119
495 3300044694 Ga0466963_0044029 Ga0466963_0044029_1117_1530 119
496 3300044842 Ga0466957_1431624 Ga0466957_1431624_70_450 119
497 3300048929 Ga0496126_0021384 Ga0496126_0021384_2924_3304 119
498 3300059477 Ga0587084_066734 Ga0587084_066734_50_430 119
499 3300059478 Ga0587093_034508 Ga0587093_034508_239_619 119
500 3300059492 Ga0587073_0160695 Ga0587073_0160695_38_418 119
501 3300059493 Ga0587077_035721 Ga0587077_035721_268_681 119
502 3300059503 Ga0587080_091004 Ga0587080_091004_238_618 119
503 3300059504 Ga0587082_060978 Ga0587082_060978_240_620 119
504 3300059505 Ga0587083_0089912 Ga0587083_0089912_239_619 119
505 3300059506 Ga0587085_060059 Ga0587085_060059_96_476 119
506 3300059507 Ga0587086_046022 Ga0587086_046022_96_476 119
507 3300059509 Ga0587089_052859 Ga0587089_052859_239_619 119
508 3300059510 Ga0587090_069215 Ga0587090_069215_236_616 119
509 3300059510 Ga0587090_076392 Ga0587090_076392_209_622 119
510 3300059510 Ga0587090_081153 Ga0587090_081153_227_607 119
511 3300059511 Ga0587091_107501 Ga0587091_107501_240_620 119
512 3300059511 Ga0587091_123110 Ga0587091_123110_17_406 119
513 3300059512 Ga0587092_066066 Ga0587092_066066_239_619 119
514 3300059604 Ga0587098_043890 Ga0587098_043890_234_614 119
515 3300059607 Ga0587125_016778 Ga0587125_016778_210_623 119
516 3300059623 Ga0587101_017282 Ga0587101_017282_377_757 119
517 3300059623 Ga0587101_044907 Ga0587101_044907_136_516 119
518 3300059624 Ga0587109_042855 Ga0587109_042855_282_662 119
519 3300059626 Ga0587115_064286 Ga0587115_064286_28_408 119
520 3300059626 Ga0587115_094356 Ga0587115_094356_79_459 119
521 3300059627 Ga0587117_062129 Ga0587117_062129_226_606 119
522 3300059630 Ga0587128_067427 Ga0587128_067427_75_455 119
523 3300059639 Ga0587062_048139 Ga0587062_048139_92_472 119
524 3300059641 Ga0587068_067412 Ga0587068_067412_239_619 119
525 3300059643 Ga0587072_046549 Ga0587072_046549_237_617 119
526 3300059644 Ga0587075_038274 Ga0587075_038274_181_561 119
527 3300059647 Ga0587079_111768 Ga0587079_111768_242_631 119
528 3300059647 Ga0587079_154532 Ga0587079_154532_166_546 119
529 3300059647 Ga0587079_160676 Ga0587079_160676_166_546 119
530 3300059648 Ga0587100_019016 Ga0587100_019016_234_614 119
531 3300059649 Ga0587102_020847 Ga0587102_020847_128_508 119
532 3300060344 Ga0587071_091763 Ga0587071_091763_77_457 119
533 3300031249 Ga0265339_10005937 Ga0265339_100059377 120
534 3300046460 Ga0495638_0177726 Ga0495638_0177726_125_487 120
535 3300047472 Ga0495686_0256988 Ga0495686_0256988_549_911 120
536 3300048913 Ga0496110_0476009 Ga0496110_0476009_565_957 120
537 3300048915 Ga0496112_0168341 Ga0496112_0168341_1332_1724 120
538 3300048920 Ga0496117_0087639 Ga0496117_0087639_370_732 120
539 3300048921 Ga0496118_0161095 Ga0496118_0161095_715_1077 120
540 3300048923 Ga0496120_0238079 Ga0496120_0238079_28_390 120
541 3300048924 Ga0496121_0005356 Ga0496121_0005356_8777_9139 120
542 3300048929 Ga0496126_0112404 Ga0496126_0112404_644_1006 120
543 3300053092 Ga0500583_0204578 Ga0500583_0204578_271_633 120
544 3300053093 Ga0500651_0019749 Ga0500651_0019749_1584_1946 120
545 3300053116 Ga0500592_012679 Ga0500592_012679_712_1074 120
546 3300053119 Ga0500595_000324 Ga0500595_000324_24267_24629 120
547 3300053119 Ga0500595_008462 Ga0500595_008462_3178_3540 120
548 3300053130 Ga0500642_0267798 Ga0500642_0267798_216_578 120
549 3300053139 Ga0500568_0063633 Ga0500568_0063633_966_1328 120
550 3300053156 Ga0500622_0043989 Ga0500622_0043989_1694_2056 120
551 3300053158 Ga0500627_0051674 Ga0500627_0051674_1362_1724 120
552 3300053731 Ga0500609_010225 Ga0500609_010225_306_668 120
553 3300059477 Ga0587084_054184 Ga0587084_054184_234_596 120
554 3300059512 Ga0587092_063825 Ga0587092_063825_234_626 120
555 3300059639 Ga0587062_046038 Ga0587062_046038_91_483 120
556 3300059645 Ga0587076_069391 Ga0587076_069391_116_502 120
557 3300005327 Ga0070658_10055755 Ga0070658_100557552 121
558 3300030863 Ga0265766_1012464 Ga0265766_10124642 121
559 3300046477 Ga0495664_0769276 Ga0495664_0769276_154_522 121
560 3300046559 Ga0495667_0863218 Ga0495667_0863218_20_388 121
561 3300053177 Ga0500636_0005118 Ga0500636_0005118_4439_4807 121
562 3300059511 Ga0587091_132249 Ga0587091_132249_22_390 121
563 3300060346 Ga0587111_0100415 Ga0587111_0100415_246_614 121
564 3300027357 Ga0209589_1000003 Ga0209589_1000003593 122
565 3300027361 Ga0209489_100003 Ga0209489_100003644 122
566 3300027363 Ga0209700_100003 Ga0209700_100003644 122
567 3300053724 Ga0500570_114053 Ga0500570_114053_675_1043 122
568 3300059623 Ga0587101_088554 Ga0587101_088554_71_442 123
569 3300059642 Ga0587069_102436 Ga0587069_102436_18_437 123
570 3300003203 JGI25406J46586_10000104 JGI25406J46586_1000010425 124
571 3300005985 Ga0081539_10000273 Ga0081539_10000273117 124
572 3300009551 Ga0105238_10672549 Ga0105238_106725493 124
573 3300025924 Ga0207694_10574160 Ga0207694_105741602 124
574 3300031456 Ga0307513_10573714 Ga0307513_105737142 124
575 3300046507 Ga0495606_0008403 Ga0495606_0008403_677_1051 124
576 3300048915 Ga0496112_0000021 Ga0496112_0000021_114947_115321 124

Structural Annotation

Top 5 Hits

ID Description Score Start End
6roc-assembly1.cif.gz_A crystal structure of borrelia burgdorferi outer surface protein bba69, mutant leu214met (se-met data) 0.3013 21 115
5ud6-assembly1.cif.gz_B crystal structure of dhdps from cyanidioschyzon merolae with lysine bound 0.2859 33 109
7qbd-assembly2.cif.gz_B tc:cd320 in complex with nanobody tc-nb26 0.2653 34 122
3qc9-assembly2.cif.gz_C crystal structure of cross-linked bovine grk1 t8c/n480c double mutant complexed with adp and mg 0.2527 19 113
7sqc-assembly1.cif.gz_2L ciliary c1 central pair apparatus isolated from chlamydomonas reinhardtii 0.2504 4 123
ID Description Score Start End Superfamily
af_Q9Y149_1_73_1.10.246.20 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.6225 26 103 1.10.246.20
af_Q9Y149_1_73_1.10.246.20 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.5874 26 103 1.10.246.20
af_Q8IEE5_502_911_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5859 22 63 3.40.50.300
af_Q8II85_1121_1232_1.10.472.30 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain 0.4704 25 101 1.10.472.30
af_Q0WVQ3_63_166_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4442 34 110 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A1H5HZU4-F1-model_v4 HdeA/HdeB family protein 0.9767 29 123
AF-A0A1I4NNI5-F1-model_v4 deleted 0.9032 25 121
AF-M4Z9K7-F1-model_v4 Uncharacterized protein 0.8992 45 121
AF-M4Z9K7-F1-model_v4 Uncharacterized protein 0.8882 45 121
AF-A0A370R703-F1-model_v4 deleted 0.8802 19 121

Feature Viewer

pLDDT pTM Quality
84.28 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map