F465393

General Info

Members Datasets Scaffolds Average Seq Length
575 333 1150 169

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10026381|Ga0114129_100263812
Length 193
Sequence MYATLAVAVQRRRARERVMEFDVTVEIPKGHRNKYEMDHVTGRIRLDRTLFTATQYPADYGFIEGTLGEDGDPLDALVLVQEPTFPGCLIRCRTIGMFRMRDEKGGDDKVLCVPAYDPRLEHLRDIHHVAEFDRLEIQHFFEVYKDLEPGKSVEGATWAGRADAEAEIRASYARHETMAHGSTGDPPDLGVEV

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
62 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
66 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
67 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
121 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
122 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
123 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
124 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
147 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
148 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
269 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
270 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2501939600 Micromonospora sp. L5 Isolate Unclassified
277 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
278 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
279 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
280 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
281 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
282 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
283 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
284 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
285 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
286 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
287 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
288 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
289 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
290 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
291 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
292 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
293 2855683550 Micromonospora sp. RP3T Isolate Unclassified
294 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
295 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
296 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
297 2858868258 Micromonospora sp. MH33 Isolate Unclassified
298 2858882152 Micromonospora noduli MED15 Isolate Nodule
299 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
300 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
301 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
302 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
303 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
304 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
305 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
306 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
307 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
308 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
309 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
310 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
311 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
312 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
313 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
314 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
315 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
316 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
317 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
318 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
319 2902582711 Micromonospora sp. AP08 Isolate Unclassified
320 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
321 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
322 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
323 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
324 649633069 Micromonospora sp. L5 Isolate Unclassified
325 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
326 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
327 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
328 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
329 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
330 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
331 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
332 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
333 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.65
Metatranscriptomes 2.26
Isolates 10.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 1.04
Rhizoplane 6.78
Rhizosphere 81.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10026381 3300009147 Bacteria 8226
2 JGI24737J22298_10159974 3300001990 Bacteria 665
3 JGI25406J46586_10018365 3300003203 Bacteria 2874
4 Ga0070683_100006167 3300005329 Bacteria 10052
5 Ga0070683_100341080 3300005329 Bacteria 1427
6 Ga0070666_10001304 3300005335 Bacteria 15098
7 Ga0070680_100056034 3300005336 Bacteria 3221
8 Ga0070680_100186047 3300005336 Bacteria 1750
9 Ga0070682_100342407 3300005337 Bacteria 1112
10 Ga0070660_100009776 3300005339 Bacteria 6757
11 Ga0070660_100093993 3300005339 Bacteria 2368
12 Ga0070660_101334738 3300005339 Bacteria 609
13 Ga0070689_100293587 3300005340 Bacteria 1351
14 Ga0070661_100145343 3300005344 Bacteria 1790
15 Ga0070668_100066642 3300005347 Bacteria 2794
16 Ga0070675_100510304 3300005354 Bacteria 1084
17 Ga0070675_100679781 3300005354 Bacteria 937
18 Ga0070671_100000909 3300005355 Bacteria 21598
19 Ga0070671_100018635 3300005355 Bacteria 5640
20 Ga0070667_100006849 3300005367 Bacteria 9466
21 Ga0070714_100076572 3300005435 Bacteria 2905
22 Ga0070714_100894959 3300005435 Bacteria 862
23 Ga0070714_101408156 3300005435 Bacteria 681
24 Ga0070713_100012059 3300005436 Bacteria 6328
25 Ga0070713_100203501 3300005436 Bacteria 1789
26 Ga0070710_10199392 3300005437 Bacteria 1263
27 Ga0070711_100543981 3300005439 Bacteria 962
28 Ga0070700_100000052 3300005441 Bacteria 85282
29 Ga0070708_100556506 3300005445 Bacteria 1082
30 Ga0070678_100365459 3300005456 Bacteria 1244
31 Ga0070681_10224562 3300005458 Bacteria 1793
32 Ga0070706_100093352 3300005467 Bacteria 2792
33 Ga0070707_100006497 3300005468 Bacteria 10858
34 Ga0070707_100118364 3300005468 Bacteria 2571
35 Ga0070698_100011034 3300005471 Bacteria 9603
36 Ga0070698_100070821 3300005471 Bacteria 3498
37 Ga0070679_100026529 3300005530 Bacteria 5693
38 Ga0070684_100207840 3300005535 Bacteria 1784
39 Ga0070697_100114733 3300005536 Bacteria 2248
40 Ga0070697_100685045 3300005536 Bacteria 904
41 Ga0070693_100135282 3300005547 Bacteria 1545
42 Ga0070665_100000401 3300005548 Bacteria 63343
43 Ga0070665_100017820 3300005548 Bacteria 7129
44 Ga0070665_100165898 3300005548 Bacteria 2211
45 Ga0070665_100177773 3300005548 Bacteria 2129
46 Ga0068857_100123458 3300005577 Bacteria 2333
47 Ga0068857_100173457 3300005577 Bacteria 1961
48 Ga0068854_100161716 3300005578 Bacteria 1735
49 Ga0068852_100008217 3300005616 Bacteria 7670
50 Ga0068859_100050567 3300005617 Bacteria 4174
51 Ga0068859_101257551 3300005617 Bacteria 815
52 Ga0068863_100004961 3300005841 Bacteria 13117
53 Ga0068863_100028576 3300005841 Bacteria 5324
54 Ga0068858_100020391 3300005842 Bacteria 6200
55 Ga0068860_100000114 3300005843 Bacteria 128789
56 Ga0068860_100102210 3300005843 Bacteria 2735
57 Ga0081455_10175681 3300005937 Bacteria 1626
58 Ga0081455_10361122 3300005937 Bacteria 1021
59 Ga0081540_1136439 3300005983 Bacteria 992
60 Ga0081539_10001096 3300005985 Bacteria 49234
61 Ga0070717_10013137 3300006028 Bacteria 6329
62 Ga0070717_10073383 3300006028 Bacteria 2860
63 Ga0070717_10112107 3300006028 Bacteria 2328
64 Ga0070717_10197980 3300006028 Bacteria 1758
65 Ga0070717_11392506 3300006028 Bacteria 637
66 Ga0070712_100183835 3300006175 Bacteria 1631
67 Ga0070712_100234657 3300006175 Bacteria 1458
68 Ga0097621_100246081 3300006237 Bacteria 1565
69 Ga0097621_100326243 3300006237 Bacteria 1361
70 Ga0075428_100000071 3300006844 Bacteria 82288
71 Ga0075428_100007534 3300006844 Bacteria 12066
72 Ga0075428_100013717 3300006844 Bacteria 9023
73 Ga0075428_100070199 3300006844 Bacteria 3830
74 Ga0075428_100449225 3300006844 Bacteria 1381
75 Ga0075428_100504900 3300006844 Bacteria 1294
76 Ga0075428_100532283 3300006844 Bacteria 1256
77 Ga0075428_100931491 3300006844 Bacteria 921
78 Ga0075430_100000279 3300006846 Bacteria 35927
79 Ga0075430_100017562 3300006846 Bacteria 6093
80 Ga0075430_100096539 3300006846 Bacteria 2470
81 Ga0075430_100175544 3300006846 Bacteria 1783
82 Ga0075430_100814240 3300006846 Bacteria 770
83 Ga0075431_100021138 3300006847 Bacteria 6650
84 Ga0075431_100116349 3300006847 Bacteria 2760
85 Ga0075431_100117596 3300006847 Bacteria 2743
86 Ga0075431_100243011 3300006847 Bacteria 1831
87 Ga0075431_100276187 3300006847 Bacteria 1702
88 Ga0075431_100291597 3300006847 Bacteria 1650
89 Ga0075431_100309415 3300006847 Bacteria 1595
90 Ga0075431_100425909 3300006847 Bacteria 1326
91 Ga0075431_100434285 3300006847 Bacteria 1311
92 Ga0075433_10066225 3300006852 Bacteria 3169
93 Ga0075434_100052100 3300006871 Bacteria 4066
94 Ga0075434_100787756 3300006871 Bacteria 967
95 Ga0075429_100006139 3300006880 Bacteria 10387
96 Ga0075429_100017651 3300006880 Bacteria 6171
97 Ga0075429_100090015 3300006880 Bacteria 2676
98 Ga0075429_100340692 3300006880 Bacteria 1312
99 Ga0075429_100469401 3300006880 Bacteria 1102
100 Ga0075436_100013649 3300006914 Bacteria 5565
101 Ga0097620_100050568 3300006931 Bacteria 4174
102 Ga0097620_101257541 3300006931 Bacteria 815
103 Ga0075435_100229709 3300007076 Bacteria 1576
104 Ga0105240_10003545 3300009093 Bacteria 24217
105 Ga0105240_10775746 3300009093 Bacteria 1040
106 Ga0111539_10396003 3300009094 Bacteria 1608
107 Ga0111539_11381574 3300009094 Bacteria 817
108 Ga0105245_10025966 3300009098 Bacteria 5154
109 Ga0114129_10001523 3300009147 Bacteria 31386
110 Ga0114129_10007655 3300009147 Bacteria 15375
111 Ga0114129_10014442 3300009147 Bacteria 11253
112 Ga0114129_10354160 3300009147 Bacteria 1944
113 Ga0114129_10828438 3300009147 Bacteria 1178
114 Ga0105241_11287612 3300009174 Bacteria 696
115 Ga0105242_11675950 3300009176 Bacteria 671
116 Ga0105248_11436032 3300009177 Bacteria 781
117 Ga0105248_12477990 3300009177 Bacteria 591
118 Ga0105237_10367540 3300009545 Bacteria 1443
119 Ga0105249_10191502 3300009553 Bacteria 1996
120 Ga0105249_10507199 3300009553 Bacteria 1252
121 Ga0105249_10564964 3300009553 Bacteria 1190
122 Ga0105249_10931116 3300009553 Bacteria 936
123 Ga0105035_107231 3300009988 Bacteria 931
124 Ga0105028_133552 3300009993 Bacteria 574
125 Ga0099796_10078588 3300010159 Bacteria 1205
126 Ga0105239_10616174 3300010375 Bacteria 1238
127 Ga0105239_10890171 3300010375 Bacteria 1022
128 Ga0157320_1000833 3300012481 Bacteria 1389
129 Ga0157325_1014206 3300012485 Bacteria 636
130 Ga0157338_1023056 3300012515 Bacteria 741
131 Ga0157373_10238575 3300013100 Bacteria 1285
132 Ga0157370_10023120 3300013104 Bacteria 6179
133 Ga0157369_10045601 3300013105 Bacteria 4766
134 Ga0157369_10138768 3300013105 Bacteria 2573
135 Ga0157369_11387515 3300013105 Bacteria 715
136 Ga0157374_10309998 3300013296 Bacteria 1562
137 Ga0157372_11142607 3300013307 Bacteria 901
138 Ga0157375_10120911 3300013308 Bacteria 2728
139 Ga0157515_127667 3300013875 Bacteria 828
140 Ga0163163_10101642 3300014325 Bacteria 2897
141 Ga0163163_10256944 3300014325 Bacteria 1798
142 Ga0163163_10691643 3300014325 Bacteria 1083
143 Ga0163163_11366537 3300014325 Bacteria 770
144 Ga0157379_10013850 3300014968 Bacteria 7069
145 Ga0157379_10014449 3300014968 Bacteria 6929
146 Ga0157379_10205170 3300014968 Bacteria 1783
147 Ga0157376_11140970 3300014969 Bacteria 806
148 Ga0197907_10480815 3300020069 Bacteria 623
149 Ga0197907_10774859 3300020069 Bacteria 805
150 Ga0197907_10970541 3300020069 Bacteria 683
151 Ga0206356_11172772 3300020070 Bacteria 1256
152 Ga0206356_11273699 3300020070 Bacteria 1065
153 Ga0206355_1695636 3300020076 Bacteria 805
154 Ga0206354_10239597 3300020081 Bacteria 862
155 Ga0206353_10344478 3300020082 Bacteria 1891
156 Ga0206353_11436168 3300020082 Bacteria 873
157 Ga0206353_11919446 3300020082 Bacteria 1519
158 Ga0213873_10089063 3300021358 Bacteria 874
159 Ga0213876_10001852 3300021384 Bacteria 12746
160 Ga0213875_10000715 3300021388 Bacteria 25429
161 Ga0224712_10001883 3300022467 Bacteria 5045
162 Ga0207692_10000190 3300025898 Bacteria 20137
163 Ga0207692_10017993 3300025898 Bacteria 3163
164 Ga0207692_10328462 3300025898 Bacteria 938
165 Ga0207680_10012623 3300025903 Bacteria 4310
166 Ga0207685_10004577 3300025905 Bacteria 3539
167 Ga0207705_10061671 3300025909 Bacteria 2708
168 Ga0207684_10000864 3300025910 Bacteria 34633
169 Ga0207684_10747406 3300025910 Bacteria 829
170 Ga0207707_10170238 3300025912 Bacteria 1903
171 Ga0207695_10168780 3300025913 Bacteria 2115
172 Ga0207695_10382718 3300025913 Bacteria 1293
173 Ga0207671_10570202 3300025914 Bacteria 902
174 Ga0207693_10183864 3300025915 Bacteria 1645
175 Ga0207663_10512028 3300025916 Bacteria 933
176 Ga0207663_10759002 3300025916 Bacteria 771
177 Ga0207660_10027115 3300025917 Bacteria 3906
178 Ga0207657_10065227 3300025919 Bacteria 3105
179 Ga0207657_10346474 3300025919 Bacteria 1172
180 Ga0207657_10994091 3300025919 Bacteria 644
181 Ga0207649_10296449 3300025920 Bacteria 1181
182 Ga0207649_10785562 3300025920 Bacteria 742
183 Ga0207646_10039054 3300025922 Bacteria 4271
184 Ga0207646_10213103 3300025922 Bacteria 1745
185 Ga0207700_10009292 3300025928 Bacteria 6133
186 Ga0207700_10162013 3300025928 Bacteria 1858
187 Ga0207700_11172720 3300025928 Bacteria 686
188 Ga0207664_10011850 3300025929 Bacteria 6218
189 Ga0207664_10286945 3300025929 Bacteria 1445
190 Ga0207664_10489664 3300025929 Bacteria 1100
191 Ga0207664_10589672 3300025929 Bacteria 998
192 Ga0207644_10000893 3300025931 Bacteria 18858
193 Ga0207644_10016064 3300025931 Bacteria 5034
194 Ga0207706_10021009 3300025933 Bacteria 5864
195 Ga0207711_10035304 3300025941 Bacteria 4238
196 Ga0207661_10005578 3300025944 Bacteria 8874
197 Ga0207661_10256172 3300025944 Bacteria 1557
198 Ga0207661_10439706 3300025944 Bacteria 1187
199 Ga0207679_10043069 3300025945 Bacteria 3248
200 Ga0207712_10761240 3300025961 Bacteria 849
201 Ga0207712_10807802 3300025961 Bacteria 825
202 Ga0207668_10038118 3300025972 Bacteria 3223
203 Ga0207668_10060104 3300025972 Bacteria 2666
204 Ga0207658_10005173 3300025986 Bacteria 8987
205 Ga0207703_10649604 3300026035 Bacteria 1001
206 Ga0207639_10225998 3300026041 Bacteria 1619
207 Ga0207678_10352632 3300026067 Bacteria 1269
208 Ga0207708_10000495 3300026075 Bacteria 30285
209 Ga0207641_10004666 3300026088 Bacteria 11822
210 Ga0207641_10011277 3300026088 Bacteria 7332
211 Ga0207674_10138493 3300026116 Bacteria 2394
212 Ga0207674_10184778 3300026116 Bacteria 2035
213 Ga0207674_10633496 3300026116 Bacteria 1032
214 Ga0268266_10007377 3300028379 Bacteria 9929
215 Ga0268266_10015134 3300028379 Bacteria 6624
216 Ga0268266_10145285 3300028379 Bacteria 2132
217 Ga0268264_10000147 3300028381 Bacteria 164790
218 Ga0268264_10026182 3300028381 Bacteria 4764
219 Ga0268264_10775725 3300028381 Bacteria 956
220 Ga0268264_11105586 3300028381 Bacteria 801
221 Ga0265338_10163074 3300028800 Bacteria 1719
222 Ga0316177_1031012 3300030731 Bacteria 8127
223 Ga0316176_1068288 3300030732 Bacteria 9170
224 Ga0314311_1167261 3300030733 Bacteria 4975
225 Ga0316178_1146583 3300030735 Bacteria 695
226 Ga0316180_1066787 3300030736 Bacteria 1187
227 Ga0265330_10283529 3300031235 Bacteria 698
228 Ga0265325_10014435 3300031241 Bacteria 4464
229 Ga0265340_10005860 3300031247 Bacteria 6799
230 Ga0307509_10084651 3300031507 Bacteria 3266
231 Ga0307408_100777661 3300031548 Bacteria 867
232 Ga0307408_101708928 3300031548 Bacteria 600
233 Ga0265313_10044261 3300031595 Bacteria 2174
234 Ga0316575_10106585 3300031665 Bacteria 1141
235 Ga0316579_10011102 3300031691 Bacteria 3822
236 Ga0316579_10060603 3300031691 Bacteria 1780
237 Ga0265314_10326609 3300031711 Bacteria 852
238 Ga0265342_10031610 3300031712 Bacteria 3271
239 Ga0316576_10051283 3300031727 Bacteria 3002
240 Ga0316576_10060518 3300031727 Bacteria 2774
241 Ga0316576_10122112 3300031727 Bacteria 1957
242 Ga0316578_10000611 3300031728 Bacteria 12514
243 Ga0316578_10135322 3300031728 Bacteria 1483
244 Ga0316577_10020948 3300031733 Bacteria 3623
245 Ga0307413_10329974 3300031824 Bacteria 1169
246 Ga0307410_10024807 3300031852 Bacteria 3752
247 Ga0307410_10797412 3300031852 Bacteria 803
248 Ga0307406_10109911 3300031901 Bacteria 1896
249 Ga0307406_10258883 3300031901 Bacteria 1315
250 Ga0307406_10949611 3300031901 Bacteria 735
251 Ga0307407_11029970 3300031903 Bacteria 637
252 Ga0307409_100243305 3300031995 Bacteria 1639
253 Ga0307409_100605026 3300031995 Bacteria 1084
254 Ga0307409_100877376 3300031995 Bacteria 909
255 Ga0307409_100927469 3300031995 Bacteria 886
256 Ga0307414_11236380 3300032004 Bacteria 692
257 Ga0307415_100065636 3300032126 Bacteria 2530
258 Ga0307415_100082150 3300032126 Bacteria 2304
259 Ga0316583_10032017 3300032133 Bacteria 1870
260 Ga0316585_10039065 3300032137 Bacteria 1508
261 Ga0316580_10018370 3300032139 Bacteria 2150
262 Ga0316588_1117898 3300033528 Bacteria 670
263 Ga0316596_1049199 3300033541 Bacteria 1115
264 Ga0373959_0067681 3300034820 Bacteria 802
265 Ga0373953_0120864 3300035117 Bacteria 1112
266 Ga0373956_0129801 3300035119 Bacteria 1180
267 Ga0316574_0001403 3300035398 Bacteria 11396
268 Ga0316574_0271320 3300035398 Bacteria 1082
269 Ga0373931_0145332 3300035691 Bacteria 1378
270 Ga0373935_0421005 3300035692 Bacteria 961
271 Ga0373947_0465430 3300035725 Bacteria 857
272 Ga0373937_0272772 3300036401 Bacteria 1597
273 Ga0373937_0613622 3300036401 Bacteria 1032
274 Ga0316584_0000468 3300036712 Bacteria 21119
275 Ga0373925_0256263 3300037068 Bacteria 1404
276 Ga0373925_0481817 3300037068 Bacteria 1018
277 Ga0395899_0075345 3300037312 Bacteria 2464
278 Ga0395899_0395199 3300037312 Bacteria 916
279 Ga0395900_0003683 3300037418 Bacteria 16474
280 Ga0395900_0058886 3300037418 Bacteria 3955
281 Ga0395898_0004120 3300037466 Bacteria 15943
282 Ga0395898_0059634 3300037466 Bacteria 3711
283 Ga0395905_0008666 3300037471 Bacteria 10019
284 Ga0395905_0025209 3300037471 Bacteria 5609
285 Ga0395905_0500849 3300037471 Bacteria 1115
286 Ga0316581_0004256 3300037588 Bacteria 3638
287 Ga0436364_1059010 3300037853 Bacteria 60327
288 Ga0395901_0007250 3300038443 Bacteria 11187
289 Ga0395901_0078662 3300038443 Bacteria 3443
290 Ga0395901_0148459 3300038443 Bacteria 2464
291 Ga0395901_0302158 3300038443 Bacteria 1659
292 Ga0400486_26016 3300038742 Bacteria 85615
293 Ga0436365_1121404 3300039437 Bacteria 19951
294 Ga0436363_0004337 3300039450 Bacteria 592
295 Ga0436362_1023230 3300039453 Bacteria 1022
296 Ga0439455_0104989 3300042012 Bacteria 783
297 Ga0439455_0113186 3300042012 Bacteria 756
298 Ga0466969_0024617 3300044656 Bacteria 3096
299 Ga0466972_0001447 3300044658 Bacteria 11536
300 Ga0466972_0003187 3300044658 Bacteria 8147
301 Ga0466972_0212568 3300044658 Bacteria 905
302 Ga0466965_0024375 3300044683 Bacteria 2926
303 Ga0466965_0050889 3300044683 Bacteria 2054
304 Ga0466965_0251503 3300044683 Bacteria 948
305 Ga0466966_0007222 3300044684 Bacteria 7363
306 Ga0466961_0012581 3300044693 Bacteria 5417
307 Ga0466961_0072937 3300044693 Bacteria 2177
308 Ga0466963_0007059 3300044694 Bacteria 6687
309 Ga0466963_0021972 3300044694 Bacteria 4034
310 Ga0466963_0047580 3300044694 Bacteria 2831
311 Ga0466963_0124673 3300044694 Bacteria 1775
312 Ga0466963_0184783 3300044694 Bacteria 1456
313 Ga0466963_0185223 3300044694 Bacteria 1454
314 Ga0466963_0221034 3300044694 Bacteria 1326
315 Ga0466963_0620377 3300044694 Bacteria 763
316 Ga0466963_0648406 3300044694 Bacteria 745
317 Ga0466963_0947925 3300044694 Bacteria 606
318 Ga0466964_0079224 3300044706 Bacteria 1406
319 Ga0466964_0392516 3300044706 Bacteria 723
320 Ga0466971_0005777 3300044719 Bacteria 5381
321 Ga0466971_0061939 3300044719 Bacteria 1693
322 Ga0466968_0105287 3300044735 Bacteria 1263
323 Ga0466968_0509258 3300044735 Bacteria 600
324 Ga0466970_0003648 3300044765 Bacteria 7507
325 Ga0466970_0014831 3300044765 Bacteria 4005
326 Ga0466970_0055931 3300044765 Bacteria 2108
327 Ga0466970_0061679 3300044765 Bacteria 2009
328 Ga0466970_0074495 3300044765 Bacteria 1827
329 Ga0466957_0199317 3300044842 Bacteria 1314
330 Ga0466957_0326263 3300044842 Bacteria 1037
331 Ga0466957_0643077 3300044842 Bacteria 745
332 Ga0466957_1272041 3300044842 Bacteria 533
333 Ga0466960_0001345 3300044901 Bacteria 8935
334 Ga0466960_0034911 3300044901 Bacteria 2346
335 Ga0466960_0106020 3300044901 Bacteria 1453
336 Ga0466960_0584263 3300044901 Bacteria 662
337 Ga0466959_0049306 3300045049 Bacteria 3093
338 Ga0466958_0014280 3300045836 Bacteria 4535
339 Ga0466958_0108316 3300045836 Bacteria 1733
340 Ga0466967_0001202 3300045976 Bacteria 14567
341 Ga0466967_0157138 3300045976 Bacteria 2131
342 Ga0466967_0184704 3300045976 Bacteria 1968
343 Ga0466967_0209938 3300045976 Bacteria 1846
344 Ga0466967_0619292 3300045976 Bacteria 1069
345 Ga0466967_0621374 3300045976 Bacteria 1067
346 Ga0466967_0918455 3300045976 Bacteria 871
347 Ga0466967_1407139 3300045976 Bacteria 695
348 Ga0466967_1511440 3300045976 Bacteria 669
349 Ga0466967_2060360 3300045976 Bacteria 567
350 Ga0495592_0254034 3300046454 Bacteria 1160
351 Ga0495603_0475101 3300046455 Bacteria 716
352 Ga0495641_0146171 3300046461 Bacteria 1056
353 Ga0495641_0272997 3300046461 Bacteria 761
354 Ga0495650_0065405 3300046471 Bacteria 1443
355 Ga0495664_0072393 3300046477 Bacteria 2059
356 Ga0495664_0083447 3300046477 Bacteria 1917
357 Ga0495664_0414598 3300046477 Bacteria 808
358 Ga0495664_0551507 3300046477 Bacteria 687
359 Ga0495606_0000899 3300046507 Bacteria 44298
360 Ga0495618_0383209 3300046514 Bacteria 862
361 Ga0495628_0252252 3300046516 Bacteria 1317
362 Ga0495630_0598585 3300046517 Bacteria 845
363 Ga0495652_0023217 3300046529 Bacteria 5499
364 Ga0495586_0108068 3300046535 Bacteria 1547
365 Ga0495645_0014632 3300046543 Bacteria 5569
366 Ga0495645_0190023 3300046543 Bacteria 1400
367 Ga0495668_0002206 3300046616 Bacteria 16580
368 Ga0495625_0003279 3300046660 Bacteria 16347
369 Ga0495635_0207087 3300046663 Bacteria 1329
370 Ga0495623_0008296 3300046679 Bacteria 6759
371 Ga0495646_0003687 3300046680 Bacteria 9559
372 Ga0495674_0008780 3300047319 Bacteria 9615
373 Ga0495676_0544272 3300047321 Bacteria 759
374 Ga0495593_0248692 3300047673 Bacteria 890
375 Ga0495626_0002553 3300048091 Bacteria 12489
376 Ga0496100_0001193 3300048903 Bacteria 12611
377 Ga0496100_0049526 3300048903 Bacteria 2717
378 Ga0496100_0859209 3300048903 Bacteria 712
379 Ga0496101_0010411 3300048904 Bacteria 6140
380 Ga0496102_0000155 3300048905 Bacteria 92990
381 Ga0496102_0028558 3300048905 Bacteria 4983
382 Ga0496102_0550257 3300048905 Bacteria 1077
383 Ga0496103_0000202 3300048906 Bacteria 59622
384 Ga0496103_0402633 3300048906 Bacteria 879
385 Ga0496104_0002997 3300048907 Bacteria 14550
386 Ga0496104_0144121 3300048907 Bacteria 2288
387 Ga0496104_0585995 3300048907 Bacteria 1026
388 Ga0496105_0006906 3300048908 Bacteria 8738
389 Ga0496105_0030945 3300048908 Bacteria 4387
390 Ga0496106_0066779 3300048909 Bacteria 2740
391 Ga0496106_0164628 3300048909 Bacteria 1755
392 Ga0496107_0020929 3300048910 Bacteria 4623
393 Ga0496107_0221571 3300048910 Bacteria 1407
394 Ga0496108_0198346 3300048911 Bacteria 1741
395 Ga0496108_0229136 3300048911 Bacteria 1615
396 Ga0496109_0071582 3300048912 Bacteria 3184
397 Ga0496109_0080524 3300048912 Bacteria 3000
398 Ga0496109_0101212 3300048912 Bacteria 2674
399 Ga0496109_0178314 3300048912 Bacteria 1995
400 Ga0496109_0194342 3300048912 Bacteria 1907
401 Ga0496109_0243015 3300048912 Bacteria 1694
402 Ga0496109_0495296 3300048912 Bacteria 1153
403 Ga0496110_0061611 3300048913 Bacteria 3312
404 Ga0496110_0082404 3300048913 Bacteria 2869
405 Ga0496111_0622139 3300048914 Bacteria 789
406 Ga0496112_0787423 3300048915 Bacteria 876
407 Ga0496112_1042167 3300048915 Bacteria 737
408 Ga0496113_0149166 3300048916 Bacteria 1844
409 Ga0496113_0321889 3300048916 Bacteria 1239
410 Ga0496113_0813039 3300048916 Bacteria 742
411 Ga0496114_0100825 3300048917 Bacteria 2464
412 Ga0496114_0432563 3300048917 Bacteria 1166
413 Ga0496115_0002856 3300048918 Bacteria 12439
414 Ga0496115_0004689 3300048918 Bacteria 9907
415 Ga0496116_0000241 3300048919 Bacteria 100186
416 Ga0496117_0000529 3300048920 Bacteria 62772
417 Ga0496118_0000265 3300048921 Bacteria 91869
418 Ga0496119_0000456 3300048922 Bacteria 56083
419 Ga0496120_0002051 3300048923 Bacteria 21769
420 Ga0496121_0043202 3300048924 Bacteria 3907
421 Ga0496124_0067710 3300048927 Bacteria 2970
422 Ga0496125_0044744 3300048928 Bacteria 3736
423 Ga0496126_0000381 3300048929 Bacteria 91810
424 Ga0496126_0588135 3300048929 Bacteria 878
425 Ga0501031_0139741 3300049568 Bacteria 1583
426 Ga0501033_0473091 3300049570 Bacteria 869
427 Ga0501034_0011846 3300049571 Bacteria 9027
428 Ga0501037_0032766 3300049573 Bacteria 3839
429 Ga0501038_0340470 3300049574 Bacteria 1170
430 Ga0501038_0340502 3300049574 Bacteria 1170
431 Ga0501040_0107480 3300049576 Bacteria 1950
432 Ga0501043_0673705 3300049579 Bacteria 758
433 Ga0501047_0000088 3300049581 Bacteria 117495
434 Ga0501047_0128504 3300049581 Bacteria 2414
435 Ga0501067_0002216 3300049583 Bacteria 10742
436 Ga0501067_0003186 3300049583 Bacteria 9054
437 Ga0501067_0027899 3300049583 Bacteria 3129
438 Ga0501068_0003259 3300049584 Bacteria 8703
439 Ga0501069_0057678 3300049585 Bacteria 2165
440 Ga0501070_0001724 3300049586 Bacteria 19336
441 Ga0501070_0003386 3300049586 Bacteria 13832
442 Ga0501070_0011997 3300049586 Bacteria 7313
443 Ga0501070_0019513 3300049586 Bacteria 5686
444 Ga0501070_0038276 3300049586 Bacteria 4001
445 Ga0501071_0003311 3300049587 Bacteria 10063
446 Ga0501071_0181716 3300049587 Bacteria 1576
447 Ga0501071_0200992 3300049587 Bacteria 1497
448 Ga0501072_0020471 3300049588 Bacteria 5127
449 Ga0501072_0041037 3300049588 Bacteria 3634
450 Ga0501073_0004509 3300049589 Bacteria 10465
451 Ga0501073_0014684 3300049589 Bacteria 5689
452 Ga0501073_0045647 3300049589 Bacteria 3085
453 Ga0501074_0001348 3300049590 Bacteria 16288
454 Ga0501074_0001368 3300049590 Bacteria 16174
455 Ga0501074_0068069 3300049590 Bacteria 2559
456 Ga0501077_0003752 3300049593 Bacteria 9142
457 Ga0501077_0197182 3300049593 Bacteria 1279
458 Ga0501079_0005763 3300049741 Bacteria 9259
459 Ga0501079_0072634 3300049741 Bacteria 2659
460 Ga0501080_0001111 3300049742 Bacteria 22170
461 Ga0501080_0001728 3300049742 Bacteria 18680
462 Ga0501080_0004256 3300049742 Bacteria 12703
463 Ga0501080_0080741 3300049742 Bacteria 3022
464 Ga0501080_0113206 3300049742 Bacteria 2515
465 Ga0501081_0597601 3300049743 Bacteria 826
466 Ga0501083_0005059 3300049744 Bacteria 9341
467 Ga0501035_0173719 3300049822 Bacteria 1860
468 Ga0501035_0765433 3300049822 Bacteria 774
469 Ga0501044_0390355 3300049823 Bacteria 1306
470 nmdc:mga05p37_1047830_c1 3300050507 Bacteria 861
471 nmdc:mga05p37_174737_c1 3300050507 Bacteria 2618
472 nmdc:mga05p37_250822_c1 3300050507 Bacteria 2123
473 nmdc:mga05p37_27327_c1 3300050507 Bacteria 6947
474 nmdc:mga05p37_27815_c1 3300050507 Bacteria 6888
475 nmdc:mga05p37_59067_c1 3300050507 Bacteria 4724
476 nmdc:mga05p37_765040_c1 3300050507 Bacteria 1062
477 nmdc:mga09592_177780_c1 3300050508 Bacteria 1841
478 nmdc:mga09592_261862_c1 3300050508 Bacteria 1500
479 nmdc:mga09592_393175_c1 3300050508 Bacteria 1199
480 nmdc:mga09592_402544_c1 3300050508 Bacteria 1183
481 nmdc:mga09592_423187_c1 3300050508 Bacteria 1150
482 nmdc:mga09592_656631_c1 3300050508 Bacteria 895
483 nmdc:mga0qj67_315543_c1 3300050509 Bacteria 1266
484 nmdc:mga0qj67_46385_c1 3300050509 Bacteria 3431
485 nmdc:mga0qj67_517_c1 3300050509 Bacteria 26296
486 nmdc:mga06r32_1281194_c1 3300050510 Bacteria 677
487 nmdc:mga06r32_141_c6 3300050510 Bacteria 4405
488 nmdc:mga06r32_187298_c1 3300050510 Bacteria 2057
489 nmdc:mga06r32_19962_c1 3300050510 Bacteria 6161
490 nmdc:mga06r32_247799_c1 3300050510 Bacteria 1769
491 nmdc:mga06r32_630983_c1 3300050510 Bacteria 1041
492 nmdc:mga06r32_80476_c1 3300050510 Bacteria 3170
493 nmdc:mga06r32_808429_c1 3300050510 Bacteria 898
494 nmdc:mga08y16_507664_c1 3300050511 Bacteria 1224
495 nmdc:mga0rr50_18274_c1 3300050513 Bacteria 4705
496 nmdc:mga0a205_74589_c1 3300050515 Bacteria 3278
497 Ga0495601_0583758 3300053077 Bacteria 718
498 Ga0495612_0002970 3300053078 Bacteria 7039
499 Ga0495619_0006039 3300053085 Bacteria 7674
500 Ga0495619_0057352 3300053085 Bacteria 2584
501 Ga0495619_0763729 3300053085 Bacteria 655
502 Ga0500646_0000052 3300053090 Bacteria 32125
503 Ga0500583_0034130 3300053092 Bacteria 2259
504 Ga0500641_0146377 3300053096 Bacteria 1020
505 Ga0500660_122104 3300053100 Bacteria 1082
506 Ga0500594_0135922 3300053118 Bacteria 782
507 Ga0500588_0002738 3300053146 Bacteria 3630
508 Ga0501084_0019768 3300054114 Bacteria 5612
509 Ga0501084_0123328 3300054114 Bacteria 2179
510 Ga0501084_0273354 3300054114 Bacteria 1427
511 Ga0501082_0002800 3300060353 Bacteria 15221
512 Ga0501082_0017784 3300060353 Bacteria 6125
513 Ga0501082_0360070 3300060353 Bacteria 1269
514 Ga0466962_0008705 3300061719 Bacteria 4865
515 Ga0466962_0323637 3300061719 Bacteria 765
516 Ga0530510_0189615 3300061734 Bacteria 1526
517 Ga0530510_1046654 3300061734 Bacteria 625
518 2501944605 2501939600 Bacteria 6907073
519 2515497677 2515154088 Bacteria 5526283
520 2515720404 2515154129 Bacteria 5584369
521 2515757789 2515154137 Bacteria 5711575
522 2516084539 2515154202 Bacteria 5471270
523 2516091597 2515154203 Bacteria 5458536
524 2558911691 2558860112 Bacteria 9931328
525 2623499318 2622736605 Bacteria 4992138
526 2623585453 2622736626 Bacteria 7181580
527 2676490278 2675903060 Bacteria 10051191
528 2734974651 2734482000 Bacteria 5525167
529 2772645272 2772190715 Bacteria 6959372
530 2816505990 2816332139 Bacteria 9138787
531 2831939786 2831935698 Bacteria 5963223
532 2832005847 2832004796 Bacteria 6538017
533 2855672422 2855670206 Bacteria 7120389
534 2855677251 2855676851 Bacteria 7063653
535 2855686248 2855683550 Bacteria 7134265
536 2856859367 2856858025 Bacteria 7255264
537 2857289163 2857288857 Bacteria 7189066
538 2858850285 2858848962 Bacteria 6963058
539 2858874563 2858868258 Bacteria 7683772
540 2858884693 2858882152 Bacteria 7230291
541 2858893354 2858888857 Bacteria 7060307
542 2858898277 2858895516 Bacteria 7378898
543 2858902573 2858902515 Bacteria 7086037
544 2866066330 2866065130 Bacteria 6518152
545 2867306294 2867302475 Bacteria 7087181
546 2867317103 2867312974 Bacteria 7058875
547 2867322925 2867319477 Bacteria 7069771
548 2867510522 2867507094 Bacteria 6506033
549 2869052161 2869048445 Bacteria 6875584
550 2869068261 2869061728 Bacteria 7112407
551 2869073562 2869068681 Bacteria 7205615
552 2870787898 2870782633 Bacteria 9624083
553 2873316128 2873314349 Bacteria 8512634
554 2880494766 2880489317 Bacteria 7096270
555 2880497548 2880495981 Bacteria 7340502
556 2884704097 2884693830 Bacteria 11273186
557 2887485653 2887478801 Bacteria 8972725
558 2891401068 2891395885 Bacteria 9251614
559 2895431880 2895427314 Bacteria 13147766
560 2895448548 2895442618 Bacteria 11027144
561 2902584326 2902582711 Bacteria 6187705
562 2915362479 2915358134 Bacteria 6050864
563 2929226112 2929219909 Bacteria 6984360
564 2929232774 2929226422 Bacteria 7248583
565 2996228135 2996221748 Bacteria 6799777
566 649812768 649633069 Bacteria 6962533
567 8001783062 8001781756 Bacteria 9586736
568 8003834853 8003830390 Bacteria 6541657
569 8003857172 8003856774 Bacteria 7675274
570 8003876630 8003870546 Bacteria 7396674
571 8054473675 8054472261 Bacteria 7464355
572 8054710696 8054704163 Bacteria 7247792
573 8054732398 8054727385 Bacteria 7558670
574 8054739361 8054734606 Bacteria 6947278
575 8055418098 8055412473 Bacteria 6257500
576 Ga0114129_10026381
577 JGI24737J22298_10159974
578 JGI25406J46586_10018365
579 Ga0070683_100006167
580 Ga0070683_100341080
581 Ga0070666_10001304
582 Ga0070680_100056034
583 Ga0070680_100186047
584 Ga0070682_100342407
585 Ga0070660_100009776
586 Ga0070660_100093993
587 Ga0070660_101334738
588 Ga0070689_100293587
589 Ga0070661_100145343
590 Ga0070668_100066642
591 Ga0070675_100510304
592 Ga0070675_100679781
593 Ga0070671_100000909
594 Ga0070671_100018635
595 Ga0070667_100006849
596 Ga0070714_100076572
597 Ga0070714_100894959
598 Ga0070714_101408156
599 Ga0070713_100012059
600 Ga0070713_100203501
601 Ga0070710_10199392
602 Ga0070711_100543981
603 Ga0070700_100000052
604 Ga0070708_100556506
605 Ga0070678_100365459
606 Ga0070681_10224562
607 Ga0070706_100093352
608 Ga0070707_100006497
609 Ga0070707_100118364
610 Ga0070698_100011034
611 Ga0070698_100070821
612 Ga0070679_100026529
613 Ga0070684_100207840
614 Ga0070697_100114733
615 Ga0070697_100685045
616 Ga0070693_100135282
617 Ga0070665_100000401
618 Ga0070665_100017820
619 Ga0070665_100165898
620 Ga0070665_100177773
621 Ga0068857_100123458
622 Ga0068857_100173457
623 Ga0068854_100161716
624 Ga0068852_100008217
625 Ga0068859_100050567
626 Ga0068859_101257551
627 Ga0068863_100004961
628 Ga0068863_100028576
629 Ga0068858_100020391
630 Ga0068860_100000114
631 Ga0068860_100102210
632 Ga0081455_10175681
633 Ga0081455_10361122
634 Ga0081540_1136439
635 Ga0081539_10001096
636 Ga0070717_10013137
637 Ga0070717_10073383
638 Ga0070717_10112107
639 Ga0070717_10197980
640 Ga0070717_11392506
641 Ga0070712_100183835
642 Ga0070712_100234657
643 Ga0097621_100246081
644 Ga0097621_100326243
645 Ga0075428_100000071
646 Ga0075428_100007534
647 Ga0075428_100013717
648 Ga0075428_100070199
649 Ga0075428_100449225
650 Ga0075428_100504900
651 Ga0075428_100532283
652 Ga0075428_100931491
653 Ga0075430_100000279
654 Ga0075430_100017562
655 Ga0075430_100096539
656 Ga0075430_100175544
657 Ga0075430_100814240
658 Ga0075431_100021138
659 Ga0075431_100116349
660 Ga0075431_100117596
661 Ga0075431_100243011
662 Ga0075431_100276187
663 Ga0075431_100291597
664 Ga0075431_100309415
665 Ga0075431_100425909
666 Ga0075431_100434285
667 Ga0075433_10066225
668 Ga0075434_100052100
669 Ga0075434_100787756
670 Ga0075429_100006139
671 Ga0075429_100017651
672 Ga0075429_100090015
673 Ga0075429_100340692
674 Ga0075429_100469401
675 Ga0075436_100013649
676 Ga0097620_100050568
677 Ga0097620_101257541
678 Ga0075435_100229709
679 Ga0105240_10003545
680 Ga0105240_10775746
681 Ga0111539_10396003
682 Ga0111539_11381574
683 Ga0105245_10025966
684 Ga0114129_10001523
685 Ga0114129_10007655
686 Ga0114129_10014442
687 Ga0114129_10354160
688 Ga0114129_10828438
689 Ga0105241_11287612
690 Ga0105242_11675950
691 Ga0105248_11436032
692 Ga0105248_12477990
693 Ga0105237_10367540
694 Ga0105249_10191502
695 Ga0105249_10507199
696 Ga0105249_10564964
697 Ga0105249_10931116
698 Ga0105035_107231
699 Ga0105028_133552
700 Ga0099796_10078588
701 Ga0105239_10616174
702 Ga0105239_10890171
703 Ga0157320_1000833
704 Ga0157325_1014206
705 Ga0157338_1023056
706 Ga0157373_10238575
707 Ga0157370_10023120
708 Ga0157369_10045601
709 Ga0157369_10138768
710 Ga0157369_11387515
711 Ga0157374_10309998
712 Ga0157372_11142607
713 Ga0157375_10120911
714 Ga0157515_127667
715 Ga0163163_10101642
716 Ga0163163_10256944
717 Ga0163163_10691643
718 Ga0163163_11366537
719 Ga0157379_10013850
720 Ga0157379_10014449
721 Ga0157379_10205170
722 Ga0157376_11140970
723 Ga0197907_10480815
724 Ga0197907_10774859
725 Ga0197907_10970541
726 Ga0206356_11172772
727 Ga0206356_11273699
728 Ga0206355_1695636
729 Ga0206354_10239597
730 Ga0206353_10344478
731 Ga0206353_11436168
732 Ga0206353_11919446
733 Ga0213873_10089063
734 Ga0213876_10001852
735 Ga0213875_10000715
736 Ga0224712_10001883
737 Ga0207692_10000190
738 Ga0207692_10017993
739 Ga0207692_10328462
740 Ga0207680_10012623
741 Ga0207685_10004577
742 Ga0207705_10061671
743 Ga0207684_10000864
744 Ga0207684_10747406
745 Ga0207707_10170238
746 Ga0207695_10168780
747 Ga0207695_10382718
748 Ga0207671_10570202
749 Ga0207693_10183864
750 Ga0207663_10512028
751 Ga0207663_10759002
752 Ga0207660_10027115
753 Ga0207657_10065227
754 Ga0207657_10346474
755 Ga0207657_10994091
756 Ga0207649_10296449
757 Ga0207649_10785562
758 Ga0207646_10039054
759 Ga0207646_10213103
760 Ga0207700_10009292
761 Ga0207700_10162013
762 Ga0207700_11172720
763 Ga0207664_10011850
764 Ga0207664_10286945
765 Ga0207664_10489664
766 Ga0207664_10589672
767 Ga0207644_10000893
768 Ga0207644_10016064
769 Ga0207706_10021009
770 Ga0207711_10035304
771 Ga0207661_10005578
772 Ga0207661_10256172
773 Ga0207661_10439706
774 Ga0207679_10043069
775 Ga0207712_10761240
776 Ga0207712_10807802
777 Ga0207668_10038118
778 Ga0207668_10060104
779 Ga0207658_10005173
780 Ga0207703_10649604
781 Ga0207639_10225998
782 Ga0207678_10352632
783 Ga0207708_10000495
784 Ga0207641_10004666
785 Ga0207641_10011277
786 Ga0207674_10138493
787 Ga0207674_10184778
788 Ga0207674_10633496
789 Ga0268266_10007377
790 Ga0268266_10015134
791 Ga0268266_10145285
792 Ga0268264_10000147
793 Ga0268264_10026182
794 Ga0268264_10775725
795 Ga0268264_11105586
796 Ga0265338_10163074
797 Ga0316177_1031012
798 Ga0316176_1068288
799 Ga0314311_1167261
800 Ga0316178_1146583
801 Ga0316180_1066787
802 Ga0265330_10283529
803 Ga0265325_10014435
804 Ga0265340_10005860
805 Ga0307509_10084651
806 Ga0307408_100777661
807 Ga0307408_101708928
808 Ga0265313_10044261
809 Ga0316575_10106585
810 Ga0316579_10011102
811 Ga0316579_10060603
812 Ga0265314_10326609
813 Ga0265342_10031610
814 Ga0316576_10051283
815 Ga0316576_10060518
816 Ga0316576_10122112
817 Ga0316578_10000611
818 Ga0316578_10135322
819 Ga0316577_10020948
820 Ga0307413_10329974
821 Ga0307410_10024807
822 Ga0307410_10797412
823 Ga0307406_10109911
824 Ga0307406_10258883
825 Ga0307406_10949611
826 Ga0307407_11029970
827 Ga0307409_100243305
828 Ga0307409_100605026
829 Ga0307409_100877376
830 Ga0307409_100927469
831 Ga0307414_11236380
832 Ga0307415_100065636
833 Ga0307415_100082150
834 Ga0316583_10032017
835 Ga0316585_10039065
836 Ga0316580_10018370
837 Ga0316588_1117898
838 Ga0316596_1049199
839 Ga0373959_0067681
840 Ga0373953_0120864
841 Ga0373956_0129801
842 Ga0316574_0001403
843 Ga0316574_0271320
844 Ga0373931_0145332
845 Ga0373935_0421005
846 Ga0373947_0465430
847 Ga0373937_0272772
848 Ga0373937_0613622
849 Ga0316584_0000468
850 Ga0373925_0256263
851 Ga0373925_0481817
852 Ga0395899_0075345
853 Ga0395899_0395199
854 Ga0395900_0003683
855 Ga0395900_0058886
856 Ga0395898_0004120
857 Ga0395898_0059634
858 Ga0395905_0008666
859 Ga0395905_0025209
860 Ga0395905_0500849
861 Ga0316581_0004256
862 Ga0436364_1059010
863 Ga0395901_0007250
864 Ga0395901_0078662
865 Ga0395901_0148459
866 Ga0395901_0302158
867 Ga0400486_26016
868 Ga0436365_1121404
869 Ga0436363_0004337
870 Ga0436362_1023230
871 Ga0439455_0104989
872 Ga0439455_0113186
873 Ga0466969_0024617
874 Ga0466972_0001447
875 Ga0466972_0003187
876 Ga0466972_0212568
877 Ga0466965_0024375
878 Ga0466965_0050889
879 Ga0466965_0251503
880 Ga0466966_0007222
881 Ga0466961_0012581
882 Ga0466961_0072937
883 Ga0466963_0007059
884 Ga0466963_0021972
885 Ga0466963_0047580
886 Ga0466963_0124673
887 Ga0466963_0184783
888 Ga0466963_0185223
889 Ga0466963_0221034
890 Ga0466963_0620377
891 Ga0466963_0648406
892 Ga0466963_0947925
893 Ga0466964_0079224
894 Ga0466964_0392516
895 Ga0466971_0005777
896 Ga0466971_0061939
897 Ga0466968_0105287
898 Ga0466968_0509258
899 Ga0466970_0003648
900 Ga0466970_0014831
901 Ga0466970_0055931
902 Ga0466970_0061679
903 Ga0466970_0074495
904 Ga0466957_0199317
905 Ga0466957_0326263
906 Ga0466957_0643077
907 Ga0466957_1272041
908 Ga0466960_0001345
909 Ga0466960_0034911
910 Ga0466960_0106020
911 Ga0466960_0584263
912 Ga0466959_0049306
913 Ga0466958_0014280
914 Ga0466958_0108316
915 Ga0466967_0001202
916 Ga0466967_0157138
917 Ga0466967_0184704
918 Ga0466967_0209938
919 Ga0466967_0619292
920 Ga0466967_0621374
921 Ga0466967_0918455
922 Ga0466967_1407139
923 Ga0466967_1511440
924 Ga0466967_2060360
925 Ga0495592_0254034
926 Ga0495603_0475101
927 Ga0495641_0146171
928 Ga0495641_0272997
929 Ga0495650_0065405
930 Ga0495664_0072393
931 Ga0495664_0083447
932 Ga0495664_0414598
933 Ga0495664_0551507
934 Ga0495606_0000899
935 Ga0495618_0383209
936 Ga0495628_0252252
937 Ga0495630_0598585
938 Ga0495652_0023217
939 Ga0495586_0108068
940 Ga0495645_0014632
941 Ga0495645_0190023
942 Ga0495668_0002206
943 Ga0495625_0003279
944 Ga0495635_0207087
945 Ga0495623_0008296
946 Ga0495646_0003687
947 Ga0495674_0008780
948 Ga0495676_0544272
949 Ga0495593_0248692
950 Ga0495626_0002553
951 Ga0496100_0001193
952 Ga0496100_0049526
953 Ga0496100_0859209
954 Ga0496101_0010411
955 Ga0496102_0000155
956 Ga0496102_0028558
957 Ga0496102_0550257
958 Ga0496103_0000202
959 Ga0496103_0402633
960 Ga0496104_0002997
961 Ga0496104_0144121
962 Ga0496104_0585995
963 Ga0496105_0006906
964 Ga0496105_0030945
965 Ga0496106_0066779
966 Ga0496106_0164628
967 Ga0496107_0020929
968 Ga0496107_0221571
969 Ga0496108_0198346
970 Ga0496108_0229136
971 Ga0496109_0071582
972 Ga0496109_0080524
973 Ga0496109_0101212
974 Ga0496109_0178314
975 Ga0496109_0194342
976 Ga0496109_0243015
977 Ga0496109_0495296
978 Ga0496110_0061611
979 Ga0496110_0082404
980 Ga0496111_0622139
981 Ga0496112_0787423
982 Ga0496112_1042167
983 Ga0496113_0149166
984 Ga0496113_0321889
985 Ga0496113_0813039
986 Ga0496114_0100825
987 Ga0496114_0432563
988 Ga0496115_0002856
989 Ga0496115_0004689
990 Ga0496116_0000241
991 Ga0496117_0000529
992 Ga0496118_0000265
993 Ga0496119_0000456
994 Ga0496120_0002051
995 Ga0496121_0043202
996 Ga0496124_0067710
997 Ga0496125_0044744
998 Ga0496126_0000381
999 Ga0496126_0588135
1000 Ga0501031_0139741
1001 Ga0501033_0473091
1002 Ga0501034_0011846
1003 Ga0501037_0032766
1004 Ga0501038_0340470
1005 Ga0501038_0340502
1006 Ga0501040_0107480
1007 Ga0501043_0673705
1008 Ga0501047_0000088
1009 Ga0501047_0128504
1010 Ga0501067_0002216
1011 Ga0501067_0003186
1012 Ga0501067_0027899
1013 Ga0501068_0003259
1014 Ga0501069_0057678
1015 Ga0501070_0001724
1016 Ga0501070_0003386
1017 Ga0501070_0011997
1018 Ga0501070_0019513
1019 Ga0501070_0038276
1020 Ga0501071_0003311
1021 Ga0501071_0181716
1022 Ga0501071_0200992
1023 Ga0501072_0020471
1024 Ga0501072_0041037
1025 Ga0501073_0004509
1026 Ga0501073_0014684
1027 Ga0501073_0045647
1028 Ga0501074_0001348
1029 Ga0501074_0001368
1030 Ga0501074_0068069
1031 Ga0501077_0003752
1032 Ga0501077_0197182
1033 Ga0501079_0005763
1034 Ga0501079_0072634
1035 Ga0501080_0001111
1036 Ga0501080_0001728
1037 Ga0501080_0004256
1038 Ga0501080_0080741
1039 Ga0501080_0113206
1040 Ga0501081_0597601
1041 Ga0501083_0005059
1042 Ga0501035_0173719
1043 Ga0501035_0765433
1044 Ga0501044_0390355
1045 nmdc:mga05p37_1047830_c1
1046 nmdc:mga05p37_174737_c1
1047 nmdc:mga05p37_250822_c1
1048 nmdc:mga05p37_27327_c1
1049 nmdc:mga05p37_27815_c1
1050 nmdc:mga05p37_59067_c1
1051 nmdc:mga05p37_765040_c1
1052 nmdc:mga09592_177780_c1
1053 nmdc:mga09592_261862_c1
1054 nmdc:mga09592_393175_c1
1055 nmdc:mga09592_402544_c1
1056 nmdc:mga09592_423187_c1
1057 nmdc:mga09592_656631_c1
1058 nmdc:mga0qj67_315543_c1
1059 nmdc:mga0qj67_46385_c1
1060 nmdc:mga0qj67_517_c1
1061 nmdc:mga06r32_1281194_c1
1062 nmdc:mga06r32_141_c6
1063 nmdc:mga06r32_187298_c1
1064 nmdc:mga06r32_19962_c1
1065 nmdc:mga06r32_247799_c1
1066 nmdc:mga06r32_630983_c1
1067 nmdc:mga06r32_80476_c1
1068 nmdc:mga06r32_808429_c1
1069 nmdc:mga08y16_507664_c1
1070 nmdc:mga0rr50_18274_c1
1071 nmdc:mga0a205_74589_c1
1072 Ga0495601_0583758
1073 Ga0495612_0002970
1074 Ga0495619_0006039
1075 Ga0495619_0057352
1076 Ga0495619_0763729
1077 Ga0500646_0000052
1078 Ga0500583_0034130
1079 Ga0500641_0146377
1080 Ga0500660_122104
1081 Ga0500594_0135922
1082 Ga0500588_0002738
1083 Ga0501084_0019768
1084 Ga0501084_0123328
1085 Ga0501084_0273354
1086 Ga0501082_0002800
1087 Ga0501082_0017784
1088 Ga0501082_0360070
1089 Ga0466962_0008705
1090 Ga0466962_0323637
1091 Ga0530510_0189615
1092 Ga0530510_1046654
1093 2501944605
1094 2515497677
1095 2515720404
1096 2515757789
1097 2516084539
1098 2516091597
1099 2558911691
1100 2623499318
1101 2623585453
1102 2676490278
1103 2734974651
1104 2772645272
1105 2816505990
1106 2831939786
1107 2832005847
1108 2855672422
1109 2855677251
1110 2855686248
1111 2856859367
1112 2857289163
1113 2858850285
1114 2858874563
1115 2858884693
1116 2858893354
1117 2858898277
1118 2858902573
1119 2866066330
1120 2867306294
1121 2867317103
1122 2867322925
1123 2867510522
1124 2869052161
1125 2869068261
1126 2869073562
1127 2870787898
1128 2873316128
1129 2880494766
1130 2880497548
1131 2884704097
1132 2887485653
1133 2891401068
1134 2895431880
1135 2895448548
1136 2902584326
1137 2915362479
1138 2929226112
1139 2929232774
1140 2996228135
1141 649812768
1142 8001783062
1143 8003834853
1144 8003857172
1145 8003876630
1146 8054473675
1147 8054710696
1148 8054732398
1149 8054739361
1150 8055418098

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

23

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ld3-assembly1.cif.gz_A crystal structure of inorganic phosphatase from anaplasma phagocytophilum at 1.75a resolution 0.9742 2 158
1mjz-assembly1.cif.gz_A structure of inorganic pyrophosphatase mutant d97n 0.9713 2 158
2au6-assembly1.cif.gz_A crystal structure of catalytic intermediate of inorganic pyrophosphatase 0.9712 2 158
4um4-assembly1.cif.gz_B structure of inorganic pyrophosphatase from escherichia coli in complex with sulfate 0.9699 2 157
2au7-assembly1.cif.gz_A the r43q active site variant of e.coli inorganic pyrophosphatase 0.9686 2 158
ID Description Score Start End Superfamily
4z71B00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9668 1 158 3.90.80.10
1i40A00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9652 2 159 3.90.80.10
2prdA00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9553 2 158 3.90.80.10
3emjE00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9451 3 155 3.90.80.10
3q5vB00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.9414 2 159 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A538N2F7-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9939 44 164 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A1C6RV02-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9921 1 164 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A376EYW7-F1-model_v4 deleted 0.9918 1 161
AF-A0A7K3W6Z6-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9887 1 162 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A3B0AVR5-F1-model_v4 Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) 0.9886 1 160 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Map