F465393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 575 | 333 | 1150 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10026381|Ga0114129_100263812 |
| Length | 193 |
| Sequence | MYATLAVAVQRRRARERVMEFDVTVEIPKGHRNKYEMDHVTGRIRLDRTLFTATQYPADYGFIEGTLGEDGDPLDALVLVQEPTFPGCLIRCRTIGMFRMRDEKGGDDKVLCVPAYDPRLEHLRDIHHVAEFDRLEIQHFFEVYKDLEPGKSVEGATWAGRADAEAEIRASYARHETMAHGSTGDPPDLGVEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 62 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 63 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 66 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 67 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 81 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 121 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 122 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 123 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 124 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 125 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 126 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 132 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 133 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 136 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 137 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 138 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 146 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 147 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 148 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 154 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 171 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 172 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 173 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 174 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 179 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 184 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 226 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 227 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 228 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 231 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 232 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 267 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 268 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 269 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 270 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 271 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 272 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 275 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 276 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 277 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 278 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 279 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 280 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 281 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 282 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 283 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 284 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 285 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 286 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 287 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 288 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 289 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 290 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 291 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 292 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 293 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 294 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 295 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 296 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 297 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 298 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 299 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 300 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 301 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 302 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 303 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 304 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 305 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 306 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 307 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 308 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 309 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 310 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 311 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 312 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 313 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 314 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 315 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 316 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 317 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 318 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 319 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 320 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 321 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 322 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 323 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 324 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 325 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 326 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 327 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 328 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 329 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 330 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 331 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 332 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 333 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.65 |
| Metatranscriptomes | 2.26 |
| Isolates | 10.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.04 |
| Nodule | 1.04 |
| Rhizoplane | 6.78 |
| Rhizosphere | 81.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10026381 | 3300009147 | Bacteria | 8226 |
| 2 | JGI24737J22298_10159974 | 3300001990 | Bacteria | 665 |
| 3 | JGI25406J46586_10018365 | 3300003203 | Bacteria | 2874 |
| 4 | Ga0070683_100006167 | 3300005329 | Bacteria | 10052 |
| 5 | Ga0070683_100341080 | 3300005329 | Bacteria | 1427 |
| 6 | Ga0070666_10001304 | 3300005335 | Bacteria | 15098 |
| 7 | Ga0070680_100056034 | 3300005336 | Bacteria | 3221 |
| 8 | Ga0070680_100186047 | 3300005336 | Bacteria | 1750 |
| 9 | Ga0070682_100342407 | 3300005337 | Bacteria | 1112 |
| 10 | Ga0070660_100009776 | 3300005339 | Bacteria | 6757 |
| 11 | Ga0070660_100093993 | 3300005339 | Bacteria | 2368 |
| 12 | Ga0070660_101334738 | 3300005339 | Bacteria | 609 |
| 13 | Ga0070689_100293587 | 3300005340 | Bacteria | 1351 |
| 14 | Ga0070661_100145343 | 3300005344 | Bacteria | 1790 |
| 15 | Ga0070668_100066642 | 3300005347 | Bacteria | 2794 |
| 16 | Ga0070675_100510304 | 3300005354 | Bacteria | 1084 |
| 17 | Ga0070675_100679781 | 3300005354 | Bacteria | 937 |
| 18 | Ga0070671_100000909 | 3300005355 | Bacteria | 21598 |
| 19 | Ga0070671_100018635 | 3300005355 | Bacteria | 5640 |
| 20 | Ga0070667_100006849 | 3300005367 | Bacteria | 9466 |
| 21 | Ga0070714_100076572 | 3300005435 | Bacteria | 2905 |
| 22 | Ga0070714_100894959 | 3300005435 | Bacteria | 862 |
| 23 | Ga0070714_101408156 | 3300005435 | Bacteria | 681 |
| 24 | Ga0070713_100012059 | 3300005436 | Bacteria | 6328 |
| 25 | Ga0070713_100203501 | 3300005436 | Bacteria | 1789 |
| 26 | Ga0070710_10199392 | 3300005437 | Bacteria | 1263 |
| 27 | Ga0070711_100543981 | 3300005439 | Bacteria | 962 |
| 28 | Ga0070700_100000052 | 3300005441 | Bacteria | 85282 |
| 29 | Ga0070708_100556506 | 3300005445 | Bacteria | 1082 |
| 30 | Ga0070678_100365459 | 3300005456 | Bacteria | 1244 |
| 31 | Ga0070681_10224562 | 3300005458 | Bacteria | 1793 |
| 32 | Ga0070706_100093352 | 3300005467 | Bacteria | 2792 |
| 33 | Ga0070707_100006497 | 3300005468 | Bacteria | 10858 |
| 34 | Ga0070707_100118364 | 3300005468 | Bacteria | 2571 |
| 35 | Ga0070698_100011034 | 3300005471 | Bacteria | 9603 |
| 36 | Ga0070698_100070821 | 3300005471 | Bacteria | 3498 |
| 37 | Ga0070679_100026529 | 3300005530 | Bacteria | 5693 |
| 38 | Ga0070684_100207840 | 3300005535 | Bacteria | 1784 |
| 39 | Ga0070697_100114733 | 3300005536 | Bacteria | 2248 |
| 40 | Ga0070697_100685045 | 3300005536 | Bacteria | 904 |
| 41 | Ga0070693_100135282 | 3300005547 | Bacteria | 1545 |
| 42 | Ga0070665_100000401 | 3300005548 | Bacteria | 63343 |
| 43 | Ga0070665_100017820 | 3300005548 | Bacteria | 7129 |
| 44 | Ga0070665_100165898 | 3300005548 | Bacteria | 2211 |
| 45 | Ga0070665_100177773 | 3300005548 | Bacteria | 2129 |
| 46 | Ga0068857_100123458 | 3300005577 | Bacteria | 2333 |
| 47 | Ga0068857_100173457 | 3300005577 | Bacteria | 1961 |
| 48 | Ga0068854_100161716 | 3300005578 | Bacteria | 1735 |
| 49 | Ga0068852_100008217 | 3300005616 | Bacteria | 7670 |
| 50 | Ga0068859_100050567 | 3300005617 | Bacteria | 4174 |
| 51 | Ga0068859_101257551 | 3300005617 | Bacteria | 815 |
| 52 | Ga0068863_100004961 | 3300005841 | Bacteria | 13117 |
| 53 | Ga0068863_100028576 | 3300005841 | Bacteria | 5324 |
| 54 | Ga0068858_100020391 | 3300005842 | Bacteria | 6200 |
| 55 | Ga0068860_100000114 | 3300005843 | Bacteria | 128789 |
| 56 | Ga0068860_100102210 | 3300005843 | Bacteria | 2735 |
| 57 | Ga0081455_10175681 | 3300005937 | Bacteria | 1626 |
| 58 | Ga0081455_10361122 | 3300005937 | Bacteria | 1021 |
| 59 | Ga0081540_1136439 | 3300005983 | Bacteria | 992 |
| 60 | Ga0081539_10001096 | 3300005985 | Bacteria | 49234 |
| 61 | Ga0070717_10013137 | 3300006028 | Bacteria | 6329 |
| 62 | Ga0070717_10073383 | 3300006028 | Bacteria | 2860 |
| 63 | Ga0070717_10112107 | 3300006028 | Bacteria | 2328 |
| 64 | Ga0070717_10197980 | 3300006028 | Bacteria | 1758 |
| 65 | Ga0070717_11392506 | 3300006028 | Bacteria | 637 |
| 66 | Ga0070712_100183835 | 3300006175 | Bacteria | 1631 |
| 67 | Ga0070712_100234657 | 3300006175 | Bacteria | 1458 |
| 68 | Ga0097621_100246081 | 3300006237 | Bacteria | 1565 |
| 69 | Ga0097621_100326243 | 3300006237 | Bacteria | 1361 |
| 70 | Ga0075428_100000071 | 3300006844 | Bacteria | 82288 |
| 71 | Ga0075428_100007534 | 3300006844 | Bacteria | 12066 |
| 72 | Ga0075428_100013717 | 3300006844 | Bacteria | 9023 |
| 73 | Ga0075428_100070199 | 3300006844 | Bacteria | 3830 |
| 74 | Ga0075428_100449225 | 3300006844 | Bacteria | 1381 |
| 75 | Ga0075428_100504900 | 3300006844 | Bacteria | 1294 |
| 76 | Ga0075428_100532283 | 3300006844 | Bacteria | 1256 |
| 77 | Ga0075428_100931491 | 3300006844 | Bacteria | 921 |
| 78 | Ga0075430_100000279 | 3300006846 | Bacteria | 35927 |
| 79 | Ga0075430_100017562 | 3300006846 | Bacteria | 6093 |
| 80 | Ga0075430_100096539 | 3300006846 | Bacteria | 2470 |
| 81 | Ga0075430_100175544 | 3300006846 | Bacteria | 1783 |
| 82 | Ga0075430_100814240 | 3300006846 | Bacteria | 770 |
| 83 | Ga0075431_100021138 | 3300006847 | Bacteria | 6650 |
| 84 | Ga0075431_100116349 | 3300006847 | Bacteria | 2760 |
| 85 | Ga0075431_100117596 | 3300006847 | Bacteria | 2743 |
| 86 | Ga0075431_100243011 | 3300006847 | Bacteria | 1831 |
| 87 | Ga0075431_100276187 | 3300006847 | Bacteria | 1702 |
| 88 | Ga0075431_100291597 | 3300006847 | Bacteria | 1650 |
| 89 | Ga0075431_100309415 | 3300006847 | Bacteria | 1595 |
| 90 | Ga0075431_100425909 | 3300006847 | Bacteria | 1326 |
| 91 | Ga0075431_100434285 | 3300006847 | Bacteria | 1311 |
| 92 | Ga0075433_10066225 | 3300006852 | Bacteria | 3169 |
| 93 | Ga0075434_100052100 | 3300006871 | Bacteria | 4066 |
| 94 | Ga0075434_100787756 | 3300006871 | Bacteria | 967 |
| 95 | Ga0075429_100006139 | 3300006880 | Bacteria | 10387 |
| 96 | Ga0075429_100017651 | 3300006880 | Bacteria | 6171 |
| 97 | Ga0075429_100090015 | 3300006880 | Bacteria | 2676 |
| 98 | Ga0075429_100340692 | 3300006880 | Bacteria | 1312 |
| 99 | Ga0075429_100469401 | 3300006880 | Bacteria | 1102 |
| 100 | Ga0075436_100013649 | 3300006914 | Bacteria | 5565 |
| 101 | Ga0097620_100050568 | 3300006931 | Bacteria | 4174 |
| 102 | Ga0097620_101257541 | 3300006931 | Bacteria | 815 |
| 103 | Ga0075435_100229709 | 3300007076 | Bacteria | 1576 |
| 104 | Ga0105240_10003545 | 3300009093 | Bacteria | 24217 |
| 105 | Ga0105240_10775746 | 3300009093 | Bacteria | 1040 |
| 106 | Ga0111539_10396003 | 3300009094 | Bacteria | 1608 |
| 107 | Ga0111539_11381574 | 3300009094 | Bacteria | 817 |
| 108 | Ga0105245_10025966 | 3300009098 | Bacteria | 5154 |
| 109 | Ga0114129_10001523 | 3300009147 | Bacteria | 31386 |
| 110 | Ga0114129_10007655 | 3300009147 | Bacteria | 15375 |
| 111 | Ga0114129_10014442 | 3300009147 | Bacteria | 11253 |
| 112 | Ga0114129_10354160 | 3300009147 | Bacteria | 1944 |
| 113 | Ga0114129_10828438 | 3300009147 | Bacteria | 1178 |
| 114 | Ga0105241_11287612 | 3300009174 | Bacteria | 696 |
| 115 | Ga0105242_11675950 | 3300009176 | Bacteria | 671 |
| 116 | Ga0105248_11436032 | 3300009177 | Bacteria | 781 |
| 117 | Ga0105248_12477990 | 3300009177 | Bacteria | 591 |
| 118 | Ga0105237_10367540 | 3300009545 | Bacteria | 1443 |
| 119 | Ga0105249_10191502 | 3300009553 | Bacteria | 1996 |
| 120 | Ga0105249_10507199 | 3300009553 | Bacteria | 1252 |
| 121 | Ga0105249_10564964 | 3300009553 | Bacteria | 1190 |
| 122 | Ga0105249_10931116 | 3300009553 | Bacteria | 936 |
| 123 | Ga0105035_107231 | 3300009988 | Bacteria | 931 |
| 124 | Ga0105028_133552 | 3300009993 | Bacteria | 574 |
| 125 | Ga0099796_10078588 | 3300010159 | Bacteria | 1205 |
| 126 | Ga0105239_10616174 | 3300010375 | Bacteria | 1238 |
| 127 | Ga0105239_10890171 | 3300010375 | Bacteria | 1022 |
| 128 | Ga0157320_1000833 | 3300012481 | Bacteria | 1389 |
| 129 | Ga0157325_1014206 | 3300012485 | Bacteria | 636 |
| 130 | Ga0157338_1023056 | 3300012515 | Bacteria | 741 |
| 131 | Ga0157373_10238575 | 3300013100 | Bacteria | 1285 |
| 132 | Ga0157370_10023120 | 3300013104 | Bacteria | 6179 |
| 133 | Ga0157369_10045601 | 3300013105 | Bacteria | 4766 |
| 134 | Ga0157369_10138768 | 3300013105 | Bacteria | 2573 |
| 135 | Ga0157369_11387515 | 3300013105 | Bacteria | 715 |
| 136 | Ga0157374_10309998 | 3300013296 | Bacteria | 1562 |
| 137 | Ga0157372_11142607 | 3300013307 | Bacteria | 901 |
| 138 | Ga0157375_10120911 | 3300013308 | Bacteria | 2728 |
| 139 | Ga0157515_127667 | 3300013875 | Bacteria | 828 |
| 140 | Ga0163163_10101642 | 3300014325 | Bacteria | 2897 |
| 141 | Ga0163163_10256944 | 3300014325 | Bacteria | 1798 |
| 142 | Ga0163163_10691643 | 3300014325 | Bacteria | 1083 |
| 143 | Ga0163163_11366537 | 3300014325 | Bacteria | 770 |
| 144 | Ga0157379_10013850 | 3300014968 | Bacteria | 7069 |
| 145 | Ga0157379_10014449 | 3300014968 | Bacteria | 6929 |
| 146 | Ga0157379_10205170 | 3300014968 | Bacteria | 1783 |
| 147 | Ga0157376_11140970 | 3300014969 | Bacteria | 806 |
| 148 | Ga0197907_10480815 | 3300020069 | Bacteria | 623 |
| 149 | Ga0197907_10774859 | 3300020069 | Bacteria | 805 |
| 150 | Ga0197907_10970541 | 3300020069 | Bacteria | 683 |
| 151 | Ga0206356_11172772 | 3300020070 | Bacteria | 1256 |
| 152 | Ga0206356_11273699 | 3300020070 | Bacteria | 1065 |
| 153 | Ga0206355_1695636 | 3300020076 | Bacteria | 805 |
| 154 | Ga0206354_10239597 | 3300020081 | Bacteria | 862 |
| 155 | Ga0206353_10344478 | 3300020082 | Bacteria | 1891 |
| 156 | Ga0206353_11436168 | 3300020082 | Bacteria | 873 |
| 157 | Ga0206353_11919446 | 3300020082 | Bacteria | 1519 |
| 158 | Ga0213873_10089063 | 3300021358 | Bacteria | 874 |
| 159 | Ga0213876_10001852 | 3300021384 | Bacteria | 12746 |
| 160 | Ga0213875_10000715 | 3300021388 | Bacteria | 25429 |
| 161 | Ga0224712_10001883 | 3300022467 | Bacteria | 5045 |
| 162 | Ga0207692_10000190 | 3300025898 | Bacteria | 20137 |
| 163 | Ga0207692_10017993 | 3300025898 | Bacteria | 3163 |
| 164 | Ga0207692_10328462 | 3300025898 | Bacteria | 938 |
| 165 | Ga0207680_10012623 | 3300025903 | Bacteria | 4310 |
| 166 | Ga0207685_10004577 | 3300025905 | Bacteria | 3539 |
| 167 | Ga0207705_10061671 | 3300025909 | Bacteria | 2708 |
| 168 | Ga0207684_10000864 | 3300025910 | Bacteria | 34633 |
| 169 | Ga0207684_10747406 | 3300025910 | Bacteria | 829 |
| 170 | Ga0207707_10170238 | 3300025912 | Bacteria | 1903 |
| 171 | Ga0207695_10168780 | 3300025913 | Bacteria | 2115 |
| 172 | Ga0207695_10382718 | 3300025913 | Bacteria | 1293 |
| 173 | Ga0207671_10570202 | 3300025914 | Bacteria | 902 |
| 174 | Ga0207693_10183864 | 3300025915 | Bacteria | 1645 |
| 175 | Ga0207663_10512028 | 3300025916 | Bacteria | 933 |
| 176 | Ga0207663_10759002 | 3300025916 | Bacteria | 771 |
| 177 | Ga0207660_10027115 | 3300025917 | Bacteria | 3906 |
| 178 | Ga0207657_10065227 | 3300025919 | Bacteria | 3105 |
| 179 | Ga0207657_10346474 | 3300025919 | Bacteria | 1172 |
| 180 | Ga0207657_10994091 | 3300025919 | Bacteria | 644 |
| 181 | Ga0207649_10296449 | 3300025920 | Bacteria | 1181 |
| 182 | Ga0207649_10785562 | 3300025920 | Bacteria | 742 |
| 183 | Ga0207646_10039054 | 3300025922 | Bacteria | 4271 |
| 184 | Ga0207646_10213103 | 3300025922 | Bacteria | 1745 |
| 185 | Ga0207700_10009292 | 3300025928 | Bacteria | 6133 |
| 186 | Ga0207700_10162013 | 3300025928 | Bacteria | 1858 |
| 187 | Ga0207700_11172720 | 3300025928 | Bacteria | 686 |
| 188 | Ga0207664_10011850 | 3300025929 | Bacteria | 6218 |
| 189 | Ga0207664_10286945 | 3300025929 | Bacteria | 1445 |
| 190 | Ga0207664_10489664 | 3300025929 | Bacteria | 1100 |
| 191 | Ga0207664_10589672 | 3300025929 | Bacteria | 998 |
| 192 | Ga0207644_10000893 | 3300025931 | Bacteria | 18858 |
| 193 | Ga0207644_10016064 | 3300025931 | Bacteria | 5034 |
| 194 | Ga0207706_10021009 | 3300025933 | Bacteria | 5864 |
| 195 | Ga0207711_10035304 | 3300025941 | Bacteria | 4238 |
| 196 | Ga0207661_10005578 | 3300025944 | Bacteria | 8874 |
| 197 | Ga0207661_10256172 | 3300025944 | Bacteria | 1557 |
| 198 | Ga0207661_10439706 | 3300025944 | Bacteria | 1187 |
| 199 | Ga0207679_10043069 | 3300025945 | Bacteria | 3248 |
| 200 | Ga0207712_10761240 | 3300025961 | Bacteria | 849 |
| 201 | Ga0207712_10807802 | 3300025961 | Bacteria | 825 |
| 202 | Ga0207668_10038118 | 3300025972 | Bacteria | 3223 |
| 203 | Ga0207668_10060104 | 3300025972 | Bacteria | 2666 |
| 204 | Ga0207658_10005173 | 3300025986 | Bacteria | 8987 |
| 205 | Ga0207703_10649604 | 3300026035 | Bacteria | 1001 |
| 206 | Ga0207639_10225998 | 3300026041 | Bacteria | 1619 |
| 207 | Ga0207678_10352632 | 3300026067 | Bacteria | 1269 |
| 208 | Ga0207708_10000495 | 3300026075 | Bacteria | 30285 |
| 209 | Ga0207641_10004666 | 3300026088 | Bacteria | 11822 |
| 210 | Ga0207641_10011277 | 3300026088 | Bacteria | 7332 |
| 211 | Ga0207674_10138493 | 3300026116 | Bacteria | 2394 |
| 212 | Ga0207674_10184778 | 3300026116 | Bacteria | 2035 |
| 213 | Ga0207674_10633496 | 3300026116 | Bacteria | 1032 |
| 214 | Ga0268266_10007377 | 3300028379 | Bacteria | 9929 |
| 215 | Ga0268266_10015134 | 3300028379 | Bacteria | 6624 |
| 216 | Ga0268266_10145285 | 3300028379 | Bacteria | 2132 |
| 217 | Ga0268264_10000147 | 3300028381 | Bacteria | 164790 |
| 218 | Ga0268264_10026182 | 3300028381 | Bacteria | 4764 |
| 219 | Ga0268264_10775725 | 3300028381 | Bacteria | 956 |
| 220 | Ga0268264_11105586 | 3300028381 | Bacteria | 801 |
| 221 | Ga0265338_10163074 | 3300028800 | Bacteria | 1719 |
| 222 | Ga0316177_1031012 | 3300030731 | Bacteria | 8127 |
| 223 | Ga0316176_1068288 | 3300030732 | Bacteria | 9170 |
| 224 | Ga0314311_1167261 | 3300030733 | Bacteria | 4975 |
| 225 | Ga0316178_1146583 | 3300030735 | Bacteria | 695 |
| 226 | Ga0316180_1066787 | 3300030736 | Bacteria | 1187 |
| 227 | Ga0265330_10283529 | 3300031235 | Bacteria | 698 |
| 228 | Ga0265325_10014435 | 3300031241 | Bacteria | 4464 |
| 229 | Ga0265340_10005860 | 3300031247 | Bacteria | 6799 |
| 230 | Ga0307509_10084651 | 3300031507 | Bacteria | 3266 |
| 231 | Ga0307408_100777661 | 3300031548 | Bacteria | 867 |
| 232 | Ga0307408_101708928 | 3300031548 | Bacteria | 600 |
| 233 | Ga0265313_10044261 | 3300031595 | Bacteria | 2174 |
| 234 | Ga0316575_10106585 | 3300031665 | Bacteria | 1141 |
| 235 | Ga0316579_10011102 | 3300031691 | Bacteria | 3822 |
| 236 | Ga0316579_10060603 | 3300031691 | Bacteria | 1780 |
| 237 | Ga0265314_10326609 | 3300031711 | Bacteria | 852 |
| 238 | Ga0265342_10031610 | 3300031712 | Bacteria | 3271 |
| 239 | Ga0316576_10051283 | 3300031727 | Bacteria | 3002 |
| 240 | Ga0316576_10060518 | 3300031727 | Bacteria | 2774 |
| 241 | Ga0316576_10122112 | 3300031727 | Bacteria | 1957 |
| 242 | Ga0316578_10000611 | 3300031728 | Bacteria | 12514 |
| 243 | Ga0316578_10135322 | 3300031728 | Bacteria | 1483 |
| 244 | Ga0316577_10020948 | 3300031733 | Bacteria | 3623 |
| 245 | Ga0307413_10329974 | 3300031824 | Bacteria | 1169 |
| 246 | Ga0307410_10024807 | 3300031852 | Bacteria | 3752 |
| 247 | Ga0307410_10797412 | 3300031852 | Bacteria | 803 |
| 248 | Ga0307406_10109911 | 3300031901 | Bacteria | 1896 |
| 249 | Ga0307406_10258883 | 3300031901 | Bacteria | 1315 |
| 250 | Ga0307406_10949611 | 3300031901 | Bacteria | 735 |
| 251 | Ga0307407_11029970 | 3300031903 | Bacteria | 637 |
| 252 | Ga0307409_100243305 | 3300031995 | Bacteria | 1639 |
| 253 | Ga0307409_100605026 | 3300031995 | Bacteria | 1084 |
| 254 | Ga0307409_100877376 | 3300031995 | Bacteria | 909 |
| 255 | Ga0307409_100927469 | 3300031995 | Bacteria | 886 |
| 256 | Ga0307414_11236380 | 3300032004 | Bacteria | 692 |
| 257 | Ga0307415_100065636 | 3300032126 | Bacteria | 2530 |
| 258 | Ga0307415_100082150 | 3300032126 | Bacteria | 2304 |
| 259 | Ga0316583_10032017 | 3300032133 | Bacteria | 1870 |
| 260 | Ga0316585_10039065 | 3300032137 | Bacteria | 1508 |
| 261 | Ga0316580_10018370 | 3300032139 | Bacteria | 2150 |
| 262 | Ga0316588_1117898 | 3300033528 | Bacteria | 670 |
| 263 | Ga0316596_1049199 | 3300033541 | Bacteria | 1115 |
| 264 | Ga0373959_0067681 | 3300034820 | Bacteria | 802 |
| 265 | Ga0373953_0120864 | 3300035117 | Bacteria | 1112 |
| 266 | Ga0373956_0129801 | 3300035119 | Bacteria | 1180 |
| 267 | Ga0316574_0001403 | 3300035398 | Bacteria | 11396 |
| 268 | Ga0316574_0271320 | 3300035398 | Bacteria | 1082 |
| 269 | Ga0373931_0145332 | 3300035691 | Bacteria | 1378 |
| 270 | Ga0373935_0421005 | 3300035692 | Bacteria | 961 |
| 271 | Ga0373947_0465430 | 3300035725 | Bacteria | 857 |
| 272 | Ga0373937_0272772 | 3300036401 | Bacteria | 1597 |
| 273 | Ga0373937_0613622 | 3300036401 | Bacteria | 1032 |
| 274 | Ga0316584_0000468 | 3300036712 | Bacteria | 21119 |
| 275 | Ga0373925_0256263 | 3300037068 | Bacteria | 1404 |
| 276 | Ga0373925_0481817 | 3300037068 | Bacteria | 1018 |
| 277 | Ga0395899_0075345 | 3300037312 | Bacteria | 2464 |
| 278 | Ga0395899_0395199 | 3300037312 | Bacteria | 916 |
| 279 | Ga0395900_0003683 | 3300037418 | Bacteria | 16474 |
| 280 | Ga0395900_0058886 | 3300037418 | Bacteria | 3955 |
| 281 | Ga0395898_0004120 | 3300037466 | Bacteria | 15943 |
| 282 | Ga0395898_0059634 | 3300037466 | Bacteria | 3711 |
| 283 | Ga0395905_0008666 | 3300037471 | Bacteria | 10019 |
| 284 | Ga0395905_0025209 | 3300037471 | Bacteria | 5609 |
| 285 | Ga0395905_0500849 | 3300037471 | Bacteria | 1115 |
| 286 | Ga0316581_0004256 | 3300037588 | Bacteria | 3638 |
| 287 | Ga0436364_1059010 | 3300037853 | Bacteria | 60327 |
| 288 | Ga0395901_0007250 | 3300038443 | Bacteria | 11187 |
| 289 | Ga0395901_0078662 | 3300038443 | Bacteria | 3443 |
| 290 | Ga0395901_0148459 | 3300038443 | Bacteria | 2464 |
| 291 | Ga0395901_0302158 | 3300038443 | Bacteria | 1659 |
| 292 | Ga0400486_26016 | 3300038742 | Bacteria | 85615 |
| 293 | Ga0436365_1121404 | 3300039437 | Bacteria | 19951 |
| 294 | Ga0436363_0004337 | 3300039450 | Bacteria | 592 |
| 295 | Ga0436362_1023230 | 3300039453 | Bacteria | 1022 |
| 296 | Ga0439455_0104989 | 3300042012 | Bacteria | 783 |
| 297 | Ga0439455_0113186 | 3300042012 | Bacteria | 756 |
| 298 | Ga0466969_0024617 | 3300044656 | Bacteria | 3096 |
| 299 | Ga0466972_0001447 | 3300044658 | Bacteria | 11536 |
| 300 | Ga0466972_0003187 | 3300044658 | Bacteria | 8147 |
| 301 | Ga0466972_0212568 | 3300044658 | Bacteria | 905 |
| 302 | Ga0466965_0024375 | 3300044683 | Bacteria | 2926 |
| 303 | Ga0466965_0050889 | 3300044683 | Bacteria | 2054 |
| 304 | Ga0466965_0251503 | 3300044683 | Bacteria | 948 |
| 305 | Ga0466966_0007222 | 3300044684 | Bacteria | 7363 |
| 306 | Ga0466961_0012581 | 3300044693 | Bacteria | 5417 |
| 307 | Ga0466961_0072937 | 3300044693 | Bacteria | 2177 |
| 308 | Ga0466963_0007059 | 3300044694 | Bacteria | 6687 |
| 309 | Ga0466963_0021972 | 3300044694 | Bacteria | 4034 |
| 310 | Ga0466963_0047580 | 3300044694 | Bacteria | 2831 |
| 311 | Ga0466963_0124673 | 3300044694 | Bacteria | 1775 |
| 312 | Ga0466963_0184783 | 3300044694 | Bacteria | 1456 |
| 313 | Ga0466963_0185223 | 3300044694 | Bacteria | 1454 |
| 314 | Ga0466963_0221034 | 3300044694 | Bacteria | 1326 |
| 315 | Ga0466963_0620377 | 3300044694 | Bacteria | 763 |
| 316 | Ga0466963_0648406 | 3300044694 | Bacteria | 745 |
| 317 | Ga0466963_0947925 | 3300044694 | Bacteria | 606 |
| 318 | Ga0466964_0079224 | 3300044706 | Bacteria | 1406 |
| 319 | Ga0466964_0392516 | 3300044706 | Bacteria | 723 |
| 320 | Ga0466971_0005777 | 3300044719 | Bacteria | 5381 |
| 321 | Ga0466971_0061939 | 3300044719 | Bacteria | 1693 |
| 322 | Ga0466968_0105287 | 3300044735 | Bacteria | 1263 |
| 323 | Ga0466968_0509258 | 3300044735 | Bacteria | 600 |
| 324 | Ga0466970_0003648 | 3300044765 | Bacteria | 7507 |
| 325 | Ga0466970_0014831 | 3300044765 | Bacteria | 4005 |
| 326 | Ga0466970_0055931 | 3300044765 | Bacteria | 2108 |
| 327 | Ga0466970_0061679 | 3300044765 | Bacteria | 2009 |
| 328 | Ga0466970_0074495 | 3300044765 | Bacteria | 1827 |
| 329 | Ga0466957_0199317 | 3300044842 | Bacteria | 1314 |
| 330 | Ga0466957_0326263 | 3300044842 | Bacteria | 1037 |
| 331 | Ga0466957_0643077 | 3300044842 | Bacteria | 745 |
| 332 | Ga0466957_1272041 | 3300044842 | Bacteria | 533 |
| 333 | Ga0466960_0001345 | 3300044901 | Bacteria | 8935 |
| 334 | Ga0466960_0034911 | 3300044901 | Bacteria | 2346 |
| 335 | Ga0466960_0106020 | 3300044901 | Bacteria | 1453 |
| 336 | Ga0466960_0584263 | 3300044901 | Bacteria | 662 |
| 337 | Ga0466959_0049306 | 3300045049 | Bacteria | 3093 |
| 338 | Ga0466958_0014280 | 3300045836 | Bacteria | 4535 |
| 339 | Ga0466958_0108316 | 3300045836 | Bacteria | 1733 |
| 340 | Ga0466967_0001202 | 3300045976 | Bacteria | 14567 |
| 341 | Ga0466967_0157138 | 3300045976 | Bacteria | 2131 |
| 342 | Ga0466967_0184704 | 3300045976 | Bacteria | 1968 |
| 343 | Ga0466967_0209938 | 3300045976 | Bacteria | 1846 |
| 344 | Ga0466967_0619292 | 3300045976 | Bacteria | 1069 |
| 345 | Ga0466967_0621374 | 3300045976 | Bacteria | 1067 |
| 346 | Ga0466967_0918455 | 3300045976 | Bacteria | 871 |
| 347 | Ga0466967_1407139 | 3300045976 | Bacteria | 695 |
| 348 | Ga0466967_1511440 | 3300045976 | Bacteria | 669 |
| 349 | Ga0466967_2060360 | 3300045976 | Bacteria | 567 |
| 350 | Ga0495592_0254034 | 3300046454 | Bacteria | 1160 |
| 351 | Ga0495603_0475101 | 3300046455 | Bacteria | 716 |
| 352 | Ga0495641_0146171 | 3300046461 | Bacteria | 1056 |
| 353 | Ga0495641_0272997 | 3300046461 | Bacteria | 761 |
| 354 | Ga0495650_0065405 | 3300046471 | Bacteria | 1443 |
| 355 | Ga0495664_0072393 | 3300046477 | Bacteria | 2059 |
| 356 | Ga0495664_0083447 | 3300046477 | Bacteria | 1917 |
| 357 | Ga0495664_0414598 | 3300046477 | Bacteria | 808 |
| 358 | Ga0495664_0551507 | 3300046477 | Bacteria | 687 |
| 359 | Ga0495606_0000899 | 3300046507 | Bacteria | 44298 |
| 360 | Ga0495618_0383209 | 3300046514 | Bacteria | 862 |
| 361 | Ga0495628_0252252 | 3300046516 | Bacteria | 1317 |
| 362 | Ga0495630_0598585 | 3300046517 | Bacteria | 845 |
| 363 | Ga0495652_0023217 | 3300046529 | Bacteria | 5499 |
| 364 | Ga0495586_0108068 | 3300046535 | Bacteria | 1547 |
| 365 | Ga0495645_0014632 | 3300046543 | Bacteria | 5569 |
| 366 | Ga0495645_0190023 | 3300046543 | Bacteria | 1400 |
| 367 | Ga0495668_0002206 | 3300046616 | Bacteria | 16580 |
| 368 | Ga0495625_0003279 | 3300046660 | Bacteria | 16347 |
| 369 | Ga0495635_0207087 | 3300046663 | Bacteria | 1329 |
| 370 | Ga0495623_0008296 | 3300046679 | Bacteria | 6759 |
| 371 | Ga0495646_0003687 | 3300046680 | Bacteria | 9559 |
| 372 | Ga0495674_0008780 | 3300047319 | Bacteria | 9615 |
| 373 | Ga0495676_0544272 | 3300047321 | Bacteria | 759 |
| 374 | Ga0495593_0248692 | 3300047673 | Bacteria | 890 |
| 375 | Ga0495626_0002553 | 3300048091 | Bacteria | 12489 |
| 376 | Ga0496100_0001193 | 3300048903 | Bacteria | 12611 |
| 377 | Ga0496100_0049526 | 3300048903 | Bacteria | 2717 |
| 378 | Ga0496100_0859209 | 3300048903 | Bacteria | 712 |
| 379 | Ga0496101_0010411 | 3300048904 | Bacteria | 6140 |
| 380 | Ga0496102_0000155 | 3300048905 | Bacteria | 92990 |
| 381 | Ga0496102_0028558 | 3300048905 | Bacteria | 4983 |
| 382 | Ga0496102_0550257 | 3300048905 | Bacteria | 1077 |
| 383 | Ga0496103_0000202 | 3300048906 | Bacteria | 59622 |
| 384 | Ga0496103_0402633 | 3300048906 | Bacteria | 879 |
| 385 | Ga0496104_0002997 | 3300048907 | Bacteria | 14550 |
| 386 | Ga0496104_0144121 | 3300048907 | Bacteria | 2288 |
| 387 | Ga0496104_0585995 | 3300048907 | Bacteria | 1026 |
| 388 | Ga0496105_0006906 | 3300048908 | Bacteria | 8738 |
| 389 | Ga0496105_0030945 | 3300048908 | Bacteria | 4387 |
| 390 | Ga0496106_0066779 | 3300048909 | Bacteria | 2740 |
| 391 | Ga0496106_0164628 | 3300048909 | Bacteria | 1755 |
| 392 | Ga0496107_0020929 | 3300048910 | Bacteria | 4623 |
| 393 | Ga0496107_0221571 | 3300048910 | Bacteria | 1407 |
| 394 | Ga0496108_0198346 | 3300048911 | Bacteria | 1741 |
| 395 | Ga0496108_0229136 | 3300048911 | Bacteria | 1615 |
| 396 | Ga0496109_0071582 | 3300048912 | Bacteria | 3184 |
| 397 | Ga0496109_0080524 | 3300048912 | Bacteria | 3000 |
| 398 | Ga0496109_0101212 | 3300048912 | Bacteria | 2674 |
| 399 | Ga0496109_0178314 | 3300048912 | Bacteria | 1995 |
| 400 | Ga0496109_0194342 | 3300048912 | Bacteria | 1907 |
| 401 | Ga0496109_0243015 | 3300048912 | Bacteria | 1694 |
| 402 | Ga0496109_0495296 | 3300048912 | Bacteria | 1153 |
| 403 | Ga0496110_0061611 | 3300048913 | Bacteria | 3312 |
| 404 | Ga0496110_0082404 | 3300048913 | Bacteria | 2869 |
| 405 | Ga0496111_0622139 | 3300048914 | Bacteria | 789 |
| 406 | Ga0496112_0787423 | 3300048915 | Bacteria | 876 |
| 407 | Ga0496112_1042167 | 3300048915 | Bacteria | 737 |
| 408 | Ga0496113_0149166 | 3300048916 | Bacteria | 1844 |
| 409 | Ga0496113_0321889 | 3300048916 | Bacteria | 1239 |
| 410 | Ga0496113_0813039 | 3300048916 | Bacteria | 742 |
| 411 | Ga0496114_0100825 | 3300048917 | Bacteria | 2464 |
| 412 | Ga0496114_0432563 | 3300048917 | Bacteria | 1166 |
| 413 | Ga0496115_0002856 | 3300048918 | Bacteria | 12439 |
| 414 | Ga0496115_0004689 | 3300048918 | Bacteria | 9907 |
| 415 | Ga0496116_0000241 | 3300048919 | Bacteria | 100186 |
| 416 | Ga0496117_0000529 | 3300048920 | Bacteria | 62772 |
| 417 | Ga0496118_0000265 | 3300048921 | Bacteria | 91869 |
| 418 | Ga0496119_0000456 | 3300048922 | Bacteria | 56083 |
| 419 | Ga0496120_0002051 | 3300048923 | Bacteria | 21769 |
| 420 | Ga0496121_0043202 | 3300048924 | Bacteria | 3907 |
| 421 | Ga0496124_0067710 | 3300048927 | Bacteria | 2970 |
| 422 | Ga0496125_0044744 | 3300048928 | Bacteria | 3736 |
| 423 | Ga0496126_0000381 | 3300048929 | Bacteria | 91810 |
| 424 | Ga0496126_0588135 | 3300048929 | Bacteria | 878 |
| 425 | Ga0501031_0139741 | 3300049568 | Bacteria | 1583 |
| 426 | Ga0501033_0473091 | 3300049570 | Bacteria | 869 |
| 427 | Ga0501034_0011846 | 3300049571 | Bacteria | 9027 |
| 428 | Ga0501037_0032766 | 3300049573 | Bacteria | 3839 |
| 429 | Ga0501038_0340470 | 3300049574 | Bacteria | 1170 |
| 430 | Ga0501038_0340502 | 3300049574 | Bacteria | 1170 |
| 431 | Ga0501040_0107480 | 3300049576 | Bacteria | 1950 |
| 432 | Ga0501043_0673705 | 3300049579 | Bacteria | 758 |
| 433 | Ga0501047_0000088 | 3300049581 | Bacteria | 117495 |
| 434 | Ga0501047_0128504 | 3300049581 | Bacteria | 2414 |
| 435 | Ga0501067_0002216 | 3300049583 | Bacteria | 10742 |
| 436 | Ga0501067_0003186 | 3300049583 | Bacteria | 9054 |
| 437 | Ga0501067_0027899 | 3300049583 | Bacteria | 3129 |
| 438 | Ga0501068_0003259 | 3300049584 | Bacteria | 8703 |
| 439 | Ga0501069_0057678 | 3300049585 | Bacteria | 2165 |
| 440 | Ga0501070_0001724 | 3300049586 | Bacteria | 19336 |
| 441 | Ga0501070_0003386 | 3300049586 | Bacteria | 13832 |
| 442 | Ga0501070_0011997 | 3300049586 | Bacteria | 7313 |
| 443 | Ga0501070_0019513 | 3300049586 | Bacteria | 5686 |
| 444 | Ga0501070_0038276 | 3300049586 | Bacteria | 4001 |
| 445 | Ga0501071_0003311 | 3300049587 | Bacteria | 10063 |
| 446 | Ga0501071_0181716 | 3300049587 | Bacteria | 1576 |
| 447 | Ga0501071_0200992 | 3300049587 | Bacteria | 1497 |
| 448 | Ga0501072_0020471 | 3300049588 | Bacteria | 5127 |
| 449 | Ga0501072_0041037 | 3300049588 | Bacteria | 3634 |
| 450 | Ga0501073_0004509 | 3300049589 | Bacteria | 10465 |
| 451 | Ga0501073_0014684 | 3300049589 | Bacteria | 5689 |
| 452 | Ga0501073_0045647 | 3300049589 | Bacteria | 3085 |
| 453 | Ga0501074_0001348 | 3300049590 | Bacteria | 16288 |
| 454 | Ga0501074_0001368 | 3300049590 | Bacteria | 16174 |
| 455 | Ga0501074_0068069 | 3300049590 | Bacteria | 2559 |
| 456 | Ga0501077_0003752 | 3300049593 | Bacteria | 9142 |
| 457 | Ga0501077_0197182 | 3300049593 | Bacteria | 1279 |
| 458 | Ga0501079_0005763 | 3300049741 | Bacteria | 9259 |
| 459 | Ga0501079_0072634 | 3300049741 | Bacteria | 2659 |
| 460 | Ga0501080_0001111 | 3300049742 | Bacteria | 22170 |
| 461 | Ga0501080_0001728 | 3300049742 | Bacteria | 18680 |
| 462 | Ga0501080_0004256 | 3300049742 | Bacteria | 12703 |
| 463 | Ga0501080_0080741 | 3300049742 | Bacteria | 3022 |
| 464 | Ga0501080_0113206 | 3300049742 | Bacteria | 2515 |
| 465 | Ga0501081_0597601 | 3300049743 | Bacteria | 826 |
| 466 | Ga0501083_0005059 | 3300049744 | Bacteria | 9341 |
| 467 | Ga0501035_0173719 | 3300049822 | Bacteria | 1860 |
| 468 | Ga0501035_0765433 | 3300049822 | Bacteria | 774 |
| 469 | Ga0501044_0390355 | 3300049823 | Bacteria | 1306 |
| 470 | nmdc:mga05p37_1047830_c1 | 3300050507 | Bacteria | 861 |
| 471 | nmdc:mga05p37_174737_c1 | 3300050507 | Bacteria | 2618 |
| 472 | nmdc:mga05p37_250822_c1 | 3300050507 | Bacteria | 2123 |
| 473 | nmdc:mga05p37_27327_c1 | 3300050507 | Bacteria | 6947 |
| 474 | nmdc:mga05p37_27815_c1 | 3300050507 | Bacteria | 6888 |
| 475 | nmdc:mga05p37_59067_c1 | 3300050507 | Bacteria | 4724 |
| 476 | nmdc:mga05p37_765040_c1 | 3300050507 | Bacteria | 1062 |
| 477 | nmdc:mga09592_177780_c1 | 3300050508 | Bacteria | 1841 |
| 478 | nmdc:mga09592_261862_c1 | 3300050508 | Bacteria | 1500 |
| 479 | nmdc:mga09592_393175_c1 | 3300050508 | Bacteria | 1199 |
| 480 | nmdc:mga09592_402544_c1 | 3300050508 | Bacteria | 1183 |
| 481 | nmdc:mga09592_423187_c1 | 3300050508 | Bacteria | 1150 |
| 482 | nmdc:mga09592_656631_c1 | 3300050508 | Bacteria | 895 |
| 483 | nmdc:mga0qj67_315543_c1 | 3300050509 | Bacteria | 1266 |
| 484 | nmdc:mga0qj67_46385_c1 | 3300050509 | Bacteria | 3431 |
| 485 | nmdc:mga0qj67_517_c1 | 3300050509 | Bacteria | 26296 |
| 486 | nmdc:mga06r32_1281194_c1 | 3300050510 | Bacteria | 677 |
| 487 | nmdc:mga06r32_141_c6 | 3300050510 | Bacteria | 4405 |
| 488 | nmdc:mga06r32_187298_c1 | 3300050510 | Bacteria | 2057 |
| 489 | nmdc:mga06r32_19962_c1 | 3300050510 | Bacteria | 6161 |
| 490 | nmdc:mga06r32_247799_c1 | 3300050510 | Bacteria | 1769 |
| 491 | nmdc:mga06r32_630983_c1 | 3300050510 | Bacteria | 1041 |
| 492 | nmdc:mga06r32_80476_c1 | 3300050510 | Bacteria | 3170 |
| 493 | nmdc:mga06r32_808429_c1 | 3300050510 | Bacteria | 898 |
| 494 | nmdc:mga08y16_507664_c1 | 3300050511 | Bacteria | 1224 |
| 495 | nmdc:mga0rr50_18274_c1 | 3300050513 | Bacteria | 4705 |
| 496 | nmdc:mga0a205_74589_c1 | 3300050515 | Bacteria | 3278 |
| 497 | Ga0495601_0583758 | 3300053077 | Bacteria | 718 |
| 498 | Ga0495612_0002970 | 3300053078 | Bacteria | 7039 |
| 499 | Ga0495619_0006039 | 3300053085 | Bacteria | 7674 |
| 500 | Ga0495619_0057352 | 3300053085 | Bacteria | 2584 |
| 501 | Ga0495619_0763729 | 3300053085 | Bacteria | 655 |
| 502 | Ga0500646_0000052 | 3300053090 | Bacteria | 32125 |
| 503 | Ga0500583_0034130 | 3300053092 | Bacteria | 2259 |
| 504 | Ga0500641_0146377 | 3300053096 | Bacteria | 1020 |
| 505 | Ga0500660_122104 | 3300053100 | Bacteria | 1082 |
| 506 | Ga0500594_0135922 | 3300053118 | Bacteria | 782 |
| 507 | Ga0500588_0002738 | 3300053146 | Bacteria | 3630 |
| 508 | Ga0501084_0019768 | 3300054114 | Bacteria | 5612 |
| 509 | Ga0501084_0123328 | 3300054114 | Bacteria | 2179 |
| 510 | Ga0501084_0273354 | 3300054114 | Bacteria | 1427 |
| 511 | Ga0501082_0002800 | 3300060353 | Bacteria | 15221 |
| 512 | Ga0501082_0017784 | 3300060353 | Bacteria | 6125 |
| 513 | Ga0501082_0360070 | 3300060353 | Bacteria | 1269 |
| 514 | Ga0466962_0008705 | 3300061719 | Bacteria | 4865 |
| 515 | Ga0466962_0323637 | 3300061719 | Bacteria | 765 |
| 516 | Ga0530510_0189615 | 3300061734 | Bacteria | 1526 |
| 517 | Ga0530510_1046654 | 3300061734 | Bacteria | 625 |
| 518 | 2501944605 | 2501939600 | Bacteria | 6907073 |
| 519 | 2515497677 | 2515154088 | Bacteria | 5526283 |
| 520 | 2515720404 | 2515154129 | Bacteria | 5584369 |
| 521 | 2515757789 | 2515154137 | Bacteria | 5711575 |
| 522 | 2516084539 | 2515154202 | Bacteria | 5471270 |
| 523 | 2516091597 | 2515154203 | Bacteria | 5458536 |
| 524 | 2558911691 | 2558860112 | Bacteria | 9931328 |
| 525 | 2623499318 | 2622736605 | Bacteria | 4992138 |
| 526 | 2623585453 | 2622736626 | Bacteria | 7181580 |
| 527 | 2676490278 | 2675903060 | Bacteria | 10051191 |
| 528 | 2734974651 | 2734482000 | Bacteria | 5525167 |
| 529 | 2772645272 | 2772190715 | Bacteria | 6959372 |
| 530 | 2816505990 | 2816332139 | Bacteria | 9138787 |
| 531 | 2831939786 | 2831935698 | Bacteria | 5963223 |
| 532 | 2832005847 | 2832004796 | Bacteria | 6538017 |
| 533 | 2855672422 | 2855670206 | Bacteria | 7120389 |
| 534 | 2855677251 | 2855676851 | Bacteria | 7063653 |
| 535 | 2855686248 | 2855683550 | Bacteria | 7134265 |
| 536 | 2856859367 | 2856858025 | Bacteria | 7255264 |
| 537 | 2857289163 | 2857288857 | Bacteria | 7189066 |
| 538 | 2858850285 | 2858848962 | Bacteria | 6963058 |
| 539 | 2858874563 | 2858868258 | Bacteria | 7683772 |
| 540 | 2858884693 | 2858882152 | Bacteria | 7230291 |
| 541 | 2858893354 | 2858888857 | Bacteria | 7060307 |
| 542 | 2858898277 | 2858895516 | Bacteria | 7378898 |
| 543 | 2858902573 | 2858902515 | Bacteria | 7086037 |
| 544 | 2866066330 | 2866065130 | Bacteria | 6518152 |
| 545 | 2867306294 | 2867302475 | Bacteria | 7087181 |
| 546 | 2867317103 | 2867312974 | Bacteria | 7058875 |
| 547 | 2867322925 | 2867319477 | Bacteria | 7069771 |
| 548 | 2867510522 | 2867507094 | Bacteria | 6506033 |
| 549 | 2869052161 | 2869048445 | Bacteria | 6875584 |
| 550 | 2869068261 | 2869061728 | Bacteria | 7112407 |
| 551 | 2869073562 | 2869068681 | Bacteria | 7205615 |
| 552 | 2870787898 | 2870782633 | Bacteria | 9624083 |
| 553 | 2873316128 | 2873314349 | Bacteria | 8512634 |
| 554 | 2880494766 | 2880489317 | Bacteria | 7096270 |
| 555 | 2880497548 | 2880495981 | Bacteria | 7340502 |
| 556 | 2884704097 | 2884693830 | Bacteria | 11273186 |
| 557 | 2887485653 | 2887478801 | Bacteria | 8972725 |
| 558 | 2891401068 | 2891395885 | Bacteria | 9251614 |
| 559 | 2895431880 | 2895427314 | Bacteria | 13147766 |
| 560 | 2895448548 | 2895442618 | Bacteria | 11027144 |
| 561 | 2902584326 | 2902582711 | Bacteria | 6187705 |
| 562 | 2915362479 | 2915358134 | Bacteria | 6050864 |
| 563 | 2929226112 | 2929219909 | Bacteria | 6984360 |
| 564 | 2929232774 | 2929226422 | Bacteria | 7248583 |
| 565 | 2996228135 | 2996221748 | Bacteria | 6799777 |
| 566 | 649812768 | 649633069 | Bacteria | 6962533 |
| 567 | 8001783062 | 8001781756 | Bacteria | 9586736 |
| 568 | 8003834853 | 8003830390 | Bacteria | 6541657 |
| 569 | 8003857172 | 8003856774 | Bacteria | 7675274 |
| 570 | 8003876630 | 8003870546 | Bacteria | 7396674 |
| 571 | 8054473675 | 8054472261 | Bacteria | 7464355 |
| 572 | 8054710696 | 8054704163 | Bacteria | 7247792 |
| 573 | 8054732398 | 8054727385 | Bacteria | 7558670 |
| 574 | 8054739361 | 8054734606 | Bacteria | 6947278 |
| 575 | 8055418098 | 8055412473 | Bacteria | 6257500 |
| 576 | Ga0114129_10026381 | |||
| 577 | JGI24737J22298_10159974 | |||
| 578 | JGI25406J46586_10018365 | |||
| 579 | Ga0070683_100006167 | |||
| 580 | Ga0070683_100341080 | |||
| 581 | Ga0070666_10001304 | |||
| 582 | Ga0070680_100056034 | |||
| 583 | Ga0070680_100186047 | |||
| 584 | Ga0070682_100342407 | |||
| 585 | Ga0070660_100009776 | |||
| 586 | Ga0070660_100093993 | |||
| 587 | Ga0070660_101334738 | |||
| 588 | Ga0070689_100293587 | |||
| 589 | Ga0070661_100145343 | |||
| 590 | Ga0070668_100066642 | |||
| 591 | Ga0070675_100510304 | |||
| 592 | Ga0070675_100679781 | |||
| 593 | Ga0070671_100000909 | |||
| 594 | Ga0070671_100018635 | |||
| 595 | Ga0070667_100006849 | |||
| 596 | Ga0070714_100076572 | |||
| 597 | Ga0070714_100894959 | |||
| 598 | Ga0070714_101408156 | |||
| 599 | Ga0070713_100012059 | |||
| 600 | Ga0070713_100203501 | |||
| 601 | Ga0070710_10199392 | |||
| 602 | Ga0070711_100543981 | |||
| 603 | Ga0070700_100000052 | |||
| 604 | Ga0070708_100556506 | |||
| 605 | Ga0070678_100365459 | |||
| 606 | Ga0070681_10224562 | |||
| 607 | Ga0070706_100093352 | |||
| 608 | Ga0070707_100006497 | |||
| 609 | Ga0070707_100118364 | |||
| 610 | Ga0070698_100011034 | |||
| 611 | Ga0070698_100070821 | |||
| 612 | Ga0070679_100026529 | |||
| 613 | Ga0070684_100207840 | |||
| 614 | Ga0070697_100114733 | |||
| 615 | Ga0070697_100685045 | |||
| 616 | Ga0070693_100135282 | |||
| 617 | Ga0070665_100000401 | |||
| 618 | Ga0070665_100017820 | |||
| 619 | Ga0070665_100165898 | |||
| 620 | Ga0070665_100177773 | |||
| 621 | Ga0068857_100123458 | |||
| 622 | Ga0068857_100173457 | |||
| 623 | Ga0068854_100161716 | |||
| 624 | Ga0068852_100008217 | |||
| 625 | Ga0068859_100050567 | |||
| 626 | Ga0068859_101257551 | |||
| 627 | Ga0068863_100004961 | |||
| 628 | Ga0068863_100028576 | |||
| 629 | Ga0068858_100020391 | |||
| 630 | Ga0068860_100000114 | |||
| 631 | Ga0068860_100102210 | |||
| 632 | Ga0081455_10175681 | |||
| 633 | Ga0081455_10361122 | |||
| 634 | Ga0081540_1136439 | |||
| 635 | Ga0081539_10001096 | |||
| 636 | Ga0070717_10013137 | |||
| 637 | Ga0070717_10073383 | |||
| 638 | Ga0070717_10112107 | |||
| 639 | Ga0070717_10197980 | |||
| 640 | Ga0070717_11392506 | |||
| 641 | Ga0070712_100183835 | |||
| 642 | Ga0070712_100234657 | |||
| 643 | Ga0097621_100246081 | |||
| 644 | Ga0097621_100326243 | |||
| 645 | Ga0075428_100000071 | |||
| 646 | Ga0075428_100007534 | |||
| 647 | Ga0075428_100013717 | |||
| 648 | Ga0075428_100070199 | |||
| 649 | Ga0075428_100449225 | |||
| 650 | Ga0075428_100504900 | |||
| 651 | Ga0075428_100532283 | |||
| 652 | Ga0075428_100931491 | |||
| 653 | Ga0075430_100000279 | |||
| 654 | Ga0075430_100017562 | |||
| 655 | Ga0075430_100096539 | |||
| 656 | Ga0075430_100175544 | |||
| 657 | Ga0075430_100814240 | |||
| 658 | Ga0075431_100021138 | |||
| 659 | Ga0075431_100116349 | |||
| 660 | Ga0075431_100117596 | |||
| 661 | Ga0075431_100243011 | |||
| 662 | Ga0075431_100276187 | |||
| 663 | Ga0075431_100291597 | |||
| 664 | Ga0075431_100309415 | |||
| 665 | Ga0075431_100425909 | |||
| 666 | Ga0075431_100434285 | |||
| 667 | Ga0075433_10066225 | |||
| 668 | Ga0075434_100052100 | |||
| 669 | Ga0075434_100787756 | |||
| 670 | Ga0075429_100006139 | |||
| 671 | Ga0075429_100017651 | |||
| 672 | Ga0075429_100090015 | |||
| 673 | Ga0075429_100340692 | |||
| 674 | Ga0075429_100469401 | |||
| 675 | Ga0075436_100013649 | |||
| 676 | Ga0097620_100050568 | |||
| 677 | Ga0097620_101257541 | |||
| 678 | Ga0075435_100229709 | |||
| 679 | Ga0105240_10003545 | |||
| 680 | Ga0105240_10775746 | |||
| 681 | Ga0111539_10396003 | |||
| 682 | Ga0111539_11381574 | |||
| 683 | Ga0105245_10025966 | |||
| 684 | Ga0114129_10001523 | |||
| 685 | Ga0114129_10007655 | |||
| 686 | Ga0114129_10014442 | |||
| 687 | Ga0114129_10354160 | |||
| 688 | Ga0114129_10828438 | |||
| 689 | Ga0105241_11287612 | |||
| 690 | Ga0105242_11675950 | |||
| 691 | Ga0105248_11436032 | |||
| 692 | Ga0105248_12477990 | |||
| 693 | Ga0105237_10367540 | |||
| 694 | Ga0105249_10191502 | |||
| 695 | Ga0105249_10507199 | |||
| 696 | Ga0105249_10564964 | |||
| 697 | Ga0105249_10931116 | |||
| 698 | Ga0105035_107231 | |||
| 699 | Ga0105028_133552 | |||
| 700 | Ga0099796_10078588 | |||
| 701 | Ga0105239_10616174 | |||
| 702 | Ga0105239_10890171 | |||
| 703 | Ga0157320_1000833 | |||
| 704 | Ga0157325_1014206 | |||
| 705 | Ga0157338_1023056 | |||
| 706 | Ga0157373_10238575 | |||
| 707 | Ga0157370_10023120 | |||
| 708 | Ga0157369_10045601 | |||
| 709 | Ga0157369_10138768 | |||
| 710 | Ga0157369_11387515 | |||
| 711 | Ga0157374_10309998 | |||
| 712 | Ga0157372_11142607 | |||
| 713 | Ga0157375_10120911 | |||
| 714 | Ga0157515_127667 | |||
| 715 | Ga0163163_10101642 | |||
| 716 | Ga0163163_10256944 | |||
| 717 | Ga0163163_10691643 | |||
| 718 | Ga0163163_11366537 | |||
| 719 | Ga0157379_10013850 | |||
| 720 | Ga0157379_10014449 | |||
| 721 | Ga0157379_10205170 | |||
| 722 | Ga0157376_11140970 | |||
| 723 | Ga0197907_10480815 | |||
| 724 | Ga0197907_10774859 | |||
| 725 | Ga0197907_10970541 | |||
| 726 | Ga0206356_11172772 | |||
| 727 | Ga0206356_11273699 | |||
| 728 | Ga0206355_1695636 | |||
| 729 | Ga0206354_10239597 | |||
| 730 | Ga0206353_10344478 | |||
| 731 | Ga0206353_11436168 | |||
| 732 | Ga0206353_11919446 | |||
| 733 | Ga0213873_10089063 | |||
| 734 | Ga0213876_10001852 | |||
| 735 | Ga0213875_10000715 | |||
| 736 | Ga0224712_10001883 | |||
| 737 | Ga0207692_10000190 | |||
| 738 | Ga0207692_10017993 | |||
| 739 | Ga0207692_10328462 | |||
| 740 | Ga0207680_10012623 | |||
| 741 | Ga0207685_10004577 | |||
| 742 | Ga0207705_10061671 | |||
| 743 | Ga0207684_10000864 | |||
| 744 | Ga0207684_10747406 | |||
| 745 | Ga0207707_10170238 | |||
| 746 | Ga0207695_10168780 | |||
| 747 | Ga0207695_10382718 | |||
| 748 | Ga0207671_10570202 | |||
| 749 | Ga0207693_10183864 | |||
| 750 | Ga0207663_10512028 | |||
| 751 | Ga0207663_10759002 | |||
| 752 | Ga0207660_10027115 | |||
| 753 | Ga0207657_10065227 | |||
| 754 | Ga0207657_10346474 | |||
| 755 | Ga0207657_10994091 | |||
| 756 | Ga0207649_10296449 | |||
| 757 | Ga0207649_10785562 | |||
| 758 | Ga0207646_10039054 | |||
| 759 | Ga0207646_10213103 | |||
| 760 | Ga0207700_10009292 | |||
| 761 | Ga0207700_10162013 | |||
| 762 | Ga0207700_11172720 | |||
| 763 | Ga0207664_10011850 | |||
| 764 | Ga0207664_10286945 | |||
| 765 | Ga0207664_10489664 | |||
| 766 | Ga0207664_10589672 | |||
| 767 | Ga0207644_10000893 | |||
| 768 | Ga0207644_10016064 | |||
| 769 | Ga0207706_10021009 | |||
| 770 | Ga0207711_10035304 | |||
| 771 | Ga0207661_10005578 | |||
| 772 | Ga0207661_10256172 | |||
| 773 | Ga0207661_10439706 | |||
| 774 | Ga0207679_10043069 | |||
| 775 | Ga0207712_10761240 | |||
| 776 | Ga0207712_10807802 | |||
| 777 | Ga0207668_10038118 | |||
| 778 | Ga0207668_10060104 | |||
| 779 | Ga0207658_10005173 | |||
| 780 | Ga0207703_10649604 | |||
| 781 | Ga0207639_10225998 | |||
| 782 | Ga0207678_10352632 | |||
| 783 | Ga0207708_10000495 | |||
| 784 | Ga0207641_10004666 | |||
| 785 | Ga0207641_10011277 | |||
| 786 | Ga0207674_10138493 | |||
| 787 | Ga0207674_10184778 | |||
| 788 | Ga0207674_10633496 | |||
| 789 | Ga0268266_10007377 | |||
| 790 | Ga0268266_10015134 | |||
| 791 | Ga0268266_10145285 | |||
| 792 | Ga0268264_10000147 | |||
| 793 | Ga0268264_10026182 | |||
| 794 | Ga0268264_10775725 | |||
| 795 | Ga0268264_11105586 | |||
| 796 | Ga0265338_10163074 | |||
| 797 | Ga0316177_1031012 | |||
| 798 | Ga0316176_1068288 | |||
| 799 | Ga0314311_1167261 | |||
| 800 | Ga0316178_1146583 | |||
| 801 | Ga0316180_1066787 | |||
| 802 | Ga0265330_10283529 | |||
| 803 | Ga0265325_10014435 | |||
| 804 | Ga0265340_10005860 | |||
| 805 | Ga0307509_10084651 | |||
| 806 | Ga0307408_100777661 | |||
| 807 | Ga0307408_101708928 | |||
| 808 | Ga0265313_10044261 | |||
| 809 | Ga0316575_10106585 | |||
| 810 | Ga0316579_10011102 | |||
| 811 | Ga0316579_10060603 | |||
| 812 | Ga0265314_10326609 | |||
| 813 | Ga0265342_10031610 | |||
| 814 | Ga0316576_10051283 | |||
| 815 | Ga0316576_10060518 | |||
| 816 | Ga0316576_10122112 | |||
| 817 | Ga0316578_10000611 | |||
| 818 | Ga0316578_10135322 | |||
| 819 | Ga0316577_10020948 | |||
| 820 | Ga0307413_10329974 | |||
| 821 | Ga0307410_10024807 | |||
| 822 | Ga0307410_10797412 | |||
| 823 | Ga0307406_10109911 | |||
| 824 | Ga0307406_10258883 | |||
| 825 | Ga0307406_10949611 | |||
| 826 | Ga0307407_11029970 | |||
| 827 | Ga0307409_100243305 | |||
| 828 | Ga0307409_100605026 | |||
| 829 | Ga0307409_100877376 | |||
| 830 | Ga0307409_100927469 | |||
| 831 | Ga0307414_11236380 | |||
| 832 | Ga0307415_100065636 | |||
| 833 | Ga0307415_100082150 | |||
| 834 | Ga0316583_10032017 | |||
| 835 | Ga0316585_10039065 | |||
| 836 | Ga0316580_10018370 | |||
| 837 | Ga0316588_1117898 | |||
| 838 | Ga0316596_1049199 | |||
| 839 | Ga0373959_0067681 | |||
| 840 | Ga0373953_0120864 | |||
| 841 | Ga0373956_0129801 | |||
| 842 | Ga0316574_0001403 | |||
| 843 | Ga0316574_0271320 | |||
| 844 | Ga0373931_0145332 | |||
| 845 | Ga0373935_0421005 | |||
| 846 | Ga0373947_0465430 | |||
| 847 | Ga0373937_0272772 | |||
| 848 | Ga0373937_0613622 | |||
| 849 | Ga0316584_0000468 | |||
| 850 | Ga0373925_0256263 | |||
| 851 | Ga0373925_0481817 | |||
| 852 | Ga0395899_0075345 | |||
| 853 | Ga0395899_0395199 | |||
| 854 | Ga0395900_0003683 | |||
| 855 | Ga0395900_0058886 | |||
| 856 | Ga0395898_0004120 | |||
| 857 | Ga0395898_0059634 | |||
| 858 | Ga0395905_0008666 | |||
| 859 | Ga0395905_0025209 | |||
| 860 | Ga0395905_0500849 | |||
| 861 | Ga0316581_0004256 | |||
| 862 | Ga0436364_1059010 | |||
| 863 | Ga0395901_0007250 | |||
| 864 | Ga0395901_0078662 | |||
| 865 | Ga0395901_0148459 | |||
| 866 | Ga0395901_0302158 | |||
| 867 | Ga0400486_26016 | |||
| 868 | Ga0436365_1121404 | |||
| 869 | Ga0436363_0004337 | |||
| 870 | Ga0436362_1023230 | |||
| 871 | Ga0439455_0104989 | |||
| 872 | Ga0439455_0113186 | |||
| 873 | Ga0466969_0024617 | |||
| 874 | Ga0466972_0001447 | |||
| 875 | Ga0466972_0003187 | |||
| 876 | Ga0466972_0212568 | |||
| 877 | Ga0466965_0024375 | |||
| 878 | Ga0466965_0050889 | |||
| 879 | Ga0466965_0251503 | |||
| 880 | Ga0466966_0007222 | |||
| 881 | Ga0466961_0012581 | |||
| 882 | Ga0466961_0072937 | |||
| 883 | Ga0466963_0007059 | |||
| 884 | Ga0466963_0021972 | |||
| 885 | Ga0466963_0047580 | |||
| 886 | Ga0466963_0124673 | |||
| 887 | Ga0466963_0184783 | |||
| 888 | Ga0466963_0185223 | |||
| 889 | Ga0466963_0221034 | |||
| 890 | Ga0466963_0620377 | |||
| 891 | Ga0466963_0648406 | |||
| 892 | Ga0466963_0947925 | |||
| 893 | Ga0466964_0079224 | |||
| 894 | Ga0466964_0392516 | |||
| 895 | Ga0466971_0005777 | |||
| 896 | Ga0466971_0061939 | |||
| 897 | Ga0466968_0105287 | |||
| 898 | Ga0466968_0509258 | |||
| 899 | Ga0466970_0003648 | |||
| 900 | Ga0466970_0014831 | |||
| 901 | Ga0466970_0055931 | |||
| 902 | Ga0466970_0061679 | |||
| 903 | Ga0466970_0074495 | |||
| 904 | Ga0466957_0199317 | |||
| 905 | Ga0466957_0326263 | |||
| 906 | Ga0466957_0643077 | |||
| 907 | Ga0466957_1272041 | |||
| 908 | Ga0466960_0001345 | |||
| 909 | Ga0466960_0034911 | |||
| 910 | Ga0466960_0106020 | |||
| 911 | Ga0466960_0584263 | |||
| 912 | Ga0466959_0049306 | |||
| 913 | Ga0466958_0014280 | |||
| 914 | Ga0466958_0108316 | |||
| 915 | Ga0466967_0001202 | |||
| 916 | Ga0466967_0157138 | |||
| 917 | Ga0466967_0184704 | |||
| 918 | Ga0466967_0209938 | |||
| 919 | Ga0466967_0619292 | |||
| 920 | Ga0466967_0621374 | |||
| 921 | Ga0466967_0918455 | |||
| 922 | Ga0466967_1407139 | |||
| 923 | Ga0466967_1511440 | |||
| 924 | Ga0466967_2060360 | |||
| 925 | Ga0495592_0254034 | |||
| 926 | Ga0495603_0475101 | |||
| 927 | Ga0495641_0146171 | |||
| 928 | Ga0495641_0272997 | |||
| 929 | Ga0495650_0065405 | |||
| 930 | Ga0495664_0072393 | |||
| 931 | Ga0495664_0083447 | |||
| 932 | Ga0495664_0414598 | |||
| 933 | Ga0495664_0551507 | |||
| 934 | Ga0495606_0000899 | |||
| 935 | Ga0495618_0383209 | |||
| 936 | Ga0495628_0252252 | |||
| 937 | Ga0495630_0598585 | |||
| 938 | Ga0495652_0023217 | |||
| 939 | Ga0495586_0108068 | |||
| 940 | Ga0495645_0014632 | |||
| 941 | Ga0495645_0190023 | |||
| 942 | Ga0495668_0002206 | |||
| 943 | Ga0495625_0003279 | |||
| 944 | Ga0495635_0207087 | |||
| 945 | Ga0495623_0008296 | |||
| 946 | Ga0495646_0003687 | |||
| 947 | Ga0495674_0008780 | |||
| 948 | Ga0495676_0544272 | |||
| 949 | Ga0495593_0248692 | |||
| 950 | Ga0495626_0002553 | |||
| 951 | Ga0496100_0001193 | |||
| 952 | Ga0496100_0049526 | |||
| 953 | Ga0496100_0859209 | |||
| 954 | Ga0496101_0010411 | |||
| 955 | Ga0496102_0000155 | |||
| 956 | Ga0496102_0028558 | |||
| 957 | Ga0496102_0550257 | |||
| 958 | Ga0496103_0000202 | |||
| 959 | Ga0496103_0402633 | |||
| 960 | Ga0496104_0002997 | |||
| 961 | Ga0496104_0144121 | |||
| 962 | Ga0496104_0585995 | |||
| 963 | Ga0496105_0006906 | |||
| 964 | Ga0496105_0030945 | |||
| 965 | Ga0496106_0066779 | |||
| 966 | Ga0496106_0164628 | |||
| 967 | Ga0496107_0020929 | |||
| 968 | Ga0496107_0221571 | |||
| 969 | Ga0496108_0198346 | |||
| 970 | Ga0496108_0229136 | |||
| 971 | Ga0496109_0071582 | |||
| 972 | Ga0496109_0080524 | |||
| 973 | Ga0496109_0101212 | |||
| 974 | Ga0496109_0178314 | |||
| 975 | Ga0496109_0194342 | |||
| 976 | Ga0496109_0243015 | |||
| 977 | Ga0496109_0495296 | |||
| 978 | Ga0496110_0061611 | |||
| 979 | Ga0496110_0082404 | |||
| 980 | Ga0496111_0622139 | |||
| 981 | Ga0496112_0787423 | |||
| 982 | Ga0496112_1042167 | |||
| 983 | Ga0496113_0149166 | |||
| 984 | Ga0496113_0321889 | |||
| 985 | Ga0496113_0813039 | |||
| 986 | Ga0496114_0100825 | |||
| 987 | Ga0496114_0432563 | |||
| 988 | Ga0496115_0002856 | |||
| 989 | Ga0496115_0004689 | |||
| 990 | Ga0496116_0000241 | |||
| 991 | Ga0496117_0000529 | |||
| 992 | Ga0496118_0000265 | |||
| 993 | Ga0496119_0000456 | |||
| 994 | Ga0496120_0002051 | |||
| 995 | Ga0496121_0043202 | |||
| 996 | Ga0496124_0067710 | |||
| 997 | Ga0496125_0044744 | |||
| 998 | Ga0496126_0000381 | |||
| 999 | Ga0496126_0588135 | |||
| 1000 | Ga0501031_0139741 | |||
| 1001 | Ga0501033_0473091 | |||
| 1002 | Ga0501034_0011846 | |||
| 1003 | Ga0501037_0032766 | |||
| 1004 | Ga0501038_0340470 | |||
| 1005 | Ga0501038_0340502 | |||
| 1006 | Ga0501040_0107480 | |||
| 1007 | Ga0501043_0673705 | |||
| 1008 | Ga0501047_0000088 | |||
| 1009 | Ga0501047_0128504 | |||
| 1010 | Ga0501067_0002216 | |||
| 1011 | Ga0501067_0003186 | |||
| 1012 | Ga0501067_0027899 | |||
| 1013 | Ga0501068_0003259 | |||
| 1014 | Ga0501069_0057678 | |||
| 1015 | Ga0501070_0001724 | |||
| 1016 | Ga0501070_0003386 | |||
| 1017 | Ga0501070_0011997 | |||
| 1018 | Ga0501070_0019513 | |||
| 1019 | Ga0501070_0038276 | |||
| 1020 | Ga0501071_0003311 | |||
| 1021 | Ga0501071_0181716 | |||
| 1022 | Ga0501071_0200992 | |||
| 1023 | Ga0501072_0020471 | |||
| 1024 | Ga0501072_0041037 | |||
| 1025 | Ga0501073_0004509 | |||
| 1026 | Ga0501073_0014684 | |||
| 1027 | Ga0501073_0045647 | |||
| 1028 | Ga0501074_0001348 | |||
| 1029 | Ga0501074_0001368 | |||
| 1030 | Ga0501074_0068069 | |||
| 1031 | Ga0501077_0003752 | |||
| 1032 | Ga0501077_0197182 | |||
| 1033 | Ga0501079_0005763 | |||
| 1034 | Ga0501079_0072634 | |||
| 1035 | Ga0501080_0001111 | |||
| 1036 | Ga0501080_0001728 | |||
| 1037 | Ga0501080_0004256 | |||
| 1038 | Ga0501080_0080741 | |||
| 1039 | Ga0501080_0113206 | |||
| 1040 | Ga0501081_0597601 | |||
| 1041 | Ga0501083_0005059 | |||
| 1042 | Ga0501035_0173719 | |||
| 1043 | Ga0501035_0765433 | |||
| 1044 | Ga0501044_0390355 | |||
| 1045 | nmdc:mga05p37_1047830_c1 | |||
| 1046 | nmdc:mga05p37_174737_c1 | |||
| 1047 | nmdc:mga05p37_250822_c1 | |||
| 1048 | nmdc:mga05p37_27327_c1 | |||
| 1049 | nmdc:mga05p37_27815_c1 | |||
| 1050 | nmdc:mga05p37_59067_c1 | |||
| 1051 | nmdc:mga05p37_765040_c1 | |||
| 1052 | nmdc:mga09592_177780_c1 | |||
| 1053 | nmdc:mga09592_261862_c1 | |||
| 1054 | nmdc:mga09592_393175_c1 | |||
| 1055 | nmdc:mga09592_402544_c1 | |||
| 1056 | nmdc:mga09592_423187_c1 | |||
| 1057 | nmdc:mga09592_656631_c1 | |||
| 1058 | nmdc:mga0qj67_315543_c1 | |||
| 1059 | nmdc:mga0qj67_46385_c1 | |||
| 1060 | nmdc:mga0qj67_517_c1 | |||
| 1061 | nmdc:mga06r32_1281194_c1 | |||
| 1062 | nmdc:mga06r32_141_c6 | |||
| 1063 | nmdc:mga06r32_187298_c1 | |||
| 1064 | nmdc:mga06r32_19962_c1 | |||
| 1065 | nmdc:mga06r32_247799_c1 | |||
| 1066 | nmdc:mga06r32_630983_c1 | |||
| 1067 | nmdc:mga06r32_80476_c1 | |||
| 1068 | nmdc:mga06r32_808429_c1 | |||
| 1069 | nmdc:mga08y16_507664_c1 | |||
| 1070 | nmdc:mga0rr50_18274_c1 | |||
| 1071 | nmdc:mga0a205_74589_c1 | |||
| 1072 | Ga0495601_0583758 | |||
| 1073 | Ga0495612_0002970 | |||
| 1074 | Ga0495619_0006039 | |||
| 1075 | Ga0495619_0057352 | |||
| 1076 | Ga0495619_0763729 | |||
| 1077 | Ga0500646_0000052 | |||
| 1078 | Ga0500583_0034130 | |||
| 1079 | Ga0500641_0146377 | |||
| 1080 | Ga0500660_122104 | |||
| 1081 | Ga0500594_0135922 | |||
| 1082 | Ga0500588_0002738 | |||
| 1083 | Ga0501084_0019768 | |||
| 1084 | Ga0501084_0123328 | |||
| 1085 | Ga0501084_0273354 | |||
| 1086 | Ga0501082_0002800 | |||
| 1087 | Ga0501082_0017784 | |||
| 1088 | Ga0501082_0360070 | |||
| 1089 | Ga0466962_0008705 | |||
| 1090 | Ga0466962_0323637 | |||
| 1091 | Ga0530510_0189615 | |||
| 1092 | Ga0530510_1046654 | |||
| 1093 | 2501944605 | |||
| 1094 | 2515497677 | |||
| 1095 | 2515720404 | |||
| 1096 | 2515757789 | |||
| 1097 | 2516084539 | |||
| 1098 | 2516091597 | |||
| 1099 | 2558911691 | |||
| 1100 | 2623499318 | |||
| 1101 | 2623585453 | |||
| 1102 | 2676490278 | |||
| 1103 | 2734974651 | |||
| 1104 | 2772645272 | |||
| 1105 | 2816505990 | |||
| 1106 | 2831939786 | |||
| 1107 | 2832005847 | |||
| 1108 | 2855672422 | |||
| 1109 | 2855677251 | |||
| 1110 | 2855686248 | |||
| 1111 | 2856859367 | |||
| 1112 | 2857289163 | |||
| 1113 | 2858850285 | |||
| 1114 | 2858874563 | |||
| 1115 | 2858884693 | |||
| 1116 | 2858893354 | |||
| 1117 | 2858898277 | |||
| 1118 | 2858902573 | |||
| 1119 | 2866066330 | |||
| 1120 | 2867306294 | |||
| 1121 | 2867317103 | |||
| 1122 | 2867322925 | |||
| 1123 | 2867510522 | |||
| 1124 | 2869052161 | |||
| 1125 | 2869068261 | |||
| 1126 | 2869073562 | |||
| 1127 | 2870787898 | |||
| 1128 | 2873316128 | |||
| 1129 | 2880494766 | |||
| 1130 | 2880497548 | |||
| 1131 | 2884704097 | |||
| 1132 | 2887485653 | |||
| 1133 | 2891401068 | |||
| 1134 | 2895431880 | |||
| 1135 | 2895448548 | |||
| 1136 | 2902584326 | |||
| 1137 | 2915362479 | |||
| 1138 | 2929226112 | |||
| 1139 | 2929232774 | |||
| 1140 | 2996228135 | |||
| 1141 | 649812768 | |||
| 1142 | 8001783062 | |||
| 1143 | 8003834853 | |||
| 1144 | 8003857172 | |||
| 1145 | 8003876630 | |||
| 1146 | 8054473675 | |||
| 1147 | 8054710696 | |||
| 1148 | 8054732398 | |||
| 1149 | 8054739361 | |||
| 1150 | 8055418098 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ld3-assembly1.cif.gz_A | crystal structure of inorganic phosphatase from anaplasma phagocytophilum at 1.75a resolution | 0.9742 | 2 | 158 |
| 1mjz-assembly1.cif.gz_A | structure of inorganic pyrophosphatase mutant d97n | 0.9713 | 2 | 158 |
| 2au6-assembly1.cif.gz_A | crystal structure of catalytic intermediate of inorganic pyrophosphatase | 0.9712 | 2 | 158 |
| 4um4-assembly1.cif.gz_B | structure of inorganic pyrophosphatase from escherichia coli in complex with sulfate | 0.9699 | 2 | 157 |
| 2au7-assembly1.cif.gz_A | the r43q active site variant of e.coli inorganic pyrophosphatase | 0.9686 | 2 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4z71B00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9668 | 1 | 158 | 3.90.80.10 |
| 1i40A00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9652 | 2 | 159 | 3.90.80.10 |
| 2prdA00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9553 | 2 | 158 | 3.90.80.10 |
| 3emjE00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9451 | 3 | 155 | 3.90.80.10 |
| 3q5vB00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.9414 | 2 | 159 | 3.90.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538N2F7-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9939 | 44 | 164 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A1C6RV02-F1-model_v4 | Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) | 0.9921 | 1 | 164 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A376EYW7-F1-model_v4 | deleted | 0.9918 | 1 | 161 |
|
| AF-A0A7K3W6Z6-F1-model_v4 | Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) | 0.9887 | 1 | 162 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A3B0AVR5-F1-model_v4 | Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) | 0.9886 | 1 | 160 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |