F465012

General Info

Members Datasets Scaffolds Average Seq Length
571 368 544 351

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237098|2513676117
Length 382
Sequence DPGIHAFLSPDQYVDGRVKPGHDAAGTAGVVMTYIAKPKFHHPGLKKNELGYTHRDYEGKISTLCAGCGHDSITASIIEACYELSIEPHRVAKISGIGCSSKTPDYFLGNSHGFNSVHGRMPSVLTGANLANRDLIYLGVSGDGDSASIGFGQFAHSIRRGVNMTYIVENNGVYGLTKGQFSATADRGSKSKKGVVNTDNAIDLVAIALQLGATFVARSFSGDKTQLVPLIAAAIQHKGASFIDVISPCIAFNNHAGSTKSFDYVREHNDAVNRLDVLVGREPIHVDYAPGTVQVVEQHDGSRIALRKLDADYDPHDRVGAMTFLQKHAAKGQIVTGLLYVDPEAEDLHAHLNTVDTPLNTLDAKALCPGSAALDKINASLR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
5 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
8 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
11 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
12 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
15 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
16 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
17 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
18 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
19 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
20 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
21 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
22 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
23 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
24 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
25 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
26 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
27 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
28 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
29 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
33 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
36 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
37 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
38 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
39 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
46 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
62 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
92 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
159 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
237 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
240 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
243 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
244 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
248 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
255 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
256 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
257 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
258 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
259 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
260 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
267 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
268 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
269 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
270 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
306 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
348 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
351 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
352 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
353 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
354 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
355 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
356 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
357 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
358 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
359 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
362 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
363 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
366 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
367 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
368 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.44
Metatranscriptomes 0
Isolates 4.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 1.93
Rhizoplane 2.98
Rhizosphere 81.61
Stem 0
Stem Tuber 0
Unclassified 4.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3047889 2162886007 Bacteria 1684
2 ARSoilYngRDRAFT_c00458 3300000042 Bacteria 4991
3 ARcpr5yngRDRAFT_c002082 3300000043 Bacteria 2112
4 ARSoilOldRDRAFT_c000053 3300000044 Bacteria 23841
5 ARCol0oldRDRAFT_c01210 3300000045 Bacteria 1847
6 ARCol0yngRDRAFT_1000025 3300000652 Bacteria 26845
7 JGI24747J21853_1000252 3300001978 Bacteria 2932
8 JGI24739J22299_10004000 3300001989 Bacteria 5641
9 JGI24739J22299_10008709 3300001989 Bacteria 3784
10 JGI24737J22298_10000053 3300001990 Bacteria 34054
11 JGI24737J22298_10004052 3300001990 Bacteria 5124
12 JGI24750J21931_1000906 3300002070 Bacteria 4027
13 JGI24745J21846_1000906 3300002073 Bacteria 2758
14 JGI24738J21930_10002204 3300002075 Bacteria 5182
15 JGI24035J26624_1000962 3300002126 Bacteria 2711
16 JGI24034J26672_10000960 3300002239 Bacteria 3760
17 JGI24742J22300_10000216 3300002244 Bacteria 8591
18 JGI24751J29686_10004605 3300002459 Bacteria 2802
19 JGI25157J39369_1011623 3300002741 Bacteria 1135
20 Ga0055535_1000063 3300003761 Bacteria 117039
21 Ga0055535_1000072 3300003761 Bacteria 113031
22 Ga0055535_1000219 3300003761 Bacteria 60251
23 Ga0055529_1000287 3300003763 Bacteria 59706
24 Ga0055530_10001762 3300003791 Bacteria 15127
25 Ga0055531_10006219 3300003794 Bacteria 6818
26 Ga0065165_1000472 3300005262 Bacteria 62746
27 Ga0065165_1018743 3300005262 Bacteria 2494
28 Ga0065717_1002456 3300005276 Bacteria 1949
29 Ga0065716_1002341 3300005277 Bacteria 1908
30 Ga0065704_10100585 3300005289 Bacteria 2248
31 Ga0065712_10071633 3300005290 Bacteria 5146
32 Ga0070658_10011015 3300005327 Bacteria 7249
33 Ga0070658_10019708 3300005327 Bacteria 5401
34 Ga0070658_10248509 3300005327 Bacteria 1509
35 Ga0070676_10004729 3300005328 Bacteria 7199
36 Ga0070683_100001083 3300005329 Bacteria 20468
37 Ga0070683_100145741 3300005329 Bacteria 2243
38 Ga0070690_100002762 3300005330 Bacteria 9483
39 Ga0070670_100005035 3300005331 Bacteria 11118
40 Ga0070677_10003137 3300005333 Bacteria 5311
41 Ga0068869_100000279 3300005334 Bacteria 27008
42 Ga0070680_100056337 3300005336 Bacteria 3213
43 Ga0070680_100124707 3300005336 Bacteria 2151
44 Ga0070680_100237101 3300005336 Bacteria 1541
45 Ga0070682_100000287 3300005337 Bacteria 35953
46 Ga0068868_100004075 3300005338 Bacteria 10198
47 Ga0070660_100000245 3300005339 Bacteria 35915
48 Ga0070660_100038256 3300005339 Bacteria 3642
49 Ga0070689_100000422 3300005340 Bacteria 24979
50 Ga0070691_10006681 3300005341 Bacteria 5279
51 Ga0070687_100000348 3300005343 Bacteria 15751
52 Ga0070661_100000017 3300005344 Bacteria 153232
53 Ga0070692_10000101 3300005345 Bacteria 19118
54 Ga0070668_100003604 3300005347 Bacteria 11429
55 Ga0070668_100006939 3300005347 Bacteria 8392
56 Ga0070668_100044014 3300005347 Bacteria 3423
57 Ga0070668_100079031 3300005347 Bacteria 2574
58 Ga0070668_100097123 3300005347 Bacteria 2330
59 Ga0070669_100000314 3300005353 Bacteria 37924
60 Ga0070669_100134363 3300005353 Bacteria 1901
61 Ga0070675_100000161 3300005354 Bacteria 40950
62 Ga0070675_100219713 3300005354 Bacteria 1654
63 Ga0070675_100307217 3300005354 Bacteria 1398
64 Ga0070671_100000313 3300005355 Bacteria 32932
65 Ga0070671_100009979 3300005355 Bacteria 7625
66 Ga0070671_100128052 3300005355 Bacteria 2137
67 Ga0070674_100001686 3300005356 Bacteria 11955
68 Ga0070673_100000272 3300005364 Bacteria 26555
69 Ga0070673_100081674 3300005364 Bacteria 2621
70 Ga0070688_100000306 3300005365 Bacteria 24982
71 Ga0070688_100000991 3300005365 Bacteria 14237
72 Ga0070659_100000467 3300005366 Bacteria 29858
73 Ga0070659_100007586 3300005366 Bacteria 7886
74 Ga0070667_100012364 3300005367 Bacteria 7061
75 Ga0070667_100024052 3300005367 Bacteria 5059
76 Ga0070709_10173754 3300005434 Bacteria 1508
77 Ga0070714_100009580 3300005435 Bacteria 7622
78 Ga0070714_100014952 3300005435 Bacteria 6239
79 Ga0070713_100000371 3300005436 Bacteria 28904
80 Ga0070701_10000204 3300005438 Bacteria 18457
81 Ga0070700_100000856 3300005441 Bacteria 15021
82 Ga0070694_100002279 3300005444 Bacteria 11339
83 Ga0070694_100070271 3300005444 Bacteria 2410
84 Ga0070663_100000945 3300005455 Bacteria 15785
85 Ga0070678_100314752 3300005456 Bacteria 1335
86 Ga0070662_100003593 3300005457 Bacteria 9675
87 Ga0070681_10009252 3300005458 Bacteria 9684
88 Ga0070681_10041263 3300005458 Bacteria 4624
89 Ga0070681_10049176 3300005458 Bacteria 4212
90 Ga0070681_10264052 3300005458 Bacteria 1633
91 Ga0068867_100151199 3300005459 Bacteria 1824
92 Ga0070685_10031229 3300005466 Bacteria 2974
93 Ga0070679_100002050 3300005530 Bacteria 18095
94 Ga0070679_100013603 3300005530 Bacteria 7796
95 Ga0070679_100100453 3300005530 Bacteria 2879
96 Ga0070679_100228746 3300005530 Bacteria 1819
97 Ga0070679_100238982 3300005530 Bacteria 1774
98 Ga0070684_100000365 3300005535 Bacteria 31110
99 Ga0070684_100035412 3300005535 Bacteria 4272
100 Ga0068853_100000523 3300005539 Bacteria 25970
101 Ga0070672_100000709 3300005543 Bacteria 19721
102 Ga0070686_100000455 3300005544 Bacteria 24982
103 Ga0070695_100001044 3300005545 Bacteria 15130
104 Ga0070696_100021689 3300005546 Bacteria 4356
105 Ga0070696_100237412 3300005546 Bacteria 1373
106 Ga0070693_100000905 3300005547 Bacteria 13209
107 Ga0070693_100060132 3300005547 Bacteria 2205
108 Ga0070665_100000327 3300005548 Bacteria 73382
109 Ga0070665_100052141 3300005548 Bacteria 4105
110 Ga0070665_100109298 3300005548 Bacteria 2767
111 Ga0070665_100140598 3300005548 Bacteria 2418
112 Ga0070704_100000197 3300005549 Bacteria 24897
113 Ga0068855_100040932 3300005563 Bacteria 5495
114 Ga0068855_100079840 3300005563 Bacteria 3793
115 Ga0068855_100098430 3300005563 Bacteria 3369
116 Ga0068855_100099582 3300005563 Bacteria 3347
117 Ga0068855_100643262 3300005563 Bacteria 1139
118 Ga0070664_100002074 3300005564 Bacteria 16005
119 Ga0068857_100000921 3300005577 Bacteria 22261
120 Ga0068857_100024980 3300005577 Bacteria 5262
121 Ga0068854_100000749 3300005578 Bacteria 19195
122 Ga0068854_100019836 3300005578 Bacteria 4537
123 Ga0068856_100000902 3300005614 Bacteria 31812
124 Ga0068856_100253827 3300005614 Bacteria 1773
125 Ga0070702_100002928 3300005615 Bacteria 7519
126 Ga0070702_100164471 3300005615 Bacteria 1437
127 Ga0068852_100015241 3300005616 Bacteria 5953
128 Ga0068852_100110867 3300005616 Bacteria 2494
129 Ga0068859_100004450 3300005617 Bacteria 14299
130 Ga0068859_100008773 3300005617 Bacteria 10209
131 Ga0068859_100089758 3300005617 Bacteria 3124
132 Ga0068864_100049073 3300005618 Bacteria 3630
133 Ga0068866_10002012 3300005718 Bacteria 8459
134 Ga0068861_100000825 3300005719 Bacteria 18722
135 Ga0068870_10000112 3300005840 Bacteria 27710
136 Ga0068863_100000703 3300005841 Bacteria 33695
137 Ga0068863_100023806 3300005841 Bacteria 5845
138 Ga0068858_100008283 3300005842 Bacteria 9996
139 Ga0068858_100019588 3300005842 Bacteria 6326
140 Ga0068860_100000165 3300005843 Bacteria 108321
141 Ga0068860_100006736 3300005843 Bacteria 11522
142 Ga0068860_100049862 3300005843 Bacteria 3986
143 Ga0068860_100051115 3300005843 Bacteria 3933
144 Ga0068860_100120534 3300005843 Bacteria 2512
145 Ga0068862_100006290 3300005844 Bacteria 9882
146 Ga0068862_100100949 3300005844 Bacteria 2524
147 Ga0081455_10011886 3300005937 Bacteria 8717
148 Ga0081540_1010346 3300005983 Bacteria 6327
149 Ga0081540_1014849 3300005983 Bacteria 4959
150 Ga0081540_1033560 3300005983 Bacteria 2785
151 Ga0081540_1083756 3300005983 Bacteria 1425
152 Ga0075368_10024712 3300006042 Bacteria 2302
153 Ga0075363_100114362 3300006048 Bacteria 1502
154 Ga0075364_10057532 3300006051 Bacteria 2547
155 Ga0075364_10145686 3300006051 Bacteria 1594
156 Ga0070716_100117379 3300006173 Bacteria 1660
157 Ga0075362_10036225 3300006177 Bacteria 2157
158 Ga0075369_10015948 3300006186 Bacteria 3024
159 Ga0075366_10049965 3300006195 Bacteria 2482
160 Ga0097621_100000473 3300006237 Bacteria 28196
161 Ga0097621_100025204 3300006237 Bacteria 4651
162 Ga0075370_10068039 3300006353 Bacteria 2033
163 Ga0068871_100000118 3300006358 Bacteria 49211
164 Ga0068871_100016676 3300006358 Bacteria 5540
165 Ga0068871_100389850 3300006358 Bacteria 1239
166 Ga0075428_100208791 3300006844 Bacteria 2110
167 Ga0075430_100033350 3300006846 Bacteria 4370
168 Ga0075431_100212332 3300006847 Bacteria 1977
169 Ga0075431_100263706 3300006847 Bacteria 1748
170 Ga0075434_100013398 3300006871 Bacteria 7801
171 Ga0075434_100434097 3300006871 Bacteria 1335
172 Ga0097620_100004450 3300006931 Bacteria 14299
173 Ga0097620_100008773 3300006931 Bacteria 10209
174 Ga0097620_100089759 3300006931 Bacteria 3124
175 Ga0105240_10022758 3300009093 Bacteria 8302
176 Ga0105240_10064698 3300009093 Bacteria 4543
177 Ga0111539_10001167 3300009094 Bacteria 34770
178 Ga0111539_10004804 3300009094 Bacteria 17625
179 Ga0105245_10001982 3300009098 Bacteria 18594
180 Ga0105245_10021615 3300009098 Bacteria 5646
181 Ga0114129_10015418 3300009147 Bacteria 10872
182 Ga0114129_10180395 3300009147 Bacteria 2873
183 Ga0105243_10002278 3300009148 Bacteria 16096
184 Ga0105243_10054499 3300009148 Bacteria 3175
185 Ga0105241_10003555 3300009174 Bacteria 11590
186 Ga0105242_10001156 3300009176 Bacteria 20789
187 Ga0105248_10002414 3300009177 Bacteria 20740
188 Ga0105248_10010454 3300009177 Bacteria 10220
189 Ga0105248_10414399 3300009177 Bacteria 1517
190 Ga0105238_10028630 3300009551 Bacteria 5675
191 Ga0105249_10001021 3300009553 Bacteria 24754
192 Ga0105249_10006960 3300009553 Bacteria 9861
193 Ga0099796_10018054 3300010159 Bacteria 2112
194 Ga0105239_10008950 3300010375 Bacteria 11329
195 Ga0105239_10038202 3300010375 Bacteria 5261
196 Ga0105246_10003701 3300011119 Bacteria 9254
197 Ga0157326_1000541 3300012513 Bacteria 4473
198 Ga0157373_10005579 3300013100 Bacteria 9433
199 Ga0157373_10006895 3300013100 Bacteria 8454
200 Ga0157373_10162181 3300013100 Bacteria 1573
201 Ga0157371_10016850 3300013102 Bacteria 5440
202 Ga0157371_10131676 3300013102 Bacteria 1779
203 Ga0157369_10521336 3300013105 Bacteria 1229
204 Ga0157374_10015941 3300013296 Bacteria 6602
205 Ga0157378_10002986 3300013297 Bacteria 15027
206 Ga0157378_10375921 3300013297 Bacteria 1394
207 Ga0163162_10009522 3300013306 Bacteria 9448
208 Ga0157372_10008348 3300013307 Bacteria 11015
209 Ga0157375_10000508 3300013308 Bacteria 35108
210 Ga0157375_10053915 3300013308 Bacteria 3959
211 Ga0163163_10082125 3300014325 Bacteria 3226
212 Ga0157380_10000212 3300014326 Bacteria 34358
213 Ga0157377_10000287 3300014745 Bacteria 24040
214 Ga0157379_10008690 3300014968 Bacteria 8847
215 Ga0157379_10046080 3300014968 Bacteria 3892
216 Ga0157376_10004642 3300014969 Bacteria 9575
217 Ga0157376_10016040 3300014969 Bacteria 5675
218 Ga0163161_10000415 3300017792 Bacteria 35797
219 Ga0209258_100123 3300025242 Bacteria 178931
220 Ga0209026_1005744 3300025250 Bacteria 3239
221 Ga0209759_1001598 3300025256 Bacteria 12262
222 Ga0209233_1009332 3300025261 Bacteria 2991
223 Ga0207666_1000073 3300025271 Bacteria 16742
224 Ga0209455_1000115 3300025272 Bacteria 178506
225 Ga0207673_1000295 3300025290 Bacteria 5011
226 Ga0209758_1003089 3300025297 Bacteria 15775
227 Ga0209050_1000431 3300025298 Bacteria 76895
228 Ga0209257_1000572 3300025304 Bacteria 61910
229 Ga0209257_1001182 3300025304 Bacteria 33003
230 Ga0207697_10000061 3300025315 Bacteria 45271
231 Ga0207697_10005956 3300025315 Bacteria 5594
232 Ga0207653_10005338 3300025885 Bacteria 4015
233 Ga0207682_10002961 3300025893 Bacteria 7454
234 Ga0207692_10150929 3300025898 Bacteria 1331
235 Ga0207642_10001238 3300025899 Bacteria 7906
236 Ga0207688_10000001 3300025901 Bacteria 107505
237 Ga0207688_10015574 3300025901 Bacteria 4122
238 Ga0207685_10037419 3300025905 Bacteria 1787
239 Ga0207645_10000222 3300025907 Bacteria 47139
240 Ga0207643_10000009 3300025908 Bacteria 160496
241 Ga0207705_10019295 3300025909 Bacteria 4875
242 Ga0207705_10054591 3300025909 Bacteria 2879
243 Ga0207705_10086233 3300025909 Bacteria 2294
244 Ga0207654_10001390 3300025911 Bacteria 12824
245 Ga0207707_10004174 3300025912 Bacteria 12795
246 Ga0207707_10007205 3300025912 Bacteria 9680
247 Ga0207707_10139243 3300025912 Bacteria 2122
248 Ga0207707_10317028 3300025912 Bacteria 1347
249 Ga0207695_10002836 3300025913 Bacteria 25176
250 Ga0207695_10003652 3300025913 Bacteria 21488
251 Ga0207695_10037195 3300025913 Bacteria 5254
252 Ga0207695_10041473 3300025913 Bacteria 4927
253 Ga0207671_10033935 3300025914 Bacteria 3794
254 Ga0207660_10000197 3300025917 Bacteria 38486
255 Ga0207660_10056050 3300025917 Bacteria 2819
256 Ga0207657_10000776 3300025919 Bacteria 33868
257 Ga0207657_10060873 3300025919 Bacteria 3239
258 Ga0207649_10000052 3300025920 Bacteria 106800
259 Ga0207649_10271357 3300025920 Bacteria 1230
260 Ga0207652_10001438 3300025921 Bacteria 21098
261 Ga0207652_10028531 3300025921 Bacteria 4657
262 Ga0207652_10041704 3300025921 Bacteria 3903
263 Ga0207652_10065597 3300025921 Bacteria 3144
264 Ga0207652_10096741 3300025921 Bacteria 2601
265 Ga0207652_10169340 3300025921 Bacteria 1959
266 Ga0207681_10000035 3300025923 Bacteria 161792
267 Ga0207681_10307423 3300025923 Bacteria 1256
268 Ga0207694_10057865 3300025924 Bacteria 3015
269 Ga0207650_10006131 3300025925 Bacteria 8190
270 Ga0207650_10035460 3300025925 Bacteria 3623
271 Ga0207659_10000132 3300025926 Bacteria 43798
272 Ga0207659_10093633 3300025926 Bacteria 2249
273 Ga0207687_10000174 3300025927 Bacteria 42351
274 Ga0207687_10017776 3300025927 Bacteria 4688
275 Ga0207700_10000274 3300025928 Bacteria 30765
276 Ga0207700_10118585 3300025928 Bacteria 2142
277 Ga0207664_10007717 3300025929 Bacteria 7469
278 Ga0207644_10000212 3300025931 Bacteria 40175
279 Ga0207644_10016349 3300025931 Bacteria 4992
280 Ga0207644_10098037 3300025931 Bacteria 2196
281 Ga0207690_10000148 3300025932 Bacteria 56244
282 Ga0207690_10000294 3300025932 Bacteria 35162
283 Ga0207706_10001360 3300025933 Bacteria 24441
284 Ga0207706_10025201 3300025933 Bacteria 5332
285 Ga0207706_10144799 3300025933 Bacteria 2090
286 Ga0207709_10000530 3300025935 Bacteria 33097
287 Ga0207670_10000523 3300025936 Bacteria 21171
288 Ga0207670_10317815 3300025936 Bacteria 1224
289 Ga0207669_10000857 3300025937 Bacteria 12949
290 Ga0207704_10000198 3300025938 Bacteria 31182
291 Ga0207691_10000517 3300025940 Bacteria 38398
292 Ga0207691_10076224 3300025940 Bacteria 3022
293 Ga0207691_10252651 3300025940 Bacteria 1521
294 Ga0207711_10008997 3300025941 Bacteria 8349
295 Ga0207711_10041446 3300025941 Bacteria 3921
296 Ga0207711_10311697 3300025941 Bacteria 1453
297 Ga0207689_10000031 3300025942 Bacteria 97131
298 Ga0207661_10001089 3300025944 Bacteria 18028
299 Ga0207661_10094772 3300025944 Bacteria 2494
300 Ga0207679_10000183 3300025945 Bacteria 51645
301 Ga0207667_10057690 3300025949 Bacteria 4074
302 Ga0207667_10458292 3300025949 Bacteria 1295
303 Ga0207651_10000051 3300025960 Bacteria 54163
304 Ga0207651_10155404 3300025960 Bacteria 1786
305 Ga0207712_10000738 3300025961 Bacteria 24767
306 Ga0207712_10056531 3300025961 Bacteria 2765
307 Ga0207668_10000664 3300025972 Bacteria 21087
308 Ga0207668_10009551 3300025972 Bacteria 5821
309 Ga0207668_10078238 3300025972 Bacteria 2387
310 Ga0207640_10002152 3300025981 Bacteria 10584
311 Ga0207658_10016338 3300025986 Bacteria 5104
312 Ga0207677_10075252 3300026023 Bacteria 2399
313 Ga0207703_10279307 3300026035 Bacteria 1516
314 Ga0207703_10321818 3300026035 Bacteria 1416
315 Ga0207639_10001257 3300026041 Bacteria 17164
316 Ga0207678_10000531 3300026067 Bacteria 34761
317 Ga0207708_10000573 3300026075 Bacteria 28465
318 Ga0207708_10006283 3300026075 Bacteria 8804
319 Ga0207702_10003284 3300026078 Bacteria 14915
320 Ga0207641_10001041 3300026088 Bacteria 28118
321 Ga0207648_10000581 3300026089 Bacteria 41019
322 Ga0207676_10000124 3300026095 Bacteria 67747
323 Ga0207676_10033074 3300026095 Bacteria 3904
324 Ga0207674_10000095 3300026116 Bacteria 99278
325 Ga0207674_10032833 3300026116 Bacteria 5441
326 Ga0207675_100000414 3300026118 Bacteria 41042
327 Ga0207675_100149414 3300026118 Bacteria 2223
328 Ga0207683_10000242 3300026121 Bacteria 48576
329 Ga0207698_10000951 3300026142 Bacteria 16837
330 Ga0207698_10473032 3300026142 Bacteria 1214
331 Ga0209981_1001280 3300027378 Bacteria 3191
332 Ga0210000_1001323 3300027462 Bacteria 3489
333 Ga0209999_1004075 3300027543 Bacteria 2625
334 Ga0209999_1008573 3300027543 Bacteria 1845
335 Ga0209982_1006315 3300027552 Bacteria 1722
336 Ga0210002_1001450 3300027617 Bacteria 3346
337 Ga0209983_1001668 3300027665 Bacteria 4921
338 Ga0209971_1004583 3300027682 Bacteria 3279
339 Ga0209966_1001052 3300027695 Bacteria 5088
340 Ga0209974_10001326 3300027876 Bacteria 8891
341 Ga0209974_10006235 3300027876 Bacteria 4171
342 Ga0207428_10000037 3300027907 Bacteria 218857
343 Ga0207428_10001773 3300027907 Bacteria 22109
344 Ga0268266_10000064 3300028379 Bacteria 249533
345 Ga0268266_10050497 3300028379 Bacteria 3569
346 Ga0268266_10071783 3300028379 Bacteria 3001
347 Ga0268266_10076065 3300028379 Bacteria 2917
348 Ga0268265_10000757 3300028380 Bacteria 31383
349 Ga0268265_10010381 3300028380 Bacteria 6292
350 Ga0268265_10012546 3300028380 Bacteria 5744
351 Ga0268265_10101042 3300028380 Bacteria 2329
352 Ga0268264_10000021 3300028381 Bacteria 481580
353 Ga0268264_10002331 3300028381 Bacteria 16789
354 Ga0268264_10012005 3300028381 Bacteria 7133
355 Ga0265336_10000048 3300028666 Bacteria 121572
356 Ga0307517_10004666 3300028786 Bacteria 21011
357 Ga0307515_10000020 3300028794 Bacteria 411735
358 Ga0265324_10003288 3300029957 Bacteria 7765
359 Ga0307511_10061552 3300030521 Bacteria 2859
360 Ga0265330_10068397 3300031235 Bacteria 1538
361 Ga0265325_10024100 3300031241 Bacteria 3312
362 Ga0265339_10002224 3300031249 Bacteria 14062
363 Ga0265327_10077631 3300031251 Bacteria 1647
364 Ga0307513_10001560 3300031456 Bacteria 32859
365 Ga0307513_10025455 3300031456 Bacteria 6855
366 Ga0307408_100098197 3300031548 Bacteria 2226
367 Ga0265313_10000098 3300031595 Bacteria 89130
368 Ga0265342_10099615 3300031712 Bacteria 1657
369 Ga0265342_10134189 3300031712 Bacteria 1385
370 Ga0307516_10003023 3300031730 Bacteria 21939
371 Ga0307507_10128569 3300033179 Bacteria 1993
372 Ga0307510_10026020 3300033180 Bacteria 6736
373 Ga0373930_0000371 3300034816 Bacteria 5868
374 Ga0373948_0000135 3300034817 Bacteria 7792
375 Ga0373950_0000327 3300034818 Bacteria 5972
376 Ga0373958_0000084 3300034819 Bacteria 9758
377 Ga0373938_0000013 3300034957 Bacteria 24269
378 Ga0373928_0001053 3300035084 Bacteria 5442
379 Ga0373929_0002957 3300035085 Bacteria 3093
380 Ga0373940_0002191 3300035088 Bacteria 3746
381 Ga0373949_0001274 3300035090 Bacteria 7344
382 Ga0373951_0006039 3300035091 Bacteria 2787
383 Ga0373952_0000880 3300035092 Bacteria 5466
384 Ga0373932_0000427 3300035112 Bacteria 12821
385 Ga0373932_0001840 3300035112 Bacteria 5677
386 Ga0373936_0005812 3300035113 Bacteria 4647
387 Ga0373939_0000704 3300035114 Bacteria 8284
388 Ga0373960_0000570 3300035121 Bacteria 7483
389 Ga0373942_0000725 3300035207 Bacteria 9083
390 Ga0373962_0000542 3300035242 Bacteria 8470
391 Ga0373962_0000610 3300035242 Bacteria 8072
392 Ga0373931_0002178 3300035691 Bacteria 8639
393 Ga0373931_0046588 3300035691 Bacteria 2292
394 Ga0373927_0073950 3300035695 Bacteria 2207
395 Ga0373927_0106094 3300035695 Bacteria 1829
396 Ga0373927_0163754 3300035695 Bacteria 1457
397 Ga0373925_0263357 3300037068 Bacteria 1385
398 Ga0395899_0005491 3300037312 Bacteria 9828
399 Ga0395899_0037648 3300037312 Bacteria 3626
400 Ga0395900_0004219 3300037418 Bacteria 15252
401 Ga0395900_0017348 3300037418 Bacteria 7350
402 Ga0395900_0160111 3300037418 Bacteria 2296
403 Ga0395900_0202164 3300037418 Bacteria 2009
404 Ga0395900_0316748 3300037418 Bacteria 1541
405 Ga0395898_0014233 3300037466 Bacteria 8177
406 Ga0395898_0015013 3300037466 Bacteria 7950
407 Ga0395898_0022197 3300037466 Bacteria 6432
408 Ga0395898_0352416 3300037466 Bacteria 1403
409 Ga0395905_0000983 3300037471 Bacteria 36562
410 Ga0395901_0022367 3300038443 Bacteria 6478
411 Ga0395901_0088277 3300038443 Bacteria 3243
412 Ga0395901_0130825 3300038443 Bacteria 2637
413 Ga0395901_0242258 3300038443 Bacteria 1880
414 Ga0395901_0603684 3300038443 Bacteria 1106
415 Ga0436365_0677869 3300039437 Bacteria 1359
416 Ga0436365_1378731 3300039437 Bacteria 1495
417 Ga0436360_0898381 3300039438 Bacteria 1634
418 Ga0436360_1266199 3300039438 Bacteria 1137
419 Ga0436361_0180569 3300039447 Bacteria 3182
420 Ga0451577_0004901 3300042876 Bacteria 13951
421 Ga0451577_0057580 3300042876 Bacteria 3464
422 Ga0451577_0068162 3300042876 Bacteria 3173
423 Ga0451577_0146502 3300042876 Bacteria 2123
424 Ga0453683_0013725 3300044673 Bacteria 5275
425 Ga0453683_0048258 3300044673 Bacteria 2671
426 Ga0466966_0051914 3300044684 Bacteria 2606
427 Ga0466963_0043929 3300044694 Bacteria 2940
428 Ga0453684_0014814 3300044712 Bacteria 12416
429 Ga0466957_0188578 3300044842 Bacteria 1350
430 Ga0451576_0006125 3300045051 Bacteria 14822
431 Ga0451576_0024532 3300045051 Bacteria 6514
432 Ga0451576_0177053 3300045051 Bacteria 2227
433 Ga0466967_0003577 3300045976 Bacteria 10195
434 Ga0495603_0097030 3300046455 Bacteria 1722
435 Ga0495638_0159912 3300046460 Bacteria 1300
436 Ga0495638_0164278 3300046460 Bacteria 1278
437 Ga0495639_0003100 3300046475 Bacteria 7230
438 Ga0495583_0000062 3300046506 Bacteria 195151
439 Ga0495606_0001633 3300046507 Bacteria 29221
440 Ga0495637_0021073 3300046520 Bacteria 2991
441 Ga0495637_0060757 3300046520 Bacteria 1551
442 Ga0495640_0007537 3300046533 Bacteria 8551
443 Ga0495621_0030896 3300046539 Bacteria 1834
444 Ga0495597_0037382 3300046542 Bacteria 2180
445 Ga0495668_0065197 3300046616 Bacteria 2005
446 Ga0495634_0054248 3300046642 Bacteria 2684
447 Ga0495625_0007787 3300046660 Bacteria 9246
448 Ga0495625_0035033 3300046660 Bacteria 3702
449 Ga0495659_0005240 3300046664 Bacteria 4078
450 Ga0495669_0000009 3300046684 Bacteria 165516
451 Ga0495649_0000247 3300046694 Bacteria 47906
452 Ga0495589_0003753 3300046794 Bacteria 8176
453 Ga0495674_0073619 3300047319 Bacteria 2944
454 Ga0495677_0069031 3300047445 Bacteria 1316
455 Ga0495686_0000049 3300047472 Bacteria 275004
456 Ga0495686_0014246 3300047472 Bacteria 5479
457 Ga0496101_0000866 3300048904 Bacteria 17903
458 Ga0496102_0001833 3300048905 Bacteria 18355
459 Ga0496102_0246568 3300048905 Bacteria 1684
460 Ga0496103_0001022 3300048906 Bacteria 19583
461 Ga0496107_0000118 3300048910 Bacteria 38697
462 Ga0496108_0006961 3300048911 Bacteria 9152
463 Ga0496108_0077610 3300048911 Bacteria 2810
464 Ga0496109_0002269 3300048912 Bacteria 15980
465 Ga0496109_0042716 3300048912 Bacteria 4108
466 Ga0496110_0156665 3300048913 Bacteria 2063
467 Ga0496112_0064319 3300048915 Bacteria 3620
468 Ga0496112_0102359 3300048915 Bacteria 2834
469 Ga0496113_0067850 3300048916 Bacteria 2706
470 Ga0496114_0372423 3300048917 Bacteria 1264
471 Ga0496115_0000967 3300048918 Bacteria 20862
472 Ga0496115_0106814 3300048918 Bacteria 2298
473 Ga0496126_0018874 3300048929 Bacteria 6814
474 Ga0501031_0222190 3300049568 Bacteria 1230
475 Ga0501032_0054310 3300049569 Bacteria 2697
476 Ga0501033_0033776 3300049570 Bacteria 3840
477 Ga0501034_0086892 3300049571 Bacteria 3127
478 Ga0501038_0149809 3300049574 Bacteria 1902
479 Ga0501038_0187603 3300049574 Bacteria 1665
480 Ga0501039_0149854 3300049575 Bacteria 1833
481 Ga0501043_0015687 3300049579 Bacteria 5939
482 Ga0501047_0000729 3300049581 Bacteria 34190
483 Ga0501047_0012289 3300049581 Bacteria 8103
484 Ga0501047_0027647 3300049581 Bacteria 5465
485 Ga0501047_0106554 3300049581 Bacteria 2684
486 Ga0501047_0109557 3300049581 Bacteria 2644
487 Ga0501047_0350892 3300049581 Bacteria 1312
488 Ga0501067_0065525 3300049583 Bacteria 2011
489 Ga0501067_0088263 3300049583 Bacteria 1721
490 Ga0501068_0021679 3300049584 Bacteria 3754
491 Ga0501070_0039278 3300049586 Bacteria 3948
492 Ga0501070_0110901 3300049586 Bacteria 2267
493 Ga0501072_0097662 3300049588 Bacteria 2335
494 Ga0501073_0027102 3300049589 Bacteria 4101
495 Ga0501073_0091631 3300049589 Bacteria 2113
496 Ga0501073_0155006 3300049589 Bacteria 1588
497 Ga0501074_0190975 3300049590 Bacteria 1460
498 Ga0501075_0114076 3300049591 Bacteria 2055
499 Ga0501080_0129759 3300049742 Bacteria 2333
500 Ga0501080_0156434 3300049742 Bacteria 2105
501 Ga0501083_0014143 3300049744 Bacteria 5581
502 Ga0501083_0088579 3300049744 Bacteria 2046
503 Ga0501035_0001116 3300049822 Bacteria 28096
504 Ga0501035_0027156 3300049822 Bacteria 5234
505 Ga0501035_0087906 3300049822 Bacteria 2739
506 Ga0501044_0000222 3300049823 Bacteria 71930
507 Ga0501044_0006838 3300049823 Bacteria 12568
508 Ga0501044_0066214 3300049823 Bacteria 3684
509 nmdc:mga0k408_34689_c2 3300050493 Bacteria 2284
510 nmdc:mga07m45_59399_c1 3300050496 Bacteria 2164
511 nmdc:mga0qj67_151017_c1 3300050509 Bacteria 1885
512 nmdc:mga06r32_115174_c1 3300050510 Bacteria 2647
513 nmdc:mga08y16_13712_c1 3300050511 Bacteria 8533
514 nmdc:mga08y16_333_c1 3300050511 Bacteria 42807
515 nmdc:mga0n895_62_c1 3300050512 Bacteria 62891
516 nmdc:mga0n895_97850_c1 3300050512 Bacteria 2940
517 Ga0495601_0011855 3300053077 Bacteria 5226
518 Ga0495595_0009473 3300053084 Bacteria 4030
519 Ga0495619_0025558 3300053085 Bacteria 3793
520 Ga0500643_004921 3300053087 Bacteria 5880
521 Ga0500644_0000282 3300053088 Bacteria 28207
522 Ga0500651_0001656 3300053093 Bacteria 11353
523 Ga0500641_0001396 3300053096 Bacteria 8609
524 Ga0500641_0008896 3300053096 Bacteria 3599
525 Ga0500641_0041561 3300053096 Bacteria 1861
526 Ga0500562_011969 3300053108 Bacteria 2202
527 Ga0500593_032897 3300053117 Bacteria 2321
528 Ga0500594_0013276 3300053118 Bacteria 1956
529 Ga0500595_000016 3300053119 Bacteria 211397
530 Ga0500642_0010511 3300053130 Bacteria 3267
531 Ga0500652_000024 3300053131 Bacteria 116239
532 Ga0500652_061781 3300053131 Bacteria 1543
533 Ga0500655_000102 3300053133 Bacteria 21853
534 Ga0500590_000159 3300053148 Bacteria 19562
535 Ga0500604_0012877 3300053151 Bacteria 2263
536 Ga0500616_0000006 3300053153 Bacteria 944738
537 Ga0500616_0012855 3300053153 Bacteria 4881
538 Ga0500616_0028109 3300053153 Bacteria 3101
539 Ga0500616_0092438 3300053153 Bacteria 1495
540 Ga0500622_0006073 3300053156 Bacteria 7092
541 Ga0500627_0016976 3300053158 Bacteria 2851
542 Ga0500570_000434 3300053724 Bacteria 16045
543 Ga0500645_000033 3300053730 Bacteria 119279
544 Ga0500645_000666 3300053730 Bacteria 21562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0603684 Ga0395901_0603684_111_1070 319
2 3300048929 Ga0496126_0018874 Ga0496126_0018874_216_1376 341
3 iso_pu_bacteria 2524023210 2524466577 347
4 iso_pu_bacteria 2524023228 2524534660 347
5 iso_pu_bacteria 2582581305 2585261929 347
6 iso_pu_bacteria 2643221541 2643731008 347
7 iso_pu_bacteria 2643221598 2643999041 347
8 iso_pu_bacteria 2643221605 2644039064 347
9 iso_pu_bacteria 2643221606 2644044339 347
10 iso_pu_bacteria 2643221614 2644085038 347
11 iso_pu_bacteria 2643221661 2644342590 347
12 iso_pu_bacteria 2643221666 2644365890 347
13 iso_pu_bacteria 2643221671 2644391737 347
14 iso_pu_bacteria 2667528175 2671119309 347
15 iso_pu_bacteria 2791355197 2793071984 347
16 iso_pu_bacteria 2885374607 2885378315 347
17 iso_pu_bacteria 2903768456 2903769750 347
18 iso_pu_bacteria 2904699407 2904706143 347
19 iso_pu_bacteria 2935630451 2935632330 347
20 iso_pu_bacteria 2939631187 2939631439 347
21 iso_pu_bacteria 2941507105 2941508277 347
22 iso_pu_bacteria 2941515067 2941515217 347
23 iso_pu_bacteria 2941523033 2941524208 347
24 iso_pu_bacteria 8006933436 8006933797 347
25 iso_pu_bacteria 8006973647 8006983469 347
26 iso_pu_bacteria 8056681323 8056689684 347
27 iso_pu_bacteria 8056689827 8056693181 347
28 2162886007 SwRhRL2b_contig_3047889 SwRhRL2b_0947.00007960 351
29 3300000042 ARSoilYngRDRAFT_c00458 ARSoilYngRDRAFT_004585 351
30 3300000043 ARcpr5yngRDRAFT_c002082 ARcpr5yngRDRAFT_0020822 351
31 3300000044 ARSoilOldRDRAFT_c000053 ARSoilOldRDRAFT_00005331 351
32 3300000045 ARCol0oldRDRAFT_c01210 ARCol0oldRDRAFT_012102 351
33 3300000652 ARCol0yngRDRAFT_1000025 ARCol0yngRDRAFT_100002535 351
34 3300001978 JGI24747J21853_1000252 JGI24747J21853_10002522 351
35 3300001989 JGI24739J22299_10004000 JGI24739J22299_100040004 351
36 3300001989 JGI24739J22299_10008709 JGI24739J22299_100087093 351
37 3300001990 JGI24737J22298_10000053 JGI24737J22298_1000005326 351
38 3300001990 JGI24737J22298_10004052 JGI24737J22298_100040526 351
39 3300002070 JGI24750J21931_1000906 JGI24750J21931_10009063 351
40 3300002073 JGI24745J21846_1000906 JGI24745J21846_10009062 351
41 3300002075 JGI24738J21930_10002204 JGI24738J21930_100022046 351
42 3300002126 JGI24035J26624_1000962 JGI24035J26624_10009622 351
43 3300002239 JGI24034J26672_10000960 JGI24034J26672_100009602 351
44 3300002244 JGI24742J22300_10000216 JGI24742J22300_100002169 351
45 3300002459 JGI24751J29686_10004605 JGI24751J29686_100046052 351
46 3300002741 JGI25157J39369_1011623 JGI25157J39369_10116231 351
47 3300003761 Ga0055535_1000063 Ga0055535_100006375 351
48 3300003761 Ga0055535_1000072 Ga0055535_100007278 351
49 3300003761 Ga0055535_1000219 Ga0055535_100021924 351
50 3300003763 Ga0055529_1000287 Ga0055529_100028741 351
51 3300003791 Ga0055530_10001762 Ga0055530_1000176210 351
52 3300003794 Ga0055531_10006219 Ga0055531_100062192 351
53 3300005262 Ga0065165_1000472 Ga0065165_100047226 351
54 3300005262 Ga0065165_1018743 Ga0065165_10187432 351
55 3300005276 Ga0065717_1002456 Ga0065717_10024562 351
56 3300005277 Ga0065716_1002341 Ga0065716_10023411 351
57 3300005289 Ga0065704_10100585 Ga0065704_101005852 351
58 3300005290 Ga0065712_10071633 Ga0065712_100716335 351
59 3300005327 Ga0070658_10011015 Ga0070658_100110156 351
60 3300005327 Ga0070658_10019708 Ga0070658_100197084 351
61 3300005327 Ga0070658_10248509 Ga0070658_102485092 351
62 3300005328 Ga0070676_10004729 Ga0070676_100047297 351
63 3300005329 Ga0070683_100001083 Ga0070683_1000010837 351
64 3300005329 Ga0070683_100145741 Ga0070683_1001457412 351
65 3300005330 Ga0070690_100002762 Ga0070690_1000027628 351
66 3300005331 Ga0070670_100005035 Ga0070670_1000050354 351
67 3300005333 Ga0070677_10003137 Ga0070677_100031374 351
68 3300005334 Ga0068869_100000279 Ga0068869_10000027912 351
69 3300005336 Ga0070680_100056337 Ga0070680_1000563372 351
70 3300005336 Ga0070680_100124707 Ga0070680_1001247071 351
71 3300005336 Ga0070680_100237101 Ga0070680_1002371011 351
72 3300005337 Ga0070682_100000287 Ga0070682_1000002872 351
73 3300005338 Ga0068868_100004075 Ga0068868_1000040757 351
74 3300005339 Ga0070660_100000245 Ga0070660_10000024524 351
75 3300005339 Ga0070660_100038256 Ga0070660_1000382566 351
76 3300005340 Ga0070689_100000422 Ga0070689_1000004222 351
77 3300005341 Ga0070691_10006681 Ga0070691_100066812 351
78 3300005343 Ga0070687_100000348 Ga0070687_10000034816 351
79 3300005344 Ga0070661_100000017 Ga0070661_100000017153 351
80 3300005345 Ga0070692_10000101 Ga0070692_1000010116 351
81 3300005347 Ga0070668_100003604 Ga0070668_10000360412 351
82 3300005347 Ga0070668_100006939 Ga0070668_1000069392 351
83 3300005347 Ga0070668_100044014 Ga0070668_1000440142 351
84 3300005347 Ga0070668_100079031 Ga0070668_1000790312 351
85 3300005347 Ga0070668_100097123 Ga0070668_1000971232 351
86 3300005353 Ga0070669_100000314 Ga0070669_10000031427 351
87 3300005353 Ga0070669_100134363 Ga0070669_1001343632 351
88 3300005354 Ga0070675_100000161 Ga0070675_10000016127 351
89 3300005354 Ga0070675_100219713 Ga0070675_1002197132 351
90 3300005354 Ga0070675_100307217 Ga0070675_1003072172 351
91 3300005355 Ga0070671_100000313 Ga0070671_10000031326 351
92 3300005355 Ga0070671_100009979 Ga0070671_1000099794 351
93 3300005355 Ga0070671_100128052 Ga0070671_1001280522 351
94 3300005356 Ga0070674_100001686 Ga0070674_1000016867 351
95 3300005364 Ga0070673_100000272 Ga0070673_10000027227 351
96 3300005364 Ga0070673_100081674 Ga0070673_1000816741 351
97 3300005365 Ga0070688_100000306 Ga0070688_1000003062 351
98 3300005365 Ga0070688_100000991 Ga0070688_1000009912 351
99 3300005366 Ga0070659_100000467 Ga0070659_1000004673 351
100 3300005366 Ga0070659_100007586 Ga0070659_1000075862 351
101 3300005367 Ga0070667_100012364 Ga0070667_1000123647 351
102 3300005367 Ga0070667_100024052 Ga0070667_1000240526 351
103 3300005434 Ga0070709_10173754 Ga0070709_101737542 351
104 3300005435 Ga0070714_100009580 Ga0070714_1000095802 351
105 3300005435 Ga0070714_100014952 Ga0070714_1000149526 351
106 3300005436 Ga0070713_100000371 Ga0070713_10000037124 351
107 3300005438 Ga0070701_10000204 Ga0070701_1000020423 351
108 3300005441 Ga0070700_100000856 Ga0070700_10000085616 351
109 3300005444 Ga0070694_100002279 Ga0070694_1000022799 351
110 3300005444 Ga0070694_100070271 Ga0070694_1000702712 351
111 3300005455 Ga0070663_100000945 Ga0070663_10000094516 351
112 3300005456 Ga0070678_100314752 Ga0070678_1003147522 351
113 3300005457 Ga0070662_100003593 Ga0070662_1000035937 351
114 3300005458 Ga0070681_10009252 Ga0070681_100092527 351
115 3300005458 Ga0070681_10041263 Ga0070681_100412631 351
116 3300005458 Ga0070681_10049176 Ga0070681_100491764 351
117 3300005458 Ga0070681_10264052 Ga0070681_102640522 351
118 3300005459 Ga0068867_100151199 Ga0068867_1001511992 351
119 3300005466 Ga0070685_10031229 Ga0070685_100312292 351
120 3300005530 Ga0070679_100002050 Ga0070679_10000205013 351
121 3300005530 Ga0070679_100013603 Ga0070679_1000136032 351
122 3300005530 Ga0070679_100100453 Ga0070679_1001004532 351
123 3300005530 Ga0070679_100228746 Ga0070679_1002287462 351
124 3300005530 Ga0070679_100238982 Ga0070679_1002389822 351
125 3300005535 Ga0070684_100000365 Ga0070684_10000036520 351
126 3300005535 Ga0070684_100035412 Ga0070684_1000354123 351
127 3300005539 Ga0068853_100000523 Ga0068853_10000052324 351
128 3300005543 Ga0070672_100000709 Ga0070672_10000070911 351
129 3300005544 Ga0070686_100000455 Ga0070686_1000004552 351
130 3300005545 Ga0070695_100001044 Ga0070695_1000010444 351
131 3300005546 Ga0070696_100021689 Ga0070696_1000216893 351
132 3300005546 Ga0070696_100237412 Ga0070696_1002374121 351
133 3300005547 Ga0070693_100000905 Ga0070693_1000009052 351
134 3300005547 Ga0070693_100060132 Ga0070693_1000601322 351
135 3300005548 Ga0070665_100000327 Ga0070665_10000032782 351
136 3300005548 Ga0070665_100052141 Ga0070665_1000521412 351
137 3300005548 Ga0070665_100109298 Ga0070665_1001092982 351
138 3300005548 Ga0070665_100140598 Ga0070665_1001405982 351
139 3300005549 Ga0070704_100000197 Ga0070704_10000019727 351
140 3300005563 Ga0068855_100040932 Ga0068855_1000409322 351
141 3300005563 Ga0068855_100079840 Ga0068855_1000798402 351
142 3300005563 Ga0068855_100098430 Ga0068855_1000984302 351
143 3300005563 Ga0068855_100099582 Ga0068855_1000995822 351
144 3300005563 Ga0068855_100643262 Ga0068855_1006432621 351
145 3300005564 Ga0070664_100002074 Ga0070664_10000207419 351
146 3300005577 Ga0068857_100000921 Ga0068857_1000009212 351
147 3300005577 Ga0068857_100024980 Ga0068857_1000249803 351
148 3300005578 Ga0068854_100000749 Ga0068854_10000074916 351
149 3300005578 Ga0068854_100019836 Ga0068854_1000198365 351
150 3300005614 Ga0068856_100000902 Ga0068856_10000090217 351
151 3300005614 Ga0068856_100253827 Ga0068856_1002538272 351
152 3300005615 Ga0070702_100002928 Ga0070702_1000029282 351
153 3300005615 Ga0070702_100164471 Ga0070702_1001644712 351
154 3300005616 Ga0068852_100015241 Ga0068852_1000152416 351
155 3300005616 Ga0068852_100110867 Ga0068852_1001108673 351
156 3300005617 Ga0068859_100004450 Ga0068859_1000044507 351
157 3300005617 Ga0068859_100008773 Ga0068859_1000087736 351
158 3300005617 Ga0068859_100089758 Ga0068859_1000897582 351
159 3300005618 Ga0068864_100049073 Ga0068864_1000490731 351
160 3300005718 Ga0068866_10002012 Ga0068866_100020129 351
161 3300005719 Ga0068861_100000825 Ga0068861_10000082516 351
162 3300005840 Ga0068870_10000112 Ga0068870_1000011213 351
163 3300005841 Ga0068863_100000703 Ga0068863_10000070312 351
164 3300005841 Ga0068863_100023806 Ga0068863_1000238063 351
165 3300005842 Ga0068858_100008283 Ga0068858_1000082835 351
166 3300005842 Ga0068858_100019588 Ga0068858_1000195882 351
167 3300005843 Ga0068860_100000165 Ga0068860_10000016513 351
168 3300005843 Ga0068860_100006736 Ga0068860_1000067362 351
169 3300005843 Ga0068860_100049862 Ga0068860_1000498622 351
170 3300005843 Ga0068860_100051115 Ga0068860_1000511152 351
171 3300005843 Ga0068860_100120534 Ga0068860_1001205342 351
172 3300005844 Ga0068862_100006290 Ga0068862_1000062904 351
173 3300005844 Ga0068862_100100949 Ga0068862_1001009492 351
174 3300005937 Ga0081455_10011886 Ga0081455_100118861 351
175 3300005983 Ga0081540_1010346 Ga0081540_10103465 351
176 3300005983 Ga0081540_1014849 Ga0081540_10148493 351
177 3300005983 Ga0081540_1033560 Ga0081540_10335603 351
178 3300005983 Ga0081540_1083756 Ga0081540_10837562 351
179 3300006042 Ga0075368_10024712 Ga0075368_100247123 351
180 3300006048 Ga0075363_100114362 Ga0075363_1001143622 351
181 3300006051 Ga0075364_10057532 Ga0075364_100575322 351
182 3300006051 Ga0075364_10145686 Ga0075364_101456862 351
183 3300006173 Ga0070716_100117379 Ga0070716_1001173792 351
184 3300006177 Ga0075362_10036225 Ga0075362_100362253 351
185 3300006186 Ga0075369_10015948 Ga0075369_100159482 351
186 3300006195 Ga0075366_10049965 Ga0075366_100499652 351
187 3300006237 Ga0097621_100000473 Ga0097621_10000047327 351
188 3300006237 Ga0097621_100025204 Ga0097621_1000252043 351
189 3300006353 Ga0075370_10068039 Ga0075370_100680392 351
190 3300006358 Ga0068871_100000118 Ga0068871_10000011837 351
191 3300006358 Ga0068871_100016676 Ga0068871_1000166763 351
192 3300006358 Ga0068871_100389850 Ga0068871_1003898502 351
193 3300006844 Ga0075428_100208791 Ga0075428_1002087913 351
194 3300006846 Ga0075430_100033350 Ga0075430_1000333503 351
195 3300006847 Ga0075431_100212332 Ga0075431_1002123322 351
196 3300006847 Ga0075431_100263706 Ga0075431_1002637062 351
197 3300006871 Ga0075434_100013398 Ga0075434_1000133983 351
198 3300006871 Ga0075434_100434097 Ga0075434_1004340971 351
199 3300006931 Ga0097620_100004450 Ga0097620_1000044507 351
200 3300006931 Ga0097620_100008773 Ga0097620_1000087736 351
201 3300006931 Ga0097620_100089759 Ga0097620_1000897592 351
202 3300009093 Ga0105240_10022758 Ga0105240_100227583 351
203 3300009093 Ga0105240_10064698 Ga0105240_100646982 351
204 3300009094 Ga0111539_10001167 Ga0111539_1000116725 351
205 3300009094 Ga0111539_10004804 Ga0111539_100048044 351
206 3300009098 Ga0105245_10001982 Ga0105245_100019822 351
207 3300009098 Ga0105245_10021615 Ga0105245_100216157 351
208 3300009147 Ga0114129_10015418 Ga0114129_1001541810 351
209 3300009147 Ga0114129_10180395 Ga0114129_101803954 351
210 3300009148 Ga0105243_10002278 Ga0105243_1000227816 351
211 3300009148 Ga0105243_10054499 Ga0105243_100544992 351
212 3300009174 Ga0105241_10003555 Ga0105241_100035552 351
213 3300009176 Ga0105242_10001156 Ga0105242_1000115610 351
214 3300009177 Ga0105248_10002414 Ga0105248_1000241411 351
215 3300009177 Ga0105248_10010454 Ga0105248_100104542 351
216 3300009177 Ga0105248_10414399 Ga0105248_104143992 351
217 3300009551 Ga0105238_10028630 Ga0105238_100286303 351
218 3300009553 Ga0105249_10001021 Ga0105249_1000102110 351
219 3300009553 Ga0105249_10006960 Ga0105249_1000696010 351
220 3300010159 Ga0099796_10018054 Ga0099796_100180542 351
221 3300010375 Ga0105239_10008950 Ga0105239_100089507 351
222 3300010375 Ga0105239_10038202 Ga0105239_100382022 351
223 3300011119 Ga0105246_10003701 Ga0105246_100037015 351
224 3300012513 Ga0157326_1000541 Ga0157326_10005415 351
225 3300013100 Ga0157373_10005579 Ga0157373_100055795 351
226 3300013100 Ga0157373_10006895 Ga0157373_100068953 351
227 3300013100 Ga0157373_10162181 Ga0157373_101621812 351
228 3300013102 Ga0157371_10016850 Ga0157371_100168504 351
229 3300013102 Ga0157371_10131676 Ga0157371_101316762 351
230 3300013105 Ga0157369_10521336 Ga0157369_105213361 351
231 3300013296 Ga0157374_10015941 Ga0157374_100159412 351
232 3300013297 Ga0157378_10002986 Ga0157378_1000298612 351
233 3300013297 Ga0157378_10375921 Ga0157378_103759212 351
234 3300013306 Ga0163162_10009522 Ga0163162_100095227 351
235 3300013307 Ga0157372_10008348 Ga0157372_1000834812 351
236 3300013308 Ga0157375_10000508 Ga0157375_1000050812 351
237 3300013308 Ga0157375_10053915 Ga0157375_100539152 351
238 3300014325 Ga0163163_10082125 Ga0163163_100821252 351
239 3300014326 Ga0157380_10000212 Ga0157380_1000021225 351
240 3300014745 Ga0157377_10000287 Ga0157377_1000028716 351
241 3300014968 Ga0157379_10008690 Ga0157379_100086902 351
242 3300014968 Ga0157379_10046080 Ga0157379_100460802 351
243 3300014969 Ga0157376_10004642 Ga0157376_100046425 351
244 3300014969 Ga0157376_10016040 Ga0157376_100160402 351
245 3300017792 Ga0163161_10000415 Ga0163161_1000041532 351
246 3300025242 Ga0209258_100123 Ga0209258_10012375 351
247 3300025250 Ga0209026_1005744 Ga0209026_10057444 351
248 3300025256 Ga0209759_1001598 Ga0209759_10015983 351
249 3300025261 Ga0209233_1009332 Ga0209233_10093323 351
250 3300025271 Ga0207666_1000073 Ga0207666_10000733 351
251 3300025272 Ga0209455_1000115 Ga0209455_100011575 351
252 3300025290 Ga0207673_1000295 Ga0207673_10002955 351
253 3300025297 Ga0209758_1003089 Ga0209758_100308911 351
254 3300025298 Ga0209050_1000431 Ga0209050_100043147 351
255 3300025304 Ga0209257_1000572 Ga0209257_100057224 351
256 3300025304 Ga0209257_1001182 Ga0209257_100118226 351
257 3300025315 Ga0207697_10000061 Ga0207697_1000006138 351
258 3300025315 Ga0207697_10005956 Ga0207697_100059563 351
259 3300025885 Ga0207653_10005338 Ga0207653_100053383 351
260 3300025893 Ga0207682_10002961 Ga0207682_100029613 351
261 3300025898 Ga0207692_10150929 Ga0207692_101509291 351
262 3300025899 Ga0207642_10001238 Ga0207642_100012388 351
263 3300025901 Ga0207688_10000001 Ga0207688_1000000195 351
264 3300025901 Ga0207688_10015574 Ga0207688_100155742 351
265 3300025905 Ga0207685_10037419 Ga0207685_100374192 351
266 3300025907 Ga0207645_10000222 Ga0207645_1000022228 351
267 3300025908 Ga0207643_10000009 Ga0207643_1000000942 351
268 3300025909 Ga0207705_10019295 Ga0207705_100192951 351
269 3300025909 Ga0207705_10054591 Ga0207705_100545912 351
270 3300025909 Ga0207705_10086233 Ga0207705_100862331 351
271 3300025911 Ga0207654_10001390 Ga0207654_1000139013 351
272 3300025912 Ga0207707_10004174 Ga0207707_1000417412 351
273 3300025912 Ga0207707_10007205 Ga0207707_100072052 351
274 3300025912 Ga0207707_10139243 Ga0207707_101392432 351
275 3300025912 Ga0207707_10317028 Ga0207707_103170281 351
276 3300025913 Ga0207695_10002836 Ga0207695_1000283617 351
277 3300025913 Ga0207695_10003652 Ga0207695_100036522 351
278 3300025913 Ga0207695_10037195 Ga0207695_100371954 351
279 3300025913 Ga0207695_10041473 Ga0207695_100414736 351
280 3300025914 Ga0207671_10033935 Ga0207671_100339352 351
281 3300025917 Ga0207660_10000197 Ga0207660_1000019710 351
282 3300025917 Ga0207660_10056050 Ga0207660_100560502 351
283 3300025919 Ga0207657_10000776 Ga0207657_1000077626 351
284 3300025919 Ga0207657_10060873 Ga0207657_100608732 351
285 3300025920 Ga0207649_10000052 Ga0207649_1000005288 351
286 3300025920 Ga0207649_10271357 Ga0207649_102713571 351
287 3300025921 Ga0207652_10001438 Ga0207652_1000143825 351
288 3300025921 Ga0207652_10028531 Ga0207652_100285312 351
289 3300025921 Ga0207652_10041704 Ga0207652_100417042 351
290 3300025921 Ga0207652_10065597 Ga0207652_100655972 351
291 3300025921 Ga0207652_10096741 Ga0207652_100967412 351
292 3300025921 Ga0207652_10169340 Ga0207652_101693402 351
293 3300025923 Ga0207681_10000035 Ga0207681_10000035165 351
294 3300025923 Ga0207681_10307423 Ga0207681_103074232 351
295 3300025924 Ga0207694_10057865 Ga0207694_100578652 351
296 3300025925 Ga0207650_10006131 Ga0207650_100061312 351
297 3300025925 Ga0207650_10035460 Ga0207650_100354601 351
298 3300025926 Ga0207659_10000132 Ga0207659_1000013226 351
299 3300025926 Ga0207659_10093633 Ga0207659_100936332 351
300 3300025927 Ga0207687_10000174 Ga0207687_1000017425 351
301 3300025927 Ga0207687_10017776 Ga0207687_100177761 351
302 3300025928 Ga0207700_10000274 Ga0207700_1000027423 351
303 3300025928 Ga0207700_10118585 Ga0207700_101185852 351
304 3300025929 Ga0207664_10007717 Ga0207664_100077174 351
305 3300025931 Ga0207644_10000212 Ga0207644_1000021210 351
306 3300025931 Ga0207644_10016349 Ga0207644_100163492 351
307 3300025931 Ga0207644_10098037 Ga0207644_100980372 351
308 3300025932 Ga0207690_10000148 Ga0207690_1000014852 351
309 3300025932 Ga0207690_10000294 Ga0207690_100002942 351
310 3300025933 Ga0207706_10001360 Ga0207706_1000136012 351
311 3300025933 Ga0207706_10025201 Ga0207706_100252012 351
312 3300025933 Ga0207706_10144799 Ga0207706_101447992 351
313 3300025935 Ga0207709_10000530 Ga0207709_100005305 351
314 3300025936 Ga0207670_10000523 Ga0207670_1000052326 351
315 3300025936 Ga0207670_10317815 Ga0207670_103178151 351
316 3300025937 Ga0207669_10000857 Ga0207669_100008579 351
317 3300025938 Ga0207704_10000198 Ga0207704_1000019841 351
318 3300025940 Ga0207691_10000517 Ga0207691_1000051716 351
319 3300025940 Ga0207691_10076224 Ga0207691_100762242 351
320 3300025940 Ga0207691_10252651 Ga0207691_102526512 351
321 3300025941 Ga0207711_10008997 Ga0207711_100089973 351
322 3300025941 Ga0207711_10041446 Ga0207711_100414462 351
323 3300025941 Ga0207711_10311697 Ga0207711_103116971 351
324 3300025942 Ga0207689_10000031 Ga0207689_1000003174 351
325 3300025944 Ga0207661_10001089 Ga0207661_1000108919 351
326 3300025944 Ga0207661_10094772 Ga0207661_100947722 351
327 3300025945 Ga0207679_10000183 Ga0207679_1000018323 351
328 3300025949 Ga0207667_10057690 Ga0207667_100576904 351
329 3300025949 Ga0207667_10458292 Ga0207667_104582921 351
330 3300025960 Ga0207651_10000051 Ga0207651_1000005143 351
331 3300025960 Ga0207651_10155404 Ga0207651_101554042 351
332 3300025961 Ga0207712_10000738 Ga0207712_1000073810 351
333 3300025961 Ga0207712_10056531 Ga0207712_100565313 351
334 3300025972 Ga0207668_10000664 Ga0207668_1000066425 351
335 3300025972 Ga0207668_10009551 Ga0207668_100095514 351
336 3300025972 Ga0207668_10078238 Ga0207668_100782382 351
337 3300025981 Ga0207640_10002152 Ga0207640_100021526 351
338 3300025986 Ga0207658_10016338 Ga0207658_100163382 351
339 3300026023 Ga0207677_10075252 Ga0207677_100752523 351
340 3300026035 Ga0207703_10279307 Ga0207703_102793072 351
341 3300026035 Ga0207703_10321818 Ga0207703_103218182 351
342 3300026041 Ga0207639_10001257 Ga0207639_100012575 351
343 3300026067 Ga0207678_10000531 Ga0207678_1000053112 351
344 3300026075 Ga0207708_10000573 Ga0207708_100005737 351
345 3300026075 Ga0207708_10006283 Ga0207708_100062835 351
346 3300026078 Ga0207702_10003284 Ga0207702_1000328416 351
347 3300026088 Ga0207641_10001041 Ga0207641_100010415 351
348 3300026089 Ga0207648_10000581 Ga0207648_1000058126 351
349 3300026095 Ga0207676_10000124 Ga0207676_1000012440 351
350 3300026095 Ga0207676_10033074 Ga0207676_100330743 351
351 3300026116 Ga0207674_10000095 Ga0207674_1000009512 351
352 3300026116 Ga0207674_10032833 Ga0207674_100328333 351
353 3300026118 Ga0207675_100000414 Ga0207675_10000041426 351
354 3300026118 Ga0207675_100149414 Ga0207675_1001494142 351
355 3300026121 Ga0207683_10000242 Ga0207683_1000024237 351
356 3300026142 Ga0207698_10000951 Ga0207698_100009513 351
357 3300026142 Ga0207698_10473032 Ga0207698_104730322 351
358 3300027378 Ga0209981_1001280 Ga0209981_10012803 351
359 3300027462 Ga0210000_1001323 Ga0210000_10013232 351
360 3300027543 Ga0209999_1004075 Ga0209999_10040752 351
361 3300027543 Ga0209999_1008573 Ga0209999_10085732 351
362 3300027552 Ga0209982_1006315 Ga0209982_10063152 351
363 3300027617 Ga0210002_1001450 Ga0210002_10014502 351
364 3300027665 Ga0209983_1001668 Ga0209983_10016684 351
365 3300027682 Ga0209971_1004583 Ga0209971_10045832 351
366 3300027695 Ga0209966_1001052 Ga0209966_10010522 351
367 3300027876 Ga0209974_10001326 Ga0209974_100013266 351
368 3300027876 Ga0209974_10006235 Ga0209974_100062355 351
369 3300027907 Ga0207428_10000037 Ga0207428_10000037189 351
370 3300027907 Ga0207428_10001773 Ga0207428_1000177314 351
371 3300028379 Ga0268266_10000064 Ga0268266_1000006426 351
372 3300028379 Ga0268266_10050497 Ga0268266_100504973 351
373 3300028379 Ga0268266_10071783 Ga0268266_100717832 351
374 3300028379 Ga0268266_10076065 Ga0268266_100760652 351
375 3300028380 Ga0268265_10000757 Ga0268265_100007576 351
376 3300028380 Ga0268265_10010381 Ga0268265_100103817 351
377 3300028380 Ga0268265_10012546 Ga0268265_100125462 351
378 3300028380 Ga0268265_10101042 Ga0268265_101010422 351
379 3300028381 Ga0268264_10000021 Ga0268264_10000021117 351
380 3300028381 Ga0268264_10002331 Ga0268264_100023313 351
381 3300028381 Ga0268264_10012005 Ga0268264_100120056 351
382 3300028666 Ga0265336_10000048 Ga0265336_1000004845 351
383 3300028786 Ga0307517_10004666 Ga0307517_100046665 351
384 3300028794 Ga0307515_10000020 Ga0307515_10000020272 351
385 3300029957 Ga0265324_10003288 Ga0265324_100032884 351
386 3300030521 Ga0307511_10061552 Ga0307511_100615523 351
387 3300031235 Ga0265330_10068397 Ga0265330_100683971 351
388 3300031241 Ga0265325_10024100 Ga0265325_100241002 351
389 3300031249 Ga0265339_10002224 Ga0265339_100022246 351
390 3300031251 Ga0265327_10077631 Ga0265327_100776312 351
391 3300031456 Ga0307513_10001560 Ga0307513_1000156023 351
392 3300031456 Ga0307513_10025455 Ga0307513_100254552 351
393 3300031548 Ga0307408_100098197 Ga0307408_1000981972 351
394 3300031595 Ga0265313_10000098 Ga0265313_1000009894 351
395 3300031712 Ga0265342_10099615 Ga0265342_100996152 351
396 3300031712 Ga0265342_10134189 Ga0265342_101341892 351
397 3300031730 Ga0307516_10003023 Ga0307516_100030236 351
398 3300033179 Ga0307507_10128569 Ga0307507_101285692 351
399 3300033180 Ga0307510_10026020 Ga0307510_100260203 351
400 3300034816 Ga0373930_0000371 Ga0373930_0000371_3887_4942 351
401 3300034817 Ga0373948_0000135 Ga0373948_0000135_4553_5608 351
402 3300034818 Ga0373950_0000327 Ga0373950_0000327_3600_4655 351
403 3300034819 Ga0373958_0000084 Ga0373958_0000084_1759_2814 351
404 3300034957 Ga0373938_0000013 Ga0373938_0000013_18694_19749 351
405 3300035084 Ga0373928_0001053 Ga0373928_0001053_1166_2221 351
406 3300035085 Ga0373929_0002957 Ga0373929_0002957_271_1326 351
407 3300035088 Ga0373940_0002191 Ga0373940_0002191_2175_3230 351
408 3300035090 Ga0373949_0001274 Ga0373949_0001274_6018_7073 351
409 3300035091 Ga0373951_0006039 Ga0373951_0006039_1337_2392 351
410 3300035092 Ga0373952_0000880 Ga0373952_0000880_96_1151 351
411 3300035112 Ga0373932_0000427 Ga0373932_0000427_737_1792 351
412 3300035112 Ga0373932_0001840 Ga0373932_0001840_4160_5215 351
413 3300035113 Ga0373936_0005812 Ga0373936_0005812_772_1827 351
414 3300035114 Ga0373939_0000704 Ga0373939_0000704_6256_7311 351
415 3300035121 Ga0373960_0000570 Ga0373960_0000570_6032_7087 351
416 3300035207 Ga0373942_0000725 Ga0373942_0000725_271_1326 351
417 3300035242 Ga0373962_0000542 Ga0373962_0000542_2056_3111 351
418 3300035242 Ga0373962_0000610 Ga0373962_0000610_5928_6983 351
419 3300035691 Ga0373931_0002178 Ga0373931_0002178_5102_6157 351
420 3300035691 Ga0373931_0046588 Ga0373931_0046588_737_1792 351
421 3300035695 Ga0373927_0073950 Ga0373927_0073950_600_1655 351
422 3300035695 Ga0373927_0106094 Ga0373927_0106094_390_1445 351
423 3300035695 Ga0373927_0163754 Ga0373927_0163754_45_1100 351
424 3300037068 Ga0373925_0263357 Ga0373925_0263357_210_1265 351
425 3300037312 Ga0395899_0005491 Ga0395899_0005491_1914_2969 351
426 3300037312 Ga0395899_0037648 Ga0395899_0037648_1274_2329 351
427 3300037418 Ga0395900_0004219 Ga0395900_0004219_12196_13251 351
428 3300037418 Ga0395900_0017348 Ga0395900_0017348_1902_2957 351
429 3300037418 Ga0395900_0160111 Ga0395900_0160111_75_1130 351
430 3300037418 Ga0395900_0202164 Ga0395900_0202164_806_1861 351
431 3300037418 Ga0395900_0316748 Ga0395900_0316748_32_1087 351
432 3300037466 Ga0395898_0014233 Ga0395898_0014233_2707_3762 351
433 3300037466 Ga0395898_0015013 Ga0395898_0015013_2137_3192 351
434 3300037466 Ga0395898_0022197 Ga0395898_0022197_556_1611 351
435 3300037466 Ga0395898_0352416 Ga0395898_0352416_200_1255 351
436 3300037471 Ga0395905_0000983 Ga0395905_0000983_20612_21667 351
437 3300038443 Ga0395901_0022367 Ga0395901_0022367_3556_4611 351
438 3300038443 Ga0395901_0088277 Ga0395901_0088277_832_1887 351
439 3300038443 Ga0395901_0130825 Ga0395901_0130825_683_1738 351
440 3300038443 Ga0395901_0242258 Ga0395901_0242258_202_1257 351
441 3300039437 Ga0436365_0677869 Ga0436365_0677869_100_1155 351
442 3300039437 Ga0436365_1378731 Ga0436365_1378731_101_1156 351
443 3300039438 Ga0436360_0898381 Ga0436360_0898381_341_1396 351
444 3300039438 Ga0436360_1266199 Ga0436360_1266199_48_1103 351
445 3300039447 Ga0436361_0180569 Ga0436361_0180569_1089_2144 351
446 3300042876 Ga0451577_0004901 Ga0451577_0004901_9476_10531 351
447 3300042876 Ga0451577_0057580 Ga0451577_0057580_526_1581 351
448 3300042876 Ga0451577_0068162 Ga0451577_0068162_737_1792 351
449 3300042876 Ga0451577_0146502 Ga0451577_0146502_527_1582 351
450 3300044673 Ga0453683_0013725 Ga0453683_0013725_1509_2564 351
451 3300044673 Ga0453683_0048258 Ga0453683_0048258_620_1675 351
452 3300044684 Ga0466966_0051914 Ga0466966_0051914_824_1879 351
453 3300044694 Ga0466963_0043929 Ga0466963_0043929_1289_2344 351
454 3300044712 Ga0453684_0014814 Ga0453684_0014814_3575_4630 351
455 3300044842 Ga0466957_0188578 Ga0466957_0188578_147_1202 351
456 3300045051 Ga0451576_0006125 Ga0451576_0006125_2243_3298 351
457 3300045051 Ga0451576_0024532 Ga0451576_0024532_1230_2285 351
458 3300045051 Ga0451576_0177053 Ga0451576_0177053_589_1644 351
459 3300045976 Ga0466967_0003577 Ga0466967_0003577_9068_10123 351
460 3300046455 Ga0495603_0097030 Ga0495603_0097030_85_1140 351
461 3300046460 Ga0495638_0159912 Ga0495638_0159912_148_1203 351
462 3300046460 Ga0495638_0164278 Ga0495638_0164278_50_1105 351
463 3300046475 Ga0495639_0003100 Ga0495639_0003100_5463_6518 351
464 3300046506 Ga0495583_0000062 Ga0495583_0000062_38715_39770 351
465 3300046507 Ga0495606_0001633 Ga0495606_0001633_11804_12859 351
466 3300046520 Ga0495637_0021073 Ga0495637_0021073_1246_2301 351
467 3300046520 Ga0495637_0060757 Ga0495637_0060757_138_1193 351
468 3300046533 Ga0495640_0007537 Ga0495640_0007537_993_2048 351
469 3300046539 Ga0495621_0030896 Ga0495621_0030896_35_1090 351
470 3300046542 Ga0495597_0037382 Ga0495597_0037382_1004_2059 351
471 3300046616 Ga0495668_0065197 Ga0495668_0065197_415_1470 351
472 3300046642 Ga0495634_0054248 Ga0495634_0054248_1532_2587 351
473 3300046660 Ga0495625_0007787 Ga0495625_0007787_2407_3462 351
474 3300046660 Ga0495625_0035033 Ga0495625_0035033_24_1079 351
475 3300046664 Ga0495659_0005240 Ga0495659_0005240_1484_2539 351
476 3300046684 Ga0495669_0000009 Ga0495669_0000009_66440_67495 351
477 3300046694 Ga0495649_0000247 Ga0495649_0000247_38571_39626 351
478 3300046794 Ga0495589_0003753 Ga0495589_0003753_2200_3255 351
479 3300047319 Ga0495674_0073619 Ga0495674_0073619_1854_2909 351
480 3300047445 Ga0495677_0069031 Ga0495677_0069031_204_1259 351
481 3300047472 Ga0495686_0000049 Ga0495686_0000049_177711_178766 351
482 3300047472 Ga0495686_0014246 Ga0495686_0014246_2955_4010 351
483 3300048904 Ga0496101_0000866 Ga0496101_0000866_13464_14519 351
484 3300048905 Ga0496102_0001833 Ga0496102_0001833_14711_15766 351
485 3300048905 Ga0496102_0246568 Ga0496102_0246568_111_1166 351
486 3300048906 Ga0496103_0001022 Ga0496103_0001022_15272_16327 351
487 3300048910 Ga0496107_0000118 Ga0496107_0000118_688_1743 351
488 3300048911 Ga0496108_0006961 Ga0496108_0006961_6491_7546 351
489 3300048911 Ga0496108_0077610 Ga0496108_0077610_1204_2259 351
490 3300048912 Ga0496109_0002269 Ga0496109_0002269_1919_2974 351
491 3300048912 Ga0496109_0042716 Ga0496109_0042716_1000_2055 351
492 3300048913 Ga0496110_0156665 Ga0496110_0156665_205_1260 351
493 3300048915 Ga0496112_0064319 Ga0496112_0064319_867_1922 351
494 3300048915 Ga0496112_0102359 Ga0496112_0102359_415_1470 351
495 3300048916 Ga0496113_0067850 Ga0496113_0067850_486_1541 351
496 3300048917 Ga0496114_0372423 Ga0496114_0372423_196_1251 351
497 3300048918 Ga0496115_0000967 Ga0496115_0000967_14482_15537 351
498 3300048918 Ga0496115_0106814 Ga0496115_0106814_154_1209 351
499 3300049568 Ga0501031_0222190 Ga0501031_0222190_56_1111 351
500 3300049569 Ga0501032_0054310 Ga0501032_0054310_1476_2531 351
501 3300049570 Ga0501033_0033776 Ga0501033_0033776_341_1396 351
502 3300049571 Ga0501034_0086892 Ga0501034_0086892_865_1920 351
503 3300049574 Ga0501038_0149809 Ga0501038_0149809_134_1189 351
504 3300049574 Ga0501038_0187603 Ga0501038_0187603_74_1129 351
505 3300049575 Ga0501039_0149854 Ga0501039_0149854_14_1069 351
506 3300049579 Ga0501043_0015687 Ga0501043_0015687_953_2008 351
507 3300049581 Ga0501047_0000729 Ga0501047_0000729_29371_30426 351
508 3300049581 Ga0501047_0012289 Ga0501047_0012289_1630_2685 351
509 3300049581 Ga0501047_0027647 Ga0501047_0027647_2195_3250 351
510 3300049581 Ga0501047_0106554 Ga0501047_0106554_576_1631 351
511 3300049581 Ga0501047_0109557 Ga0501047_0109557_880_1935 351
512 3300049581 Ga0501047_0350892 Ga0501047_0350892_123_1178 351
513 3300049583 Ga0501067_0065525 Ga0501067_0065525_186_1241 351
514 3300049583 Ga0501067_0088263 Ga0501067_0088263_123_1178 351
515 3300049584 Ga0501068_0021679 Ga0501068_0021679_596_1651 351
516 3300049586 Ga0501070_0039278 Ga0501070_0039278_1439_2494 351
517 3300049586 Ga0501070_0110901 Ga0501070_0110901_134_1189 351
518 3300049588 Ga0501072_0097662 Ga0501072_0097662_994_2049 351
519 3300049589 Ga0501073_0027102 Ga0501073_0027102_1852_2907 351
520 3300049589 Ga0501073_0091631 Ga0501073_0091631_573_1628 351
521 3300049589 Ga0501073_0155006 Ga0501073_0155006_189_1244 351
522 3300049590 Ga0501074_0190975 Ga0501074_0190975_383_1438 351
523 3300049591 Ga0501075_0114076 Ga0501075_0114076_11_1066 351
524 3300049742 Ga0501080_0129759 Ga0501080_0129759_344_1399 351
525 3300049742 Ga0501080_0156434 Ga0501080_0156434_141_1196 351
526 3300049744 Ga0501083_0014143 Ga0501083_0014143_166_1221 351
527 3300049744 Ga0501083_0088579 Ga0501083_0088579_191_1246 351
528 3300049822 Ga0501035_0001116 Ga0501035_0001116_18532_19587 351
529 3300049822 Ga0501035_0027156 Ga0501035_0027156_2680_3735 351
530 3300049822 Ga0501035_0087906 Ga0501035_0087906_616_1671 351
531 3300049823 Ga0501044_0000222 Ga0501044_0000222_42768_43823 351
532 3300049823 Ga0501044_0006838 Ga0501044_0006838_8817_9872 351
533 3300049823 Ga0501044_0066214 Ga0501044_0066214_878_1933 351
534 3300050493 nmdc:mga0k408_34689_c2 nmdc:mga0k408_34689_c2_288_1343 351
535 3300050496 nmdc:mga07m45_59399_c1 nmdc:mga07m45_59399_c1_618_1673 351
536 3300050509 nmdc:mga0qj67_151017_c1 nmdc:mga0qj67_151017_c1_728_1783 351
537 3300050510 nmdc:mga06r32_115174_c1 nmdc:mga06r32_115174_c1_581_1636 351
538 3300050511 nmdc:mga08y16_13712_c1 nmdc:mga08y16_13712_c1_3388_4443 351
539 3300050511 nmdc:mga08y16_333_c1 nmdc:mga08y16_333_c1_18011_19066 351
540 3300050512 nmdc:mga0n895_62_c1 nmdc:mga0n895_62_c1_77_1132 351
541 3300050512 nmdc:mga0n895_97850_c1 nmdc:mga0n895_97850_c1_782_1837 351
542 3300053077 Ga0495601_0011855 Ga0495601_0011855_1095_2150 351
543 3300053084 Ga0495595_0009473 Ga0495595_0009473_684_1739 351
544 3300053085 Ga0495619_0025558 Ga0495619_0025558_1247_2302 351
545 3300053087 Ga0500643_004921 Ga0500643_004921_4437_5492 351
546 3300053088 Ga0500644_0000282 Ga0500644_0000282_14450_15505 351
547 3300053093 Ga0500651_0001656 Ga0500651_0001656_7336_8391 351
548 3300053096 Ga0500641_0001396 Ga0500641_0001396_910_1965 351
549 3300053096 Ga0500641_0008896 Ga0500641_0008896_656_1711 351
550 3300053096 Ga0500641_0041561 Ga0500641_0041561_459_1514 351
551 3300053108 Ga0500562_011969 Ga0500562_011969_793_1848 351
552 3300053117 Ga0500593_032897 Ga0500593_032897_909_1964 351
553 3300053118 Ga0500594_0013276 Ga0500594_0013276_463_1518 351
554 3300053119 Ga0500595_000016 Ga0500595_000016_131296_132351 351
555 3300053130 Ga0500642_0010511 Ga0500642_0010511_1637_2692 351
556 3300053131 Ga0500652_000024 Ga0500652_000024_90157_91212 351
557 3300053131 Ga0500652_061781 Ga0500652_061781_144_1199 351
558 3300053133 Ga0500655_000102 Ga0500655_000102_3880_4935 351
559 3300053148 Ga0500590_000159 Ga0500590_000159_5675_6730 351
560 3300053151 Ga0500604_0012877 Ga0500604_0012877_54_1109 351
561 3300053153 Ga0500616_0000006 Ga0500616_0000006_588281_589336 351
562 3300053153 Ga0500616_0012855 Ga0500616_0012855_2329_3384 351
563 3300053153 Ga0500616_0028109 Ga0500616_0028109_1745_2800 351
564 3300053153 Ga0500616_0092438 Ga0500616_0092438_301_1356 351
565 3300053156 Ga0500622_0006073 Ga0500622_0006073_2995_4050 351
566 3300053158 Ga0500627_0016976 Ga0500627_0016976_546_1601 351
567 3300053724 Ga0500570_000434 Ga0500570_000434_5072_6127 351
568 3300053730 Ga0500645_000033 Ga0500645_000033_106024_107079 351
569 3300053730 Ga0500645_000666 Ga0500645_000666_18391_19446 351
570 iso_pu_bacteria 2513237098 2513676117 351
571 iso_pu_bacteria 2885383462 2885392142 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

96

245

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b48-assembly1.cif.gz_D 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.8404 41 214
5b47-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex 0.8043 34 221
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.7396 14 336
5b48-assembly1.cif.gz_B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.7176 31 335
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.7132 14 336
ID Description Score Start End Superfamily
af_Q58077_321_493_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6823 35 225 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6698 90 237 3.40.50.970
3lq1A03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6673 39 214 3.40.50.970
af_P08142_365_562_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6632 39 216 3.40.50.970
af_Q58077_321_493_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.6618 35 225 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A537U0L2-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.8303 1 351 GO:0016625
GO:0030976
GO:0044281
AF-A0A537U0L2-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.8278 1 351 GO:0016625
GO:0030976
GO:0044281
AF-A0A7Y5M726-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.8036 1 108
AF-A0A3A5UYY8-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.8031 14 224 GO:0006082
GO:0016625
GO:0030976
GO:0044272
AF-A0A7C3GBX4-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.7999 1 214 GO:0016625
GO:0030976
GO:0044281

Feature Viewer

pLDDT pTM Quality
72.9 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map