F465012
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 571 | 368 | 544 | 351 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237098|2513676117 |
| Length | 382 |
| Sequence | DPGIHAFLSPDQYVDGRVKPGHDAAGTAGVVMTYIAKPKFHHPGLKKNELGYTHRDYEGKISTLCAGCGHDSITASIIEACYELSIEPHRVAKISGIGCSSKTPDYFLGNSHGFNSVHGRMPSVLTGANLANRDLIYLGVSGDGDSASIGFGQFAHSIRRGVNMTYIVENNGVYGLTKGQFSATADRGSKSKKGVVNTDNAIDLVAIALQLGATFVARSFSGDKTQLVPLIAAAIQHKGASFIDVISPCIAFNNHAGSTKSFDYVREHNDAVNRLDVLVGREPIHVDYAPGTVQVVEQHDGSRIALRKLDADYDPHDRVGAMTFLQKHAAKGQIVTGLLYVDPEAEDLHAHLNTVDTPLNTLDAKALCPGSAALDKINASLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 4 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 5 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 6 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 7 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 8 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 9 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 10 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 11 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 12 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 13 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 14 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 15 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 16 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 17 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 18 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 19 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 20 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 21 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 22 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 23 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 24 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 25 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 26 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 27 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 28 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 29 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 30 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 33 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 34 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 35 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 36 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 37 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 38 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 39 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 40 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 46 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 97 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 99 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 106 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 107 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 110 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 111 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 112 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 113 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 114 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 233 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 238 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 239 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 240 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 241 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 243 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 245 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 257 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 259 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 266 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 273 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 274 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 275 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 348 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 351 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 353 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 354 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 355 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 356 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 357 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 358 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 362 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 366 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 367 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 368 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.44 |
| Metatranscriptomes | 0 |
| Isolates | 4.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.76 |
| Nodule | 1.93 |
| Rhizoplane | 2.98 |
| Rhizosphere | 81.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3047889 | 2162886007 | Bacteria | 1684 |
| 2 | ARSoilYngRDRAFT_c00458 | 3300000042 | Bacteria | 4991 |
| 3 | ARcpr5yngRDRAFT_c002082 | 3300000043 | Bacteria | 2112 |
| 4 | ARSoilOldRDRAFT_c000053 | 3300000044 | Bacteria | 23841 |
| 5 | ARCol0oldRDRAFT_c01210 | 3300000045 | Bacteria | 1847 |
| 6 | ARCol0yngRDRAFT_1000025 | 3300000652 | Bacteria | 26845 |
| 7 | JGI24747J21853_1000252 | 3300001978 | Bacteria | 2932 |
| 8 | JGI24739J22299_10004000 | 3300001989 | Bacteria | 5641 |
| 9 | JGI24739J22299_10008709 | 3300001989 | Bacteria | 3784 |
| 10 | JGI24737J22298_10000053 | 3300001990 | Bacteria | 34054 |
| 11 | JGI24737J22298_10004052 | 3300001990 | Bacteria | 5124 |
| 12 | JGI24750J21931_1000906 | 3300002070 | Bacteria | 4027 |
| 13 | JGI24745J21846_1000906 | 3300002073 | Bacteria | 2758 |
| 14 | JGI24738J21930_10002204 | 3300002075 | Bacteria | 5182 |
| 15 | JGI24035J26624_1000962 | 3300002126 | Bacteria | 2711 |
| 16 | JGI24034J26672_10000960 | 3300002239 | Bacteria | 3760 |
| 17 | JGI24742J22300_10000216 | 3300002244 | Bacteria | 8591 |
| 18 | JGI24751J29686_10004605 | 3300002459 | Bacteria | 2802 |
| 19 | JGI25157J39369_1011623 | 3300002741 | Bacteria | 1135 |
| 20 | Ga0055535_1000063 | 3300003761 | Bacteria | 117039 |
| 21 | Ga0055535_1000072 | 3300003761 | Bacteria | 113031 |
| 22 | Ga0055535_1000219 | 3300003761 | Bacteria | 60251 |
| 23 | Ga0055529_1000287 | 3300003763 | Bacteria | 59706 |
| 24 | Ga0055530_10001762 | 3300003791 | Bacteria | 15127 |
| 25 | Ga0055531_10006219 | 3300003794 | Bacteria | 6818 |
| 26 | Ga0065165_1000472 | 3300005262 | Bacteria | 62746 |
| 27 | Ga0065165_1018743 | 3300005262 | Bacteria | 2494 |
| 28 | Ga0065717_1002456 | 3300005276 | Bacteria | 1949 |
| 29 | Ga0065716_1002341 | 3300005277 | Bacteria | 1908 |
| 30 | Ga0065704_10100585 | 3300005289 | Bacteria | 2248 |
| 31 | Ga0065712_10071633 | 3300005290 | Bacteria | 5146 |
| 32 | Ga0070658_10011015 | 3300005327 | Bacteria | 7249 |
| 33 | Ga0070658_10019708 | 3300005327 | Bacteria | 5401 |
| 34 | Ga0070658_10248509 | 3300005327 | Bacteria | 1509 |
| 35 | Ga0070676_10004729 | 3300005328 | Bacteria | 7199 |
| 36 | Ga0070683_100001083 | 3300005329 | Bacteria | 20468 |
| 37 | Ga0070683_100145741 | 3300005329 | Bacteria | 2243 |
| 38 | Ga0070690_100002762 | 3300005330 | Bacteria | 9483 |
| 39 | Ga0070670_100005035 | 3300005331 | Bacteria | 11118 |
| 40 | Ga0070677_10003137 | 3300005333 | Bacteria | 5311 |
| 41 | Ga0068869_100000279 | 3300005334 | Bacteria | 27008 |
| 42 | Ga0070680_100056337 | 3300005336 | Bacteria | 3213 |
| 43 | Ga0070680_100124707 | 3300005336 | Bacteria | 2151 |
| 44 | Ga0070680_100237101 | 3300005336 | Bacteria | 1541 |
| 45 | Ga0070682_100000287 | 3300005337 | Bacteria | 35953 |
| 46 | Ga0068868_100004075 | 3300005338 | Bacteria | 10198 |
| 47 | Ga0070660_100000245 | 3300005339 | Bacteria | 35915 |
| 48 | Ga0070660_100038256 | 3300005339 | Bacteria | 3642 |
| 49 | Ga0070689_100000422 | 3300005340 | Bacteria | 24979 |
| 50 | Ga0070691_10006681 | 3300005341 | Bacteria | 5279 |
| 51 | Ga0070687_100000348 | 3300005343 | Bacteria | 15751 |
| 52 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 53 | Ga0070692_10000101 | 3300005345 | Bacteria | 19118 |
| 54 | Ga0070668_100003604 | 3300005347 | Bacteria | 11429 |
| 55 | Ga0070668_100006939 | 3300005347 | Bacteria | 8392 |
| 56 | Ga0070668_100044014 | 3300005347 | Bacteria | 3423 |
| 57 | Ga0070668_100079031 | 3300005347 | Bacteria | 2574 |
| 58 | Ga0070668_100097123 | 3300005347 | Bacteria | 2330 |
| 59 | Ga0070669_100000314 | 3300005353 | Bacteria | 37924 |
| 60 | Ga0070669_100134363 | 3300005353 | Bacteria | 1901 |
| 61 | Ga0070675_100000161 | 3300005354 | Bacteria | 40950 |
| 62 | Ga0070675_100219713 | 3300005354 | Bacteria | 1654 |
| 63 | Ga0070675_100307217 | 3300005354 | Bacteria | 1398 |
| 64 | Ga0070671_100000313 | 3300005355 | Bacteria | 32932 |
| 65 | Ga0070671_100009979 | 3300005355 | Bacteria | 7625 |
| 66 | Ga0070671_100128052 | 3300005355 | Bacteria | 2137 |
| 67 | Ga0070674_100001686 | 3300005356 | Bacteria | 11955 |
| 68 | Ga0070673_100000272 | 3300005364 | Bacteria | 26555 |
| 69 | Ga0070673_100081674 | 3300005364 | Bacteria | 2621 |
| 70 | Ga0070688_100000306 | 3300005365 | Bacteria | 24982 |
| 71 | Ga0070688_100000991 | 3300005365 | Bacteria | 14237 |
| 72 | Ga0070659_100000467 | 3300005366 | Bacteria | 29858 |
| 73 | Ga0070659_100007586 | 3300005366 | Bacteria | 7886 |
| 74 | Ga0070667_100012364 | 3300005367 | Bacteria | 7061 |
| 75 | Ga0070667_100024052 | 3300005367 | Bacteria | 5059 |
| 76 | Ga0070709_10173754 | 3300005434 | Bacteria | 1508 |
| 77 | Ga0070714_100009580 | 3300005435 | Bacteria | 7622 |
| 78 | Ga0070714_100014952 | 3300005435 | Bacteria | 6239 |
| 79 | Ga0070713_100000371 | 3300005436 | Bacteria | 28904 |
| 80 | Ga0070701_10000204 | 3300005438 | Bacteria | 18457 |
| 81 | Ga0070700_100000856 | 3300005441 | Bacteria | 15021 |
| 82 | Ga0070694_100002279 | 3300005444 | Bacteria | 11339 |
| 83 | Ga0070694_100070271 | 3300005444 | Bacteria | 2410 |
| 84 | Ga0070663_100000945 | 3300005455 | Bacteria | 15785 |
| 85 | Ga0070678_100314752 | 3300005456 | Bacteria | 1335 |
| 86 | Ga0070662_100003593 | 3300005457 | Bacteria | 9675 |
| 87 | Ga0070681_10009252 | 3300005458 | Bacteria | 9684 |
| 88 | Ga0070681_10041263 | 3300005458 | Bacteria | 4624 |
| 89 | Ga0070681_10049176 | 3300005458 | Bacteria | 4212 |
| 90 | Ga0070681_10264052 | 3300005458 | Bacteria | 1633 |
| 91 | Ga0068867_100151199 | 3300005459 | Bacteria | 1824 |
| 92 | Ga0070685_10031229 | 3300005466 | Bacteria | 2974 |
| 93 | Ga0070679_100002050 | 3300005530 | Bacteria | 18095 |
| 94 | Ga0070679_100013603 | 3300005530 | Bacteria | 7796 |
| 95 | Ga0070679_100100453 | 3300005530 | Bacteria | 2879 |
| 96 | Ga0070679_100228746 | 3300005530 | Bacteria | 1819 |
| 97 | Ga0070679_100238982 | 3300005530 | Bacteria | 1774 |
| 98 | Ga0070684_100000365 | 3300005535 | Bacteria | 31110 |
| 99 | Ga0070684_100035412 | 3300005535 | Bacteria | 4272 |
| 100 | Ga0068853_100000523 | 3300005539 | Bacteria | 25970 |
| 101 | Ga0070672_100000709 | 3300005543 | Bacteria | 19721 |
| 102 | Ga0070686_100000455 | 3300005544 | Bacteria | 24982 |
| 103 | Ga0070695_100001044 | 3300005545 | Bacteria | 15130 |
| 104 | Ga0070696_100021689 | 3300005546 | Bacteria | 4356 |
| 105 | Ga0070696_100237412 | 3300005546 | Bacteria | 1373 |
| 106 | Ga0070693_100000905 | 3300005547 | Bacteria | 13209 |
| 107 | Ga0070693_100060132 | 3300005547 | Bacteria | 2205 |
| 108 | Ga0070665_100000327 | 3300005548 | Bacteria | 73382 |
| 109 | Ga0070665_100052141 | 3300005548 | Bacteria | 4105 |
| 110 | Ga0070665_100109298 | 3300005548 | Bacteria | 2767 |
| 111 | Ga0070665_100140598 | 3300005548 | Bacteria | 2418 |
| 112 | Ga0070704_100000197 | 3300005549 | Bacteria | 24897 |
| 113 | Ga0068855_100040932 | 3300005563 | Bacteria | 5495 |
| 114 | Ga0068855_100079840 | 3300005563 | Bacteria | 3793 |
| 115 | Ga0068855_100098430 | 3300005563 | Bacteria | 3369 |
| 116 | Ga0068855_100099582 | 3300005563 | Bacteria | 3347 |
| 117 | Ga0068855_100643262 | 3300005563 | Bacteria | 1139 |
| 118 | Ga0070664_100002074 | 3300005564 | Bacteria | 16005 |
| 119 | Ga0068857_100000921 | 3300005577 | Bacteria | 22261 |
| 120 | Ga0068857_100024980 | 3300005577 | Bacteria | 5262 |
| 121 | Ga0068854_100000749 | 3300005578 | Bacteria | 19195 |
| 122 | Ga0068854_100019836 | 3300005578 | Bacteria | 4537 |
| 123 | Ga0068856_100000902 | 3300005614 | Bacteria | 31812 |
| 124 | Ga0068856_100253827 | 3300005614 | Bacteria | 1773 |
| 125 | Ga0070702_100002928 | 3300005615 | Bacteria | 7519 |
| 126 | Ga0070702_100164471 | 3300005615 | Bacteria | 1437 |
| 127 | Ga0068852_100015241 | 3300005616 | Bacteria | 5953 |
| 128 | Ga0068852_100110867 | 3300005616 | Bacteria | 2494 |
| 129 | Ga0068859_100004450 | 3300005617 | Bacteria | 14299 |
| 130 | Ga0068859_100008773 | 3300005617 | Bacteria | 10209 |
| 131 | Ga0068859_100089758 | 3300005617 | Bacteria | 3124 |
| 132 | Ga0068864_100049073 | 3300005618 | Bacteria | 3630 |
| 133 | Ga0068866_10002012 | 3300005718 | Bacteria | 8459 |
| 134 | Ga0068861_100000825 | 3300005719 | Bacteria | 18722 |
| 135 | Ga0068870_10000112 | 3300005840 | Bacteria | 27710 |
| 136 | Ga0068863_100000703 | 3300005841 | Bacteria | 33695 |
| 137 | Ga0068863_100023806 | 3300005841 | Bacteria | 5845 |
| 138 | Ga0068858_100008283 | 3300005842 | Bacteria | 9996 |
| 139 | Ga0068858_100019588 | 3300005842 | Bacteria | 6326 |
| 140 | Ga0068860_100000165 | 3300005843 | Bacteria | 108321 |
| 141 | Ga0068860_100006736 | 3300005843 | Bacteria | 11522 |
| 142 | Ga0068860_100049862 | 3300005843 | Bacteria | 3986 |
| 143 | Ga0068860_100051115 | 3300005843 | Bacteria | 3933 |
| 144 | Ga0068860_100120534 | 3300005843 | Bacteria | 2512 |
| 145 | Ga0068862_100006290 | 3300005844 | Bacteria | 9882 |
| 146 | Ga0068862_100100949 | 3300005844 | Bacteria | 2524 |
| 147 | Ga0081455_10011886 | 3300005937 | Bacteria | 8717 |
| 148 | Ga0081540_1010346 | 3300005983 | Bacteria | 6327 |
| 149 | Ga0081540_1014849 | 3300005983 | Bacteria | 4959 |
| 150 | Ga0081540_1033560 | 3300005983 | Bacteria | 2785 |
| 151 | Ga0081540_1083756 | 3300005983 | Bacteria | 1425 |
| 152 | Ga0075368_10024712 | 3300006042 | Bacteria | 2302 |
| 153 | Ga0075363_100114362 | 3300006048 | Bacteria | 1502 |
| 154 | Ga0075364_10057532 | 3300006051 | Bacteria | 2547 |
| 155 | Ga0075364_10145686 | 3300006051 | Bacteria | 1594 |
| 156 | Ga0070716_100117379 | 3300006173 | Bacteria | 1660 |
| 157 | Ga0075362_10036225 | 3300006177 | Bacteria | 2157 |
| 158 | Ga0075369_10015948 | 3300006186 | Bacteria | 3024 |
| 159 | Ga0075366_10049965 | 3300006195 | Bacteria | 2482 |
| 160 | Ga0097621_100000473 | 3300006237 | Bacteria | 28196 |
| 161 | Ga0097621_100025204 | 3300006237 | Bacteria | 4651 |
| 162 | Ga0075370_10068039 | 3300006353 | Bacteria | 2033 |
| 163 | Ga0068871_100000118 | 3300006358 | Bacteria | 49211 |
| 164 | Ga0068871_100016676 | 3300006358 | Bacteria | 5540 |
| 165 | Ga0068871_100389850 | 3300006358 | Bacteria | 1239 |
| 166 | Ga0075428_100208791 | 3300006844 | Bacteria | 2110 |
| 167 | Ga0075430_100033350 | 3300006846 | Bacteria | 4370 |
| 168 | Ga0075431_100212332 | 3300006847 | Bacteria | 1977 |
| 169 | Ga0075431_100263706 | 3300006847 | Bacteria | 1748 |
| 170 | Ga0075434_100013398 | 3300006871 | Bacteria | 7801 |
| 171 | Ga0075434_100434097 | 3300006871 | Bacteria | 1335 |
| 172 | Ga0097620_100004450 | 3300006931 | Bacteria | 14299 |
| 173 | Ga0097620_100008773 | 3300006931 | Bacteria | 10209 |
| 174 | Ga0097620_100089759 | 3300006931 | Bacteria | 3124 |
| 175 | Ga0105240_10022758 | 3300009093 | Bacteria | 8302 |
| 176 | Ga0105240_10064698 | 3300009093 | Bacteria | 4543 |
| 177 | Ga0111539_10001167 | 3300009094 | Bacteria | 34770 |
| 178 | Ga0111539_10004804 | 3300009094 | Bacteria | 17625 |
| 179 | Ga0105245_10001982 | 3300009098 | Bacteria | 18594 |
| 180 | Ga0105245_10021615 | 3300009098 | Bacteria | 5646 |
| 181 | Ga0114129_10015418 | 3300009147 | Bacteria | 10872 |
| 182 | Ga0114129_10180395 | 3300009147 | Bacteria | 2873 |
| 183 | Ga0105243_10002278 | 3300009148 | Bacteria | 16096 |
| 184 | Ga0105243_10054499 | 3300009148 | Bacteria | 3175 |
| 185 | Ga0105241_10003555 | 3300009174 | Bacteria | 11590 |
| 186 | Ga0105242_10001156 | 3300009176 | Bacteria | 20789 |
| 187 | Ga0105248_10002414 | 3300009177 | Bacteria | 20740 |
| 188 | Ga0105248_10010454 | 3300009177 | Bacteria | 10220 |
| 189 | Ga0105248_10414399 | 3300009177 | Bacteria | 1517 |
| 190 | Ga0105238_10028630 | 3300009551 | Bacteria | 5675 |
| 191 | Ga0105249_10001021 | 3300009553 | Bacteria | 24754 |
| 192 | Ga0105249_10006960 | 3300009553 | Bacteria | 9861 |
| 193 | Ga0099796_10018054 | 3300010159 | Bacteria | 2112 |
| 194 | Ga0105239_10008950 | 3300010375 | Bacteria | 11329 |
| 195 | Ga0105239_10038202 | 3300010375 | Bacteria | 5261 |
| 196 | Ga0105246_10003701 | 3300011119 | Bacteria | 9254 |
| 197 | Ga0157326_1000541 | 3300012513 | Bacteria | 4473 |
| 198 | Ga0157373_10005579 | 3300013100 | Bacteria | 9433 |
| 199 | Ga0157373_10006895 | 3300013100 | Bacteria | 8454 |
| 200 | Ga0157373_10162181 | 3300013100 | Bacteria | 1573 |
| 201 | Ga0157371_10016850 | 3300013102 | Bacteria | 5440 |
| 202 | Ga0157371_10131676 | 3300013102 | Bacteria | 1779 |
| 203 | Ga0157369_10521336 | 3300013105 | Bacteria | 1229 |
| 204 | Ga0157374_10015941 | 3300013296 | Bacteria | 6602 |
| 205 | Ga0157378_10002986 | 3300013297 | Bacteria | 15027 |
| 206 | Ga0157378_10375921 | 3300013297 | Bacteria | 1394 |
| 207 | Ga0163162_10009522 | 3300013306 | Bacteria | 9448 |
| 208 | Ga0157372_10008348 | 3300013307 | Bacteria | 11015 |
| 209 | Ga0157375_10000508 | 3300013308 | Bacteria | 35108 |
| 210 | Ga0157375_10053915 | 3300013308 | Bacteria | 3959 |
| 211 | Ga0163163_10082125 | 3300014325 | Bacteria | 3226 |
| 212 | Ga0157380_10000212 | 3300014326 | Bacteria | 34358 |
| 213 | Ga0157377_10000287 | 3300014745 | Bacteria | 24040 |
| 214 | Ga0157379_10008690 | 3300014968 | Bacteria | 8847 |
| 215 | Ga0157379_10046080 | 3300014968 | Bacteria | 3892 |
| 216 | Ga0157376_10004642 | 3300014969 | Bacteria | 9575 |
| 217 | Ga0157376_10016040 | 3300014969 | Bacteria | 5675 |
| 218 | Ga0163161_10000415 | 3300017792 | Bacteria | 35797 |
| 219 | Ga0209258_100123 | 3300025242 | Bacteria | 178931 |
| 220 | Ga0209026_1005744 | 3300025250 | Bacteria | 3239 |
| 221 | Ga0209759_1001598 | 3300025256 | Bacteria | 12262 |
| 222 | Ga0209233_1009332 | 3300025261 | Bacteria | 2991 |
| 223 | Ga0207666_1000073 | 3300025271 | Bacteria | 16742 |
| 224 | Ga0209455_1000115 | 3300025272 | Bacteria | 178506 |
| 225 | Ga0207673_1000295 | 3300025290 | Bacteria | 5011 |
| 226 | Ga0209758_1003089 | 3300025297 | Bacteria | 15775 |
| 227 | Ga0209050_1000431 | 3300025298 | Bacteria | 76895 |
| 228 | Ga0209257_1000572 | 3300025304 | Bacteria | 61910 |
| 229 | Ga0209257_1001182 | 3300025304 | Bacteria | 33003 |
| 230 | Ga0207697_10000061 | 3300025315 | Bacteria | 45271 |
| 231 | Ga0207697_10005956 | 3300025315 | Bacteria | 5594 |
| 232 | Ga0207653_10005338 | 3300025885 | Bacteria | 4015 |
| 233 | Ga0207682_10002961 | 3300025893 | Bacteria | 7454 |
| 234 | Ga0207692_10150929 | 3300025898 | Bacteria | 1331 |
| 235 | Ga0207642_10001238 | 3300025899 | Bacteria | 7906 |
| 236 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 237 | Ga0207688_10015574 | 3300025901 | Bacteria | 4122 |
| 238 | Ga0207685_10037419 | 3300025905 | Bacteria | 1787 |
| 239 | Ga0207645_10000222 | 3300025907 | Bacteria | 47139 |
| 240 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 241 | Ga0207705_10019295 | 3300025909 | Bacteria | 4875 |
| 242 | Ga0207705_10054591 | 3300025909 | Bacteria | 2879 |
| 243 | Ga0207705_10086233 | 3300025909 | Bacteria | 2294 |
| 244 | Ga0207654_10001390 | 3300025911 | Bacteria | 12824 |
| 245 | Ga0207707_10004174 | 3300025912 | Bacteria | 12795 |
| 246 | Ga0207707_10007205 | 3300025912 | Bacteria | 9680 |
| 247 | Ga0207707_10139243 | 3300025912 | Bacteria | 2122 |
| 248 | Ga0207707_10317028 | 3300025912 | Bacteria | 1347 |
| 249 | Ga0207695_10002836 | 3300025913 | Bacteria | 25176 |
| 250 | Ga0207695_10003652 | 3300025913 | Bacteria | 21488 |
| 251 | Ga0207695_10037195 | 3300025913 | Bacteria | 5254 |
| 252 | Ga0207695_10041473 | 3300025913 | Bacteria | 4927 |
| 253 | Ga0207671_10033935 | 3300025914 | Bacteria | 3794 |
| 254 | Ga0207660_10000197 | 3300025917 | Bacteria | 38486 |
| 255 | Ga0207660_10056050 | 3300025917 | Bacteria | 2819 |
| 256 | Ga0207657_10000776 | 3300025919 | Bacteria | 33868 |
| 257 | Ga0207657_10060873 | 3300025919 | Bacteria | 3239 |
| 258 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 259 | Ga0207649_10271357 | 3300025920 | Bacteria | 1230 |
| 260 | Ga0207652_10001438 | 3300025921 | Bacteria | 21098 |
| 261 | Ga0207652_10028531 | 3300025921 | Bacteria | 4657 |
| 262 | Ga0207652_10041704 | 3300025921 | Bacteria | 3903 |
| 263 | Ga0207652_10065597 | 3300025921 | Bacteria | 3144 |
| 264 | Ga0207652_10096741 | 3300025921 | Bacteria | 2601 |
| 265 | Ga0207652_10169340 | 3300025921 | Bacteria | 1959 |
| 266 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 267 | Ga0207681_10307423 | 3300025923 | Bacteria | 1256 |
| 268 | Ga0207694_10057865 | 3300025924 | Bacteria | 3015 |
| 269 | Ga0207650_10006131 | 3300025925 | Bacteria | 8190 |
| 270 | Ga0207650_10035460 | 3300025925 | Bacteria | 3623 |
| 271 | Ga0207659_10000132 | 3300025926 | Bacteria | 43798 |
| 272 | Ga0207659_10093633 | 3300025926 | Bacteria | 2249 |
| 273 | Ga0207687_10000174 | 3300025927 | Bacteria | 42351 |
| 274 | Ga0207687_10017776 | 3300025927 | Bacteria | 4688 |
| 275 | Ga0207700_10000274 | 3300025928 | Bacteria | 30765 |
| 276 | Ga0207700_10118585 | 3300025928 | Bacteria | 2142 |
| 277 | Ga0207664_10007717 | 3300025929 | Bacteria | 7469 |
| 278 | Ga0207644_10000212 | 3300025931 | Bacteria | 40175 |
| 279 | Ga0207644_10016349 | 3300025931 | Bacteria | 4992 |
| 280 | Ga0207644_10098037 | 3300025931 | Bacteria | 2196 |
| 281 | Ga0207690_10000148 | 3300025932 | Bacteria | 56244 |
| 282 | Ga0207690_10000294 | 3300025932 | Bacteria | 35162 |
| 283 | Ga0207706_10001360 | 3300025933 | Bacteria | 24441 |
| 284 | Ga0207706_10025201 | 3300025933 | Bacteria | 5332 |
| 285 | Ga0207706_10144799 | 3300025933 | Bacteria | 2090 |
| 286 | Ga0207709_10000530 | 3300025935 | Bacteria | 33097 |
| 287 | Ga0207670_10000523 | 3300025936 | Bacteria | 21171 |
| 288 | Ga0207670_10317815 | 3300025936 | Bacteria | 1224 |
| 289 | Ga0207669_10000857 | 3300025937 | Bacteria | 12949 |
| 290 | Ga0207704_10000198 | 3300025938 | Bacteria | 31182 |
| 291 | Ga0207691_10000517 | 3300025940 | Bacteria | 38398 |
| 292 | Ga0207691_10076224 | 3300025940 | Bacteria | 3022 |
| 293 | Ga0207691_10252651 | 3300025940 | Bacteria | 1521 |
| 294 | Ga0207711_10008997 | 3300025941 | Bacteria | 8349 |
| 295 | Ga0207711_10041446 | 3300025941 | Bacteria | 3921 |
| 296 | Ga0207711_10311697 | 3300025941 | Bacteria | 1453 |
| 297 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 298 | Ga0207661_10001089 | 3300025944 | Bacteria | 18028 |
| 299 | Ga0207661_10094772 | 3300025944 | Bacteria | 2494 |
| 300 | Ga0207679_10000183 | 3300025945 | Bacteria | 51645 |
| 301 | Ga0207667_10057690 | 3300025949 | Bacteria | 4074 |
| 302 | Ga0207667_10458292 | 3300025949 | Bacteria | 1295 |
| 303 | Ga0207651_10000051 | 3300025960 | Bacteria | 54163 |
| 304 | Ga0207651_10155404 | 3300025960 | Bacteria | 1786 |
| 305 | Ga0207712_10000738 | 3300025961 | Bacteria | 24767 |
| 306 | Ga0207712_10056531 | 3300025961 | Bacteria | 2765 |
| 307 | Ga0207668_10000664 | 3300025972 | Bacteria | 21087 |
| 308 | Ga0207668_10009551 | 3300025972 | Bacteria | 5821 |
| 309 | Ga0207668_10078238 | 3300025972 | Bacteria | 2387 |
| 310 | Ga0207640_10002152 | 3300025981 | Bacteria | 10584 |
| 311 | Ga0207658_10016338 | 3300025986 | Bacteria | 5104 |
| 312 | Ga0207677_10075252 | 3300026023 | Bacteria | 2399 |
| 313 | Ga0207703_10279307 | 3300026035 | Bacteria | 1516 |
| 314 | Ga0207703_10321818 | 3300026035 | Bacteria | 1416 |
| 315 | Ga0207639_10001257 | 3300026041 | Bacteria | 17164 |
| 316 | Ga0207678_10000531 | 3300026067 | Bacteria | 34761 |
| 317 | Ga0207708_10000573 | 3300026075 | Bacteria | 28465 |
| 318 | Ga0207708_10006283 | 3300026075 | Bacteria | 8804 |
| 319 | Ga0207702_10003284 | 3300026078 | Bacteria | 14915 |
| 320 | Ga0207641_10001041 | 3300026088 | Bacteria | 28118 |
| 321 | Ga0207648_10000581 | 3300026089 | Bacteria | 41019 |
| 322 | Ga0207676_10000124 | 3300026095 | Bacteria | 67747 |
| 323 | Ga0207676_10033074 | 3300026095 | Bacteria | 3904 |
| 324 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 325 | Ga0207674_10032833 | 3300026116 | Bacteria | 5441 |
| 326 | Ga0207675_100000414 | 3300026118 | Bacteria | 41042 |
| 327 | Ga0207675_100149414 | 3300026118 | Bacteria | 2223 |
| 328 | Ga0207683_10000242 | 3300026121 | Bacteria | 48576 |
| 329 | Ga0207698_10000951 | 3300026142 | Bacteria | 16837 |
| 330 | Ga0207698_10473032 | 3300026142 | Bacteria | 1214 |
| 331 | Ga0209981_1001280 | 3300027378 | Bacteria | 3191 |
| 332 | Ga0210000_1001323 | 3300027462 | Bacteria | 3489 |
| 333 | Ga0209999_1004075 | 3300027543 | Bacteria | 2625 |
| 334 | Ga0209999_1008573 | 3300027543 | Bacteria | 1845 |
| 335 | Ga0209982_1006315 | 3300027552 | Bacteria | 1722 |
| 336 | Ga0210002_1001450 | 3300027617 | Bacteria | 3346 |
| 337 | Ga0209983_1001668 | 3300027665 | Bacteria | 4921 |
| 338 | Ga0209971_1004583 | 3300027682 | Bacteria | 3279 |
| 339 | Ga0209966_1001052 | 3300027695 | Bacteria | 5088 |
| 340 | Ga0209974_10001326 | 3300027876 | Bacteria | 8891 |
| 341 | Ga0209974_10006235 | 3300027876 | Bacteria | 4171 |
| 342 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 343 | Ga0207428_10001773 | 3300027907 | Bacteria | 22109 |
| 344 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 345 | Ga0268266_10050497 | 3300028379 | Bacteria | 3569 |
| 346 | Ga0268266_10071783 | 3300028379 | Bacteria | 3001 |
| 347 | Ga0268266_10076065 | 3300028379 | Bacteria | 2917 |
| 348 | Ga0268265_10000757 | 3300028380 | Bacteria | 31383 |
| 349 | Ga0268265_10010381 | 3300028380 | Bacteria | 6292 |
| 350 | Ga0268265_10012546 | 3300028380 | Bacteria | 5744 |
| 351 | Ga0268265_10101042 | 3300028380 | Bacteria | 2329 |
| 352 | Ga0268264_10000021 | 3300028381 | Bacteria | 481580 |
| 353 | Ga0268264_10002331 | 3300028381 | Bacteria | 16789 |
| 354 | Ga0268264_10012005 | 3300028381 | Bacteria | 7133 |
| 355 | Ga0265336_10000048 | 3300028666 | Bacteria | 121572 |
| 356 | Ga0307517_10004666 | 3300028786 | Bacteria | 21011 |
| 357 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 358 | Ga0265324_10003288 | 3300029957 | Bacteria | 7765 |
| 359 | Ga0307511_10061552 | 3300030521 | Bacteria | 2859 |
| 360 | Ga0265330_10068397 | 3300031235 | Bacteria | 1538 |
| 361 | Ga0265325_10024100 | 3300031241 | Bacteria | 3312 |
| 362 | Ga0265339_10002224 | 3300031249 | Bacteria | 14062 |
| 363 | Ga0265327_10077631 | 3300031251 | Bacteria | 1647 |
| 364 | Ga0307513_10001560 | 3300031456 | Bacteria | 32859 |
| 365 | Ga0307513_10025455 | 3300031456 | Bacteria | 6855 |
| 366 | Ga0307408_100098197 | 3300031548 | Bacteria | 2226 |
| 367 | Ga0265313_10000098 | 3300031595 | Bacteria | 89130 |
| 368 | Ga0265342_10099615 | 3300031712 | Bacteria | 1657 |
| 369 | Ga0265342_10134189 | 3300031712 | Bacteria | 1385 |
| 370 | Ga0307516_10003023 | 3300031730 | Bacteria | 21939 |
| 371 | Ga0307507_10128569 | 3300033179 | Bacteria | 1993 |
| 372 | Ga0307510_10026020 | 3300033180 | Bacteria | 6736 |
| 373 | Ga0373930_0000371 | 3300034816 | Bacteria | 5868 |
| 374 | Ga0373948_0000135 | 3300034817 | Bacteria | 7792 |
| 375 | Ga0373950_0000327 | 3300034818 | Bacteria | 5972 |
| 376 | Ga0373958_0000084 | 3300034819 | Bacteria | 9758 |
| 377 | Ga0373938_0000013 | 3300034957 | Bacteria | 24269 |
| 378 | Ga0373928_0001053 | 3300035084 | Bacteria | 5442 |
| 379 | Ga0373929_0002957 | 3300035085 | Bacteria | 3093 |
| 380 | Ga0373940_0002191 | 3300035088 | Bacteria | 3746 |
| 381 | Ga0373949_0001274 | 3300035090 | Bacteria | 7344 |
| 382 | Ga0373951_0006039 | 3300035091 | Bacteria | 2787 |
| 383 | Ga0373952_0000880 | 3300035092 | Bacteria | 5466 |
| 384 | Ga0373932_0000427 | 3300035112 | Bacteria | 12821 |
| 385 | Ga0373932_0001840 | 3300035112 | Bacteria | 5677 |
| 386 | Ga0373936_0005812 | 3300035113 | Bacteria | 4647 |
| 387 | Ga0373939_0000704 | 3300035114 | Bacteria | 8284 |
| 388 | Ga0373960_0000570 | 3300035121 | Bacteria | 7483 |
| 389 | Ga0373942_0000725 | 3300035207 | Bacteria | 9083 |
| 390 | Ga0373962_0000542 | 3300035242 | Bacteria | 8470 |
| 391 | Ga0373962_0000610 | 3300035242 | Bacteria | 8072 |
| 392 | Ga0373931_0002178 | 3300035691 | Bacteria | 8639 |
| 393 | Ga0373931_0046588 | 3300035691 | Bacteria | 2292 |
| 394 | Ga0373927_0073950 | 3300035695 | Bacteria | 2207 |
| 395 | Ga0373927_0106094 | 3300035695 | Bacteria | 1829 |
| 396 | Ga0373927_0163754 | 3300035695 | Bacteria | 1457 |
| 397 | Ga0373925_0263357 | 3300037068 | Bacteria | 1385 |
| 398 | Ga0395899_0005491 | 3300037312 | Bacteria | 9828 |
| 399 | Ga0395899_0037648 | 3300037312 | Bacteria | 3626 |
| 400 | Ga0395900_0004219 | 3300037418 | Bacteria | 15252 |
| 401 | Ga0395900_0017348 | 3300037418 | Bacteria | 7350 |
| 402 | Ga0395900_0160111 | 3300037418 | Bacteria | 2296 |
| 403 | Ga0395900_0202164 | 3300037418 | Bacteria | 2009 |
| 404 | Ga0395900_0316748 | 3300037418 | Bacteria | 1541 |
| 405 | Ga0395898_0014233 | 3300037466 | Bacteria | 8177 |
| 406 | Ga0395898_0015013 | 3300037466 | Bacteria | 7950 |
| 407 | Ga0395898_0022197 | 3300037466 | Bacteria | 6432 |
| 408 | Ga0395898_0352416 | 3300037466 | Bacteria | 1403 |
| 409 | Ga0395905_0000983 | 3300037471 | Bacteria | 36562 |
| 410 | Ga0395901_0022367 | 3300038443 | Bacteria | 6478 |
| 411 | Ga0395901_0088277 | 3300038443 | Bacteria | 3243 |
| 412 | Ga0395901_0130825 | 3300038443 | Bacteria | 2637 |
| 413 | Ga0395901_0242258 | 3300038443 | Bacteria | 1880 |
| 414 | Ga0395901_0603684 | 3300038443 | Bacteria | 1106 |
| 415 | Ga0436365_0677869 | 3300039437 | Bacteria | 1359 |
| 416 | Ga0436365_1378731 | 3300039437 | Bacteria | 1495 |
| 417 | Ga0436360_0898381 | 3300039438 | Bacteria | 1634 |
| 418 | Ga0436360_1266199 | 3300039438 | Bacteria | 1137 |
| 419 | Ga0436361_0180569 | 3300039447 | Bacteria | 3182 |
| 420 | Ga0451577_0004901 | 3300042876 | Bacteria | 13951 |
| 421 | Ga0451577_0057580 | 3300042876 | Bacteria | 3464 |
| 422 | Ga0451577_0068162 | 3300042876 | Bacteria | 3173 |
| 423 | Ga0451577_0146502 | 3300042876 | Bacteria | 2123 |
| 424 | Ga0453683_0013725 | 3300044673 | Bacteria | 5275 |
| 425 | Ga0453683_0048258 | 3300044673 | Bacteria | 2671 |
| 426 | Ga0466966_0051914 | 3300044684 | Bacteria | 2606 |
| 427 | Ga0466963_0043929 | 3300044694 | Bacteria | 2940 |
| 428 | Ga0453684_0014814 | 3300044712 | Bacteria | 12416 |
| 429 | Ga0466957_0188578 | 3300044842 | Bacteria | 1350 |
| 430 | Ga0451576_0006125 | 3300045051 | Bacteria | 14822 |
| 431 | Ga0451576_0024532 | 3300045051 | Bacteria | 6514 |
| 432 | Ga0451576_0177053 | 3300045051 | Bacteria | 2227 |
| 433 | Ga0466967_0003577 | 3300045976 | Bacteria | 10195 |
| 434 | Ga0495603_0097030 | 3300046455 | Bacteria | 1722 |
| 435 | Ga0495638_0159912 | 3300046460 | Bacteria | 1300 |
| 436 | Ga0495638_0164278 | 3300046460 | Bacteria | 1278 |
| 437 | Ga0495639_0003100 | 3300046475 | Bacteria | 7230 |
| 438 | Ga0495583_0000062 | 3300046506 | Bacteria | 195151 |
| 439 | Ga0495606_0001633 | 3300046507 | Bacteria | 29221 |
| 440 | Ga0495637_0021073 | 3300046520 | Bacteria | 2991 |
| 441 | Ga0495637_0060757 | 3300046520 | Bacteria | 1551 |
| 442 | Ga0495640_0007537 | 3300046533 | Bacteria | 8551 |
| 443 | Ga0495621_0030896 | 3300046539 | Bacteria | 1834 |
| 444 | Ga0495597_0037382 | 3300046542 | Bacteria | 2180 |
| 445 | Ga0495668_0065197 | 3300046616 | Bacteria | 2005 |
| 446 | Ga0495634_0054248 | 3300046642 | Bacteria | 2684 |
| 447 | Ga0495625_0007787 | 3300046660 | Bacteria | 9246 |
| 448 | Ga0495625_0035033 | 3300046660 | Bacteria | 3702 |
| 449 | Ga0495659_0005240 | 3300046664 | Bacteria | 4078 |
| 450 | Ga0495669_0000009 | 3300046684 | Bacteria | 165516 |
| 451 | Ga0495649_0000247 | 3300046694 | Bacteria | 47906 |
| 452 | Ga0495589_0003753 | 3300046794 | Bacteria | 8176 |
| 453 | Ga0495674_0073619 | 3300047319 | Bacteria | 2944 |
| 454 | Ga0495677_0069031 | 3300047445 | Bacteria | 1316 |
| 455 | Ga0495686_0000049 | 3300047472 | Bacteria | 275004 |
| 456 | Ga0495686_0014246 | 3300047472 | Bacteria | 5479 |
| 457 | Ga0496101_0000866 | 3300048904 | Bacteria | 17903 |
| 458 | Ga0496102_0001833 | 3300048905 | Bacteria | 18355 |
| 459 | Ga0496102_0246568 | 3300048905 | Bacteria | 1684 |
| 460 | Ga0496103_0001022 | 3300048906 | Bacteria | 19583 |
| 461 | Ga0496107_0000118 | 3300048910 | Bacteria | 38697 |
| 462 | Ga0496108_0006961 | 3300048911 | Bacteria | 9152 |
| 463 | Ga0496108_0077610 | 3300048911 | Bacteria | 2810 |
| 464 | Ga0496109_0002269 | 3300048912 | Bacteria | 15980 |
| 465 | Ga0496109_0042716 | 3300048912 | Bacteria | 4108 |
| 466 | Ga0496110_0156665 | 3300048913 | Bacteria | 2063 |
| 467 | Ga0496112_0064319 | 3300048915 | Bacteria | 3620 |
| 468 | Ga0496112_0102359 | 3300048915 | Bacteria | 2834 |
| 469 | Ga0496113_0067850 | 3300048916 | Bacteria | 2706 |
| 470 | Ga0496114_0372423 | 3300048917 | Bacteria | 1264 |
| 471 | Ga0496115_0000967 | 3300048918 | Bacteria | 20862 |
| 472 | Ga0496115_0106814 | 3300048918 | Bacteria | 2298 |
| 473 | Ga0496126_0018874 | 3300048929 | Bacteria | 6814 |
| 474 | Ga0501031_0222190 | 3300049568 | Bacteria | 1230 |
| 475 | Ga0501032_0054310 | 3300049569 | Bacteria | 2697 |
| 476 | Ga0501033_0033776 | 3300049570 | Bacteria | 3840 |
| 477 | Ga0501034_0086892 | 3300049571 | Bacteria | 3127 |
| 478 | Ga0501038_0149809 | 3300049574 | Bacteria | 1902 |
| 479 | Ga0501038_0187603 | 3300049574 | Bacteria | 1665 |
| 480 | Ga0501039_0149854 | 3300049575 | Bacteria | 1833 |
| 481 | Ga0501043_0015687 | 3300049579 | Bacteria | 5939 |
| 482 | Ga0501047_0000729 | 3300049581 | Bacteria | 34190 |
| 483 | Ga0501047_0012289 | 3300049581 | Bacteria | 8103 |
| 484 | Ga0501047_0027647 | 3300049581 | Bacteria | 5465 |
| 485 | Ga0501047_0106554 | 3300049581 | Bacteria | 2684 |
| 486 | Ga0501047_0109557 | 3300049581 | Bacteria | 2644 |
| 487 | Ga0501047_0350892 | 3300049581 | Bacteria | 1312 |
| 488 | Ga0501067_0065525 | 3300049583 | Bacteria | 2011 |
| 489 | Ga0501067_0088263 | 3300049583 | Bacteria | 1721 |
| 490 | Ga0501068_0021679 | 3300049584 | Bacteria | 3754 |
| 491 | Ga0501070_0039278 | 3300049586 | Bacteria | 3948 |
| 492 | Ga0501070_0110901 | 3300049586 | Bacteria | 2267 |
| 493 | Ga0501072_0097662 | 3300049588 | Bacteria | 2335 |
| 494 | Ga0501073_0027102 | 3300049589 | Bacteria | 4101 |
| 495 | Ga0501073_0091631 | 3300049589 | Bacteria | 2113 |
| 496 | Ga0501073_0155006 | 3300049589 | Bacteria | 1588 |
| 497 | Ga0501074_0190975 | 3300049590 | Bacteria | 1460 |
| 498 | Ga0501075_0114076 | 3300049591 | Bacteria | 2055 |
| 499 | Ga0501080_0129759 | 3300049742 | Bacteria | 2333 |
| 500 | Ga0501080_0156434 | 3300049742 | Bacteria | 2105 |
| 501 | Ga0501083_0014143 | 3300049744 | Bacteria | 5581 |
| 502 | Ga0501083_0088579 | 3300049744 | Bacteria | 2046 |
| 503 | Ga0501035_0001116 | 3300049822 | Bacteria | 28096 |
| 504 | Ga0501035_0027156 | 3300049822 | Bacteria | 5234 |
| 505 | Ga0501035_0087906 | 3300049822 | Bacteria | 2739 |
| 506 | Ga0501044_0000222 | 3300049823 | Bacteria | 71930 |
| 507 | Ga0501044_0006838 | 3300049823 | Bacteria | 12568 |
| 508 | Ga0501044_0066214 | 3300049823 | Bacteria | 3684 |
| 509 | nmdc:mga0k408_34689_c2 | 3300050493 | Bacteria | 2284 |
| 510 | nmdc:mga07m45_59399_c1 | 3300050496 | Bacteria | 2164 |
| 511 | nmdc:mga0qj67_151017_c1 | 3300050509 | Bacteria | 1885 |
| 512 | nmdc:mga06r32_115174_c1 | 3300050510 | Bacteria | 2647 |
| 513 | nmdc:mga08y16_13712_c1 | 3300050511 | Bacteria | 8533 |
| 514 | nmdc:mga08y16_333_c1 | 3300050511 | Bacteria | 42807 |
| 515 | nmdc:mga0n895_62_c1 | 3300050512 | Bacteria | 62891 |
| 516 | nmdc:mga0n895_97850_c1 | 3300050512 | Bacteria | 2940 |
| 517 | Ga0495601_0011855 | 3300053077 | Bacteria | 5226 |
| 518 | Ga0495595_0009473 | 3300053084 | Bacteria | 4030 |
| 519 | Ga0495619_0025558 | 3300053085 | Bacteria | 3793 |
| 520 | Ga0500643_004921 | 3300053087 | Bacteria | 5880 |
| 521 | Ga0500644_0000282 | 3300053088 | Bacteria | 28207 |
| 522 | Ga0500651_0001656 | 3300053093 | Bacteria | 11353 |
| 523 | Ga0500641_0001396 | 3300053096 | Bacteria | 8609 |
| 524 | Ga0500641_0008896 | 3300053096 | Bacteria | 3599 |
| 525 | Ga0500641_0041561 | 3300053096 | Bacteria | 1861 |
| 526 | Ga0500562_011969 | 3300053108 | Bacteria | 2202 |
| 527 | Ga0500593_032897 | 3300053117 | Bacteria | 2321 |
| 528 | Ga0500594_0013276 | 3300053118 | Bacteria | 1956 |
| 529 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 530 | Ga0500642_0010511 | 3300053130 | Bacteria | 3267 |
| 531 | Ga0500652_000024 | 3300053131 | Bacteria | 116239 |
| 532 | Ga0500652_061781 | 3300053131 | Bacteria | 1543 |
| 533 | Ga0500655_000102 | 3300053133 | Bacteria | 21853 |
| 534 | Ga0500590_000159 | 3300053148 | Bacteria | 19562 |
| 535 | Ga0500604_0012877 | 3300053151 | Bacteria | 2263 |
| 536 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 537 | Ga0500616_0012855 | 3300053153 | Bacteria | 4881 |
| 538 | Ga0500616_0028109 | 3300053153 | Bacteria | 3101 |
| 539 | Ga0500616_0092438 | 3300053153 | Bacteria | 1495 |
| 540 | Ga0500622_0006073 | 3300053156 | Bacteria | 7092 |
| 541 | Ga0500627_0016976 | 3300053158 | Bacteria | 2851 |
| 542 | Ga0500570_000434 | 3300053724 | Bacteria | 16045 |
| 543 | Ga0500645_000033 | 3300053730 | Bacteria | 119279 |
| 544 | Ga0500645_000666 | 3300053730 | Bacteria | 21562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0603684 | Ga0395901_0603684_111_1070 | 319 |
| 2 | 3300048929 | Ga0496126_0018874 | Ga0496126_0018874_216_1376 | 341 |
| 3 | iso_pu_bacteria | 2524023210 | 2524466577 | 347 |
| 4 | iso_pu_bacteria | 2524023228 | 2524534660 | 347 |
| 5 | iso_pu_bacteria | 2582581305 | 2585261929 | 347 |
| 6 | iso_pu_bacteria | 2643221541 | 2643731008 | 347 |
| 7 | iso_pu_bacteria | 2643221598 | 2643999041 | 347 |
| 8 | iso_pu_bacteria | 2643221605 | 2644039064 | 347 |
| 9 | iso_pu_bacteria | 2643221606 | 2644044339 | 347 |
| 10 | iso_pu_bacteria | 2643221614 | 2644085038 | 347 |
| 11 | iso_pu_bacteria | 2643221661 | 2644342590 | 347 |
| 12 | iso_pu_bacteria | 2643221666 | 2644365890 | 347 |
| 13 | iso_pu_bacteria | 2643221671 | 2644391737 | 347 |
| 14 | iso_pu_bacteria | 2667528175 | 2671119309 | 347 |
| 15 | iso_pu_bacteria | 2791355197 | 2793071984 | 347 |
| 16 | iso_pu_bacteria | 2885374607 | 2885378315 | 347 |
| 17 | iso_pu_bacteria | 2903768456 | 2903769750 | 347 |
| 18 | iso_pu_bacteria | 2904699407 | 2904706143 | 347 |
| 19 | iso_pu_bacteria | 2935630451 | 2935632330 | 347 |
| 20 | iso_pu_bacteria | 2939631187 | 2939631439 | 347 |
| 21 | iso_pu_bacteria | 2941507105 | 2941508277 | 347 |
| 22 | iso_pu_bacteria | 2941515067 | 2941515217 | 347 |
| 23 | iso_pu_bacteria | 2941523033 | 2941524208 | 347 |
| 24 | iso_pu_bacteria | 8006933436 | 8006933797 | 347 |
| 25 | iso_pu_bacteria | 8006973647 | 8006983469 | 347 |
| 26 | iso_pu_bacteria | 8056681323 | 8056689684 | 347 |
| 27 | iso_pu_bacteria | 8056689827 | 8056693181 | 347 |
| 28 | 2162886007 | SwRhRL2b_contig_3047889 | SwRhRL2b_0947.00007960 | 351 |
| 29 | 3300000042 | ARSoilYngRDRAFT_c00458 | ARSoilYngRDRAFT_004585 | 351 |
| 30 | 3300000043 | ARcpr5yngRDRAFT_c002082 | ARcpr5yngRDRAFT_0020822 | 351 |
| 31 | 3300000044 | ARSoilOldRDRAFT_c000053 | ARSoilOldRDRAFT_00005331 | 351 |
| 32 | 3300000045 | ARCol0oldRDRAFT_c01210 | ARCol0oldRDRAFT_012102 | 351 |
| 33 | 3300000652 | ARCol0yngRDRAFT_1000025 | ARCol0yngRDRAFT_100002535 | 351 |
| 34 | 3300001978 | JGI24747J21853_1000252 | JGI24747J21853_10002522 | 351 |
| 35 | 3300001989 | JGI24739J22299_10004000 | JGI24739J22299_100040004 | 351 |
| 36 | 3300001989 | JGI24739J22299_10008709 | JGI24739J22299_100087093 | 351 |
| 37 | 3300001990 | JGI24737J22298_10000053 | JGI24737J22298_1000005326 | 351 |
| 38 | 3300001990 | JGI24737J22298_10004052 | JGI24737J22298_100040526 | 351 |
| 39 | 3300002070 | JGI24750J21931_1000906 | JGI24750J21931_10009063 | 351 |
| 40 | 3300002073 | JGI24745J21846_1000906 | JGI24745J21846_10009062 | 351 |
| 41 | 3300002075 | JGI24738J21930_10002204 | JGI24738J21930_100022046 | 351 |
| 42 | 3300002126 | JGI24035J26624_1000962 | JGI24035J26624_10009622 | 351 |
| 43 | 3300002239 | JGI24034J26672_10000960 | JGI24034J26672_100009602 | 351 |
| 44 | 3300002244 | JGI24742J22300_10000216 | JGI24742J22300_100002169 | 351 |
| 45 | 3300002459 | JGI24751J29686_10004605 | JGI24751J29686_100046052 | 351 |
| 46 | 3300002741 | JGI25157J39369_1011623 | JGI25157J39369_10116231 | 351 |
| 47 | 3300003761 | Ga0055535_1000063 | Ga0055535_100006375 | 351 |
| 48 | 3300003761 | Ga0055535_1000072 | Ga0055535_100007278 | 351 |
| 49 | 3300003761 | Ga0055535_1000219 | Ga0055535_100021924 | 351 |
| 50 | 3300003763 | Ga0055529_1000287 | Ga0055529_100028741 | 351 |
| 51 | 3300003791 | Ga0055530_10001762 | Ga0055530_1000176210 | 351 |
| 52 | 3300003794 | Ga0055531_10006219 | Ga0055531_100062192 | 351 |
| 53 | 3300005262 | Ga0065165_1000472 | Ga0065165_100047226 | 351 |
| 54 | 3300005262 | Ga0065165_1018743 | Ga0065165_10187432 | 351 |
| 55 | 3300005276 | Ga0065717_1002456 | Ga0065717_10024562 | 351 |
| 56 | 3300005277 | Ga0065716_1002341 | Ga0065716_10023411 | 351 |
| 57 | 3300005289 | Ga0065704_10100585 | Ga0065704_101005852 | 351 |
| 58 | 3300005290 | Ga0065712_10071633 | Ga0065712_100716335 | 351 |
| 59 | 3300005327 | Ga0070658_10011015 | Ga0070658_100110156 | 351 |
| 60 | 3300005327 | Ga0070658_10019708 | Ga0070658_100197084 | 351 |
| 61 | 3300005327 | Ga0070658_10248509 | Ga0070658_102485092 | 351 |
| 62 | 3300005328 | Ga0070676_10004729 | Ga0070676_100047297 | 351 |
| 63 | 3300005329 | Ga0070683_100001083 | Ga0070683_1000010837 | 351 |
| 64 | 3300005329 | Ga0070683_100145741 | Ga0070683_1001457412 | 351 |
| 65 | 3300005330 | Ga0070690_100002762 | Ga0070690_1000027628 | 351 |
| 66 | 3300005331 | Ga0070670_100005035 | Ga0070670_1000050354 | 351 |
| 67 | 3300005333 | Ga0070677_10003137 | Ga0070677_100031374 | 351 |
| 68 | 3300005334 | Ga0068869_100000279 | Ga0068869_10000027912 | 351 |
| 69 | 3300005336 | Ga0070680_100056337 | Ga0070680_1000563372 | 351 |
| 70 | 3300005336 | Ga0070680_100124707 | Ga0070680_1001247071 | 351 |
| 71 | 3300005336 | Ga0070680_100237101 | Ga0070680_1002371011 | 351 |
| 72 | 3300005337 | Ga0070682_100000287 | Ga0070682_1000002872 | 351 |
| 73 | 3300005338 | Ga0068868_100004075 | Ga0068868_1000040757 | 351 |
| 74 | 3300005339 | Ga0070660_100000245 | Ga0070660_10000024524 | 351 |
| 75 | 3300005339 | Ga0070660_100038256 | Ga0070660_1000382566 | 351 |
| 76 | 3300005340 | Ga0070689_100000422 | Ga0070689_1000004222 | 351 |
| 77 | 3300005341 | Ga0070691_10006681 | Ga0070691_100066812 | 351 |
| 78 | 3300005343 | Ga0070687_100000348 | Ga0070687_10000034816 | 351 |
| 79 | 3300005344 | Ga0070661_100000017 | Ga0070661_100000017153 | 351 |
| 80 | 3300005345 | Ga0070692_10000101 | Ga0070692_1000010116 | 351 |
| 81 | 3300005347 | Ga0070668_100003604 | Ga0070668_10000360412 | 351 |
| 82 | 3300005347 | Ga0070668_100006939 | Ga0070668_1000069392 | 351 |
| 83 | 3300005347 | Ga0070668_100044014 | Ga0070668_1000440142 | 351 |
| 84 | 3300005347 | Ga0070668_100079031 | Ga0070668_1000790312 | 351 |
| 85 | 3300005347 | Ga0070668_100097123 | Ga0070668_1000971232 | 351 |
| 86 | 3300005353 | Ga0070669_100000314 | Ga0070669_10000031427 | 351 |
| 87 | 3300005353 | Ga0070669_100134363 | Ga0070669_1001343632 | 351 |
| 88 | 3300005354 | Ga0070675_100000161 | Ga0070675_10000016127 | 351 |
| 89 | 3300005354 | Ga0070675_100219713 | Ga0070675_1002197132 | 351 |
| 90 | 3300005354 | Ga0070675_100307217 | Ga0070675_1003072172 | 351 |
| 91 | 3300005355 | Ga0070671_100000313 | Ga0070671_10000031326 | 351 |
| 92 | 3300005355 | Ga0070671_100009979 | Ga0070671_1000099794 | 351 |
| 93 | 3300005355 | Ga0070671_100128052 | Ga0070671_1001280522 | 351 |
| 94 | 3300005356 | Ga0070674_100001686 | Ga0070674_1000016867 | 351 |
| 95 | 3300005364 | Ga0070673_100000272 | Ga0070673_10000027227 | 351 |
| 96 | 3300005364 | Ga0070673_100081674 | Ga0070673_1000816741 | 351 |
| 97 | 3300005365 | Ga0070688_100000306 | Ga0070688_1000003062 | 351 |
| 98 | 3300005365 | Ga0070688_100000991 | Ga0070688_1000009912 | 351 |
| 99 | 3300005366 | Ga0070659_100000467 | Ga0070659_1000004673 | 351 |
| 100 | 3300005366 | Ga0070659_100007586 | Ga0070659_1000075862 | 351 |
| 101 | 3300005367 | Ga0070667_100012364 | Ga0070667_1000123647 | 351 |
| 102 | 3300005367 | Ga0070667_100024052 | Ga0070667_1000240526 | 351 |
| 103 | 3300005434 | Ga0070709_10173754 | Ga0070709_101737542 | 351 |
| 104 | 3300005435 | Ga0070714_100009580 | Ga0070714_1000095802 | 351 |
| 105 | 3300005435 | Ga0070714_100014952 | Ga0070714_1000149526 | 351 |
| 106 | 3300005436 | Ga0070713_100000371 | Ga0070713_10000037124 | 351 |
| 107 | 3300005438 | Ga0070701_10000204 | Ga0070701_1000020423 | 351 |
| 108 | 3300005441 | Ga0070700_100000856 | Ga0070700_10000085616 | 351 |
| 109 | 3300005444 | Ga0070694_100002279 | Ga0070694_1000022799 | 351 |
| 110 | 3300005444 | Ga0070694_100070271 | Ga0070694_1000702712 | 351 |
| 111 | 3300005455 | Ga0070663_100000945 | Ga0070663_10000094516 | 351 |
| 112 | 3300005456 | Ga0070678_100314752 | Ga0070678_1003147522 | 351 |
| 113 | 3300005457 | Ga0070662_100003593 | Ga0070662_1000035937 | 351 |
| 114 | 3300005458 | Ga0070681_10009252 | Ga0070681_100092527 | 351 |
| 115 | 3300005458 | Ga0070681_10041263 | Ga0070681_100412631 | 351 |
| 116 | 3300005458 | Ga0070681_10049176 | Ga0070681_100491764 | 351 |
| 117 | 3300005458 | Ga0070681_10264052 | Ga0070681_102640522 | 351 |
| 118 | 3300005459 | Ga0068867_100151199 | Ga0068867_1001511992 | 351 |
| 119 | 3300005466 | Ga0070685_10031229 | Ga0070685_100312292 | 351 |
| 120 | 3300005530 | Ga0070679_100002050 | Ga0070679_10000205013 | 351 |
| 121 | 3300005530 | Ga0070679_100013603 | Ga0070679_1000136032 | 351 |
| 122 | 3300005530 | Ga0070679_100100453 | Ga0070679_1001004532 | 351 |
| 123 | 3300005530 | Ga0070679_100228746 | Ga0070679_1002287462 | 351 |
| 124 | 3300005530 | Ga0070679_100238982 | Ga0070679_1002389822 | 351 |
| 125 | 3300005535 | Ga0070684_100000365 | Ga0070684_10000036520 | 351 |
| 126 | 3300005535 | Ga0070684_100035412 | Ga0070684_1000354123 | 351 |
| 127 | 3300005539 | Ga0068853_100000523 | Ga0068853_10000052324 | 351 |
| 128 | 3300005543 | Ga0070672_100000709 | Ga0070672_10000070911 | 351 |
| 129 | 3300005544 | Ga0070686_100000455 | Ga0070686_1000004552 | 351 |
| 130 | 3300005545 | Ga0070695_100001044 | Ga0070695_1000010444 | 351 |
| 131 | 3300005546 | Ga0070696_100021689 | Ga0070696_1000216893 | 351 |
| 132 | 3300005546 | Ga0070696_100237412 | Ga0070696_1002374121 | 351 |
| 133 | 3300005547 | Ga0070693_100000905 | Ga0070693_1000009052 | 351 |
| 134 | 3300005547 | Ga0070693_100060132 | Ga0070693_1000601322 | 351 |
| 135 | 3300005548 | Ga0070665_100000327 | Ga0070665_10000032782 | 351 |
| 136 | 3300005548 | Ga0070665_100052141 | Ga0070665_1000521412 | 351 |
| 137 | 3300005548 | Ga0070665_100109298 | Ga0070665_1001092982 | 351 |
| 138 | 3300005548 | Ga0070665_100140598 | Ga0070665_1001405982 | 351 |
| 139 | 3300005549 | Ga0070704_100000197 | Ga0070704_10000019727 | 351 |
| 140 | 3300005563 | Ga0068855_100040932 | Ga0068855_1000409322 | 351 |
| 141 | 3300005563 | Ga0068855_100079840 | Ga0068855_1000798402 | 351 |
| 142 | 3300005563 | Ga0068855_100098430 | Ga0068855_1000984302 | 351 |
| 143 | 3300005563 | Ga0068855_100099582 | Ga0068855_1000995822 | 351 |
| 144 | 3300005563 | Ga0068855_100643262 | Ga0068855_1006432621 | 351 |
| 145 | 3300005564 | Ga0070664_100002074 | Ga0070664_10000207419 | 351 |
| 146 | 3300005577 | Ga0068857_100000921 | Ga0068857_1000009212 | 351 |
| 147 | 3300005577 | Ga0068857_100024980 | Ga0068857_1000249803 | 351 |
| 148 | 3300005578 | Ga0068854_100000749 | Ga0068854_10000074916 | 351 |
| 149 | 3300005578 | Ga0068854_100019836 | Ga0068854_1000198365 | 351 |
| 150 | 3300005614 | Ga0068856_100000902 | Ga0068856_10000090217 | 351 |
| 151 | 3300005614 | Ga0068856_100253827 | Ga0068856_1002538272 | 351 |
| 152 | 3300005615 | Ga0070702_100002928 | Ga0070702_1000029282 | 351 |
| 153 | 3300005615 | Ga0070702_100164471 | Ga0070702_1001644712 | 351 |
| 154 | 3300005616 | Ga0068852_100015241 | Ga0068852_1000152416 | 351 |
| 155 | 3300005616 | Ga0068852_100110867 | Ga0068852_1001108673 | 351 |
| 156 | 3300005617 | Ga0068859_100004450 | Ga0068859_1000044507 | 351 |
| 157 | 3300005617 | Ga0068859_100008773 | Ga0068859_1000087736 | 351 |
| 158 | 3300005617 | Ga0068859_100089758 | Ga0068859_1000897582 | 351 |
| 159 | 3300005618 | Ga0068864_100049073 | Ga0068864_1000490731 | 351 |
| 160 | 3300005718 | Ga0068866_10002012 | Ga0068866_100020129 | 351 |
| 161 | 3300005719 | Ga0068861_100000825 | Ga0068861_10000082516 | 351 |
| 162 | 3300005840 | Ga0068870_10000112 | Ga0068870_1000011213 | 351 |
| 163 | 3300005841 | Ga0068863_100000703 | Ga0068863_10000070312 | 351 |
| 164 | 3300005841 | Ga0068863_100023806 | Ga0068863_1000238063 | 351 |
| 165 | 3300005842 | Ga0068858_100008283 | Ga0068858_1000082835 | 351 |
| 166 | 3300005842 | Ga0068858_100019588 | Ga0068858_1000195882 | 351 |
| 167 | 3300005843 | Ga0068860_100000165 | Ga0068860_10000016513 | 351 |
| 168 | 3300005843 | Ga0068860_100006736 | Ga0068860_1000067362 | 351 |
| 169 | 3300005843 | Ga0068860_100049862 | Ga0068860_1000498622 | 351 |
| 170 | 3300005843 | Ga0068860_100051115 | Ga0068860_1000511152 | 351 |
| 171 | 3300005843 | Ga0068860_100120534 | Ga0068860_1001205342 | 351 |
| 172 | 3300005844 | Ga0068862_100006290 | Ga0068862_1000062904 | 351 |
| 173 | 3300005844 | Ga0068862_100100949 | Ga0068862_1001009492 | 351 |
| 174 | 3300005937 | Ga0081455_10011886 | Ga0081455_100118861 | 351 |
| 175 | 3300005983 | Ga0081540_1010346 | Ga0081540_10103465 | 351 |
| 176 | 3300005983 | Ga0081540_1014849 | Ga0081540_10148493 | 351 |
| 177 | 3300005983 | Ga0081540_1033560 | Ga0081540_10335603 | 351 |
| 178 | 3300005983 | Ga0081540_1083756 | Ga0081540_10837562 | 351 |
| 179 | 3300006042 | Ga0075368_10024712 | Ga0075368_100247123 | 351 |
| 180 | 3300006048 | Ga0075363_100114362 | Ga0075363_1001143622 | 351 |
| 181 | 3300006051 | Ga0075364_10057532 | Ga0075364_100575322 | 351 |
| 182 | 3300006051 | Ga0075364_10145686 | Ga0075364_101456862 | 351 |
| 183 | 3300006173 | Ga0070716_100117379 | Ga0070716_1001173792 | 351 |
| 184 | 3300006177 | Ga0075362_10036225 | Ga0075362_100362253 | 351 |
| 185 | 3300006186 | Ga0075369_10015948 | Ga0075369_100159482 | 351 |
| 186 | 3300006195 | Ga0075366_10049965 | Ga0075366_100499652 | 351 |
| 187 | 3300006237 | Ga0097621_100000473 | Ga0097621_10000047327 | 351 |
| 188 | 3300006237 | Ga0097621_100025204 | Ga0097621_1000252043 | 351 |
| 189 | 3300006353 | Ga0075370_10068039 | Ga0075370_100680392 | 351 |
| 190 | 3300006358 | Ga0068871_100000118 | Ga0068871_10000011837 | 351 |
| 191 | 3300006358 | Ga0068871_100016676 | Ga0068871_1000166763 | 351 |
| 192 | 3300006358 | Ga0068871_100389850 | Ga0068871_1003898502 | 351 |
| 193 | 3300006844 | Ga0075428_100208791 | Ga0075428_1002087913 | 351 |
| 194 | 3300006846 | Ga0075430_100033350 | Ga0075430_1000333503 | 351 |
| 195 | 3300006847 | Ga0075431_100212332 | Ga0075431_1002123322 | 351 |
| 196 | 3300006847 | Ga0075431_100263706 | Ga0075431_1002637062 | 351 |
| 197 | 3300006871 | Ga0075434_100013398 | Ga0075434_1000133983 | 351 |
| 198 | 3300006871 | Ga0075434_100434097 | Ga0075434_1004340971 | 351 |
| 199 | 3300006931 | Ga0097620_100004450 | Ga0097620_1000044507 | 351 |
| 200 | 3300006931 | Ga0097620_100008773 | Ga0097620_1000087736 | 351 |
| 201 | 3300006931 | Ga0097620_100089759 | Ga0097620_1000897592 | 351 |
| 202 | 3300009093 | Ga0105240_10022758 | Ga0105240_100227583 | 351 |
| 203 | 3300009093 | Ga0105240_10064698 | Ga0105240_100646982 | 351 |
| 204 | 3300009094 | Ga0111539_10001167 | Ga0111539_1000116725 | 351 |
| 205 | 3300009094 | Ga0111539_10004804 | Ga0111539_100048044 | 351 |
| 206 | 3300009098 | Ga0105245_10001982 | Ga0105245_100019822 | 351 |
| 207 | 3300009098 | Ga0105245_10021615 | Ga0105245_100216157 | 351 |
| 208 | 3300009147 | Ga0114129_10015418 | Ga0114129_1001541810 | 351 |
| 209 | 3300009147 | Ga0114129_10180395 | Ga0114129_101803954 | 351 |
| 210 | 3300009148 | Ga0105243_10002278 | Ga0105243_1000227816 | 351 |
| 211 | 3300009148 | Ga0105243_10054499 | Ga0105243_100544992 | 351 |
| 212 | 3300009174 | Ga0105241_10003555 | Ga0105241_100035552 | 351 |
| 213 | 3300009176 | Ga0105242_10001156 | Ga0105242_1000115610 | 351 |
| 214 | 3300009177 | Ga0105248_10002414 | Ga0105248_1000241411 | 351 |
| 215 | 3300009177 | Ga0105248_10010454 | Ga0105248_100104542 | 351 |
| 216 | 3300009177 | Ga0105248_10414399 | Ga0105248_104143992 | 351 |
| 217 | 3300009551 | Ga0105238_10028630 | Ga0105238_100286303 | 351 |
| 218 | 3300009553 | Ga0105249_10001021 | Ga0105249_1000102110 | 351 |
| 219 | 3300009553 | Ga0105249_10006960 | Ga0105249_1000696010 | 351 |
| 220 | 3300010159 | Ga0099796_10018054 | Ga0099796_100180542 | 351 |
| 221 | 3300010375 | Ga0105239_10008950 | Ga0105239_100089507 | 351 |
| 222 | 3300010375 | Ga0105239_10038202 | Ga0105239_100382022 | 351 |
| 223 | 3300011119 | Ga0105246_10003701 | Ga0105246_100037015 | 351 |
| 224 | 3300012513 | Ga0157326_1000541 | Ga0157326_10005415 | 351 |
| 225 | 3300013100 | Ga0157373_10005579 | Ga0157373_100055795 | 351 |
| 226 | 3300013100 | Ga0157373_10006895 | Ga0157373_100068953 | 351 |
| 227 | 3300013100 | Ga0157373_10162181 | Ga0157373_101621812 | 351 |
| 228 | 3300013102 | Ga0157371_10016850 | Ga0157371_100168504 | 351 |
| 229 | 3300013102 | Ga0157371_10131676 | Ga0157371_101316762 | 351 |
| 230 | 3300013105 | Ga0157369_10521336 | Ga0157369_105213361 | 351 |
| 231 | 3300013296 | Ga0157374_10015941 | Ga0157374_100159412 | 351 |
| 232 | 3300013297 | Ga0157378_10002986 | Ga0157378_1000298612 | 351 |
| 233 | 3300013297 | Ga0157378_10375921 | Ga0157378_103759212 | 351 |
| 234 | 3300013306 | Ga0163162_10009522 | Ga0163162_100095227 | 351 |
| 235 | 3300013307 | Ga0157372_10008348 | Ga0157372_1000834812 | 351 |
| 236 | 3300013308 | Ga0157375_10000508 | Ga0157375_1000050812 | 351 |
| 237 | 3300013308 | Ga0157375_10053915 | Ga0157375_100539152 | 351 |
| 238 | 3300014325 | Ga0163163_10082125 | Ga0163163_100821252 | 351 |
| 239 | 3300014326 | Ga0157380_10000212 | Ga0157380_1000021225 | 351 |
| 240 | 3300014745 | Ga0157377_10000287 | Ga0157377_1000028716 | 351 |
| 241 | 3300014968 | Ga0157379_10008690 | Ga0157379_100086902 | 351 |
| 242 | 3300014968 | Ga0157379_10046080 | Ga0157379_100460802 | 351 |
| 243 | 3300014969 | Ga0157376_10004642 | Ga0157376_100046425 | 351 |
| 244 | 3300014969 | Ga0157376_10016040 | Ga0157376_100160402 | 351 |
| 245 | 3300017792 | Ga0163161_10000415 | Ga0163161_1000041532 | 351 |
| 246 | 3300025242 | Ga0209258_100123 | Ga0209258_10012375 | 351 |
| 247 | 3300025250 | Ga0209026_1005744 | Ga0209026_10057444 | 351 |
| 248 | 3300025256 | Ga0209759_1001598 | Ga0209759_10015983 | 351 |
| 249 | 3300025261 | Ga0209233_1009332 | Ga0209233_10093323 | 351 |
| 250 | 3300025271 | Ga0207666_1000073 | Ga0207666_10000733 | 351 |
| 251 | 3300025272 | Ga0209455_1000115 | Ga0209455_100011575 | 351 |
| 252 | 3300025290 | Ga0207673_1000295 | Ga0207673_10002955 | 351 |
| 253 | 3300025297 | Ga0209758_1003089 | Ga0209758_100308911 | 351 |
| 254 | 3300025298 | Ga0209050_1000431 | Ga0209050_100043147 | 351 |
| 255 | 3300025304 | Ga0209257_1000572 | Ga0209257_100057224 | 351 |
| 256 | 3300025304 | Ga0209257_1001182 | Ga0209257_100118226 | 351 |
| 257 | 3300025315 | Ga0207697_10000061 | Ga0207697_1000006138 | 351 |
| 258 | 3300025315 | Ga0207697_10005956 | Ga0207697_100059563 | 351 |
| 259 | 3300025885 | Ga0207653_10005338 | Ga0207653_100053383 | 351 |
| 260 | 3300025893 | Ga0207682_10002961 | Ga0207682_100029613 | 351 |
| 261 | 3300025898 | Ga0207692_10150929 | Ga0207692_101509291 | 351 |
| 262 | 3300025899 | Ga0207642_10001238 | Ga0207642_100012388 | 351 |
| 263 | 3300025901 | Ga0207688_10000001 | Ga0207688_1000000195 | 351 |
| 264 | 3300025901 | Ga0207688_10015574 | Ga0207688_100155742 | 351 |
| 265 | 3300025905 | Ga0207685_10037419 | Ga0207685_100374192 | 351 |
| 266 | 3300025907 | Ga0207645_10000222 | Ga0207645_1000022228 | 351 |
| 267 | 3300025908 | Ga0207643_10000009 | Ga0207643_1000000942 | 351 |
| 268 | 3300025909 | Ga0207705_10019295 | Ga0207705_100192951 | 351 |
| 269 | 3300025909 | Ga0207705_10054591 | Ga0207705_100545912 | 351 |
| 270 | 3300025909 | Ga0207705_10086233 | Ga0207705_100862331 | 351 |
| 271 | 3300025911 | Ga0207654_10001390 | Ga0207654_1000139013 | 351 |
| 272 | 3300025912 | Ga0207707_10004174 | Ga0207707_1000417412 | 351 |
| 273 | 3300025912 | Ga0207707_10007205 | Ga0207707_100072052 | 351 |
| 274 | 3300025912 | Ga0207707_10139243 | Ga0207707_101392432 | 351 |
| 275 | 3300025912 | Ga0207707_10317028 | Ga0207707_103170281 | 351 |
| 276 | 3300025913 | Ga0207695_10002836 | Ga0207695_1000283617 | 351 |
| 277 | 3300025913 | Ga0207695_10003652 | Ga0207695_100036522 | 351 |
| 278 | 3300025913 | Ga0207695_10037195 | Ga0207695_100371954 | 351 |
| 279 | 3300025913 | Ga0207695_10041473 | Ga0207695_100414736 | 351 |
| 280 | 3300025914 | Ga0207671_10033935 | Ga0207671_100339352 | 351 |
| 281 | 3300025917 | Ga0207660_10000197 | Ga0207660_1000019710 | 351 |
| 282 | 3300025917 | Ga0207660_10056050 | Ga0207660_100560502 | 351 |
| 283 | 3300025919 | Ga0207657_10000776 | Ga0207657_1000077626 | 351 |
| 284 | 3300025919 | Ga0207657_10060873 | Ga0207657_100608732 | 351 |
| 285 | 3300025920 | Ga0207649_10000052 | Ga0207649_1000005288 | 351 |
| 286 | 3300025920 | Ga0207649_10271357 | Ga0207649_102713571 | 351 |
| 287 | 3300025921 | Ga0207652_10001438 | Ga0207652_1000143825 | 351 |
| 288 | 3300025921 | Ga0207652_10028531 | Ga0207652_100285312 | 351 |
| 289 | 3300025921 | Ga0207652_10041704 | Ga0207652_100417042 | 351 |
| 290 | 3300025921 | Ga0207652_10065597 | Ga0207652_100655972 | 351 |
| 291 | 3300025921 | Ga0207652_10096741 | Ga0207652_100967412 | 351 |
| 292 | 3300025921 | Ga0207652_10169340 | Ga0207652_101693402 | 351 |
| 293 | 3300025923 | Ga0207681_10000035 | Ga0207681_10000035165 | 351 |
| 294 | 3300025923 | Ga0207681_10307423 | Ga0207681_103074232 | 351 |
| 295 | 3300025924 | Ga0207694_10057865 | Ga0207694_100578652 | 351 |
| 296 | 3300025925 | Ga0207650_10006131 | Ga0207650_100061312 | 351 |
| 297 | 3300025925 | Ga0207650_10035460 | Ga0207650_100354601 | 351 |
| 298 | 3300025926 | Ga0207659_10000132 | Ga0207659_1000013226 | 351 |
| 299 | 3300025926 | Ga0207659_10093633 | Ga0207659_100936332 | 351 |
| 300 | 3300025927 | Ga0207687_10000174 | Ga0207687_1000017425 | 351 |
| 301 | 3300025927 | Ga0207687_10017776 | Ga0207687_100177761 | 351 |
| 302 | 3300025928 | Ga0207700_10000274 | Ga0207700_1000027423 | 351 |
| 303 | 3300025928 | Ga0207700_10118585 | Ga0207700_101185852 | 351 |
| 304 | 3300025929 | Ga0207664_10007717 | Ga0207664_100077174 | 351 |
| 305 | 3300025931 | Ga0207644_10000212 | Ga0207644_1000021210 | 351 |
| 306 | 3300025931 | Ga0207644_10016349 | Ga0207644_100163492 | 351 |
| 307 | 3300025931 | Ga0207644_10098037 | Ga0207644_100980372 | 351 |
| 308 | 3300025932 | Ga0207690_10000148 | Ga0207690_1000014852 | 351 |
| 309 | 3300025932 | Ga0207690_10000294 | Ga0207690_100002942 | 351 |
| 310 | 3300025933 | Ga0207706_10001360 | Ga0207706_1000136012 | 351 |
| 311 | 3300025933 | Ga0207706_10025201 | Ga0207706_100252012 | 351 |
| 312 | 3300025933 | Ga0207706_10144799 | Ga0207706_101447992 | 351 |
| 313 | 3300025935 | Ga0207709_10000530 | Ga0207709_100005305 | 351 |
| 314 | 3300025936 | Ga0207670_10000523 | Ga0207670_1000052326 | 351 |
| 315 | 3300025936 | Ga0207670_10317815 | Ga0207670_103178151 | 351 |
| 316 | 3300025937 | Ga0207669_10000857 | Ga0207669_100008579 | 351 |
| 317 | 3300025938 | Ga0207704_10000198 | Ga0207704_1000019841 | 351 |
| 318 | 3300025940 | Ga0207691_10000517 | Ga0207691_1000051716 | 351 |
| 319 | 3300025940 | Ga0207691_10076224 | Ga0207691_100762242 | 351 |
| 320 | 3300025940 | Ga0207691_10252651 | Ga0207691_102526512 | 351 |
| 321 | 3300025941 | Ga0207711_10008997 | Ga0207711_100089973 | 351 |
| 322 | 3300025941 | Ga0207711_10041446 | Ga0207711_100414462 | 351 |
| 323 | 3300025941 | Ga0207711_10311697 | Ga0207711_103116971 | 351 |
| 324 | 3300025942 | Ga0207689_10000031 | Ga0207689_1000003174 | 351 |
| 325 | 3300025944 | Ga0207661_10001089 | Ga0207661_1000108919 | 351 |
| 326 | 3300025944 | Ga0207661_10094772 | Ga0207661_100947722 | 351 |
| 327 | 3300025945 | Ga0207679_10000183 | Ga0207679_1000018323 | 351 |
| 328 | 3300025949 | Ga0207667_10057690 | Ga0207667_100576904 | 351 |
| 329 | 3300025949 | Ga0207667_10458292 | Ga0207667_104582921 | 351 |
| 330 | 3300025960 | Ga0207651_10000051 | Ga0207651_1000005143 | 351 |
| 331 | 3300025960 | Ga0207651_10155404 | Ga0207651_101554042 | 351 |
| 332 | 3300025961 | Ga0207712_10000738 | Ga0207712_1000073810 | 351 |
| 333 | 3300025961 | Ga0207712_10056531 | Ga0207712_100565313 | 351 |
| 334 | 3300025972 | Ga0207668_10000664 | Ga0207668_1000066425 | 351 |
| 335 | 3300025972 | Ga0207668_10009551 | Ga0207668_100095514 | 351 |
| 336 | 3300025972 | Ga0207668_10078238 | Ga0207668_100782382 | 351 |
| 337 | 3300025981 | Ga0207640_10002152 | Ga0207640_100021526 | 351 |
| 338 | 3300025986 | Ga0207658_10016338 | Ga0207658_100163382 | 351 |
| 339 | 3300026023 | Ga0207677_10075252 | Ga0207677_100752523 | 351 |
| 340 | 3300026035 | Ga0207703_10279307 | Ga0207703_102793072 | 351 |
| 341 | 3300026035 | Ga0207703_10321818 | Ga0207703_103218182 | 351 |
| 342 | 3300026041 | Ga0207639_10001257 | Ga0207639_100012575 | 351 |
| 343 | 3300026067 | Ga0207678_10000531 | Ga0207678_1000053112 | 351 |
| 344 | 3300026075 | Ga0207708_10000573 | Ga0207708_100005737 | 351 |
| 345 | 3300026075 | Ga0207708_10006283 | Ga0207708_100062835 | 351 |
| 346 | 3300026078 | Ga0207702_10003284 | Ga0207702_1000328416 | 351 |
| 347 | 3300026088 | Ga0207641_10001041 | Ga0207641_100010415 | 351 |
| 348 | 3300026089 | Ga0207648_10000581 | Ga0207648_1000058126 | 351 |
| 349 | 3300026095 | Ga0207676_10000124 | Ga0207676_1000012440 | 351 |
| 350 | 3300026095 | Ga0207676_10033074 | Ga0207676_100330743 | 351 |
| 351 | 3300026116 | Ga0207674_10000095 | Ga0207674_1000009512 | 351 |
| 352 | 3300026116 | Ga0207674_10032833 | Ga0207674_100328333 | 351 |
| 353 | 3300026118 | Ga0207675_100000414 | Ga0207675_10000041426 | 351 |
| 354 | 3300026118 | Ga0207675_100149414 | Ga0207675_1001494142 | 351 |
| 355 | 3300026121 | Ga0207683_10000242 | Ga0207683_1000024237 | 351 |
| 356 | 3300026142 | Ga0207698_10000951 | Ga0207698_100009513 | 351 |
| 357 | 3300026142 | Ga0207698_10473032 | Ga0207698_104730322 | 351 |
| 358 | 3300027378 | Ga0209981_1001280 | Ga0209981_10012803 | 351 |
| 359 | 3300027462 | Ga0210000_1001323 | Ga0210000_10013232 | 351 |
| 360 | 3300027543 | Ga0209999_1004075 | Ga0209999_10040752 | 351 |
| 361 | 3300027543 | Ga0209999_1008573 | Ga0209999_10085732 | 351 |
| 362 | 3300027552 | Ga0209982_1006315 | Ga0209982_10063152 | 351 |
| 363 | 3300027617 | Ga0210002_1001450 | Ga0210002_10014502 | 351 |
| 364 | 3300027665 | Ga0209983_1001668 | Ga0209983_10016684 | 351 |
| 365 | 3300027682 | Ga0209971_1004583 | Ga0209971_10045832 | 351 |
| 366 | 3300027695 | Ga0209966_1001052 | Ga0209966_10010522 | 351 |
| 367 | 3300027876 | Ga0209974_10001326 | Ga0209974_100013266 | 351 |
| 368 | 3300027876 | Ga0209974_10006235 | Ga0209974_100062355 | 351 |
| 369 | 3300027907 | Ga0207428_10000037 | Ga0207428_10000037189 | 351 |
| 370 | 3300027907 | Ga0207428_10001773 | Ga0207428_1000177314 | 351 |
| 371 | 3300028379 | Ga0268266_10000064 | Ga0268266_1000006426 | 351 |
| 372 | 3300028379 | Ga0268266_10050497 | Ga0268266_100504973 | 351 |
| 373 | 3300028379 | Ga0268266_10071783 | Ga0268266_100717832 | 351 |
| 374 | 3300028379 | Ga0268266_10076065 | Ga0268266_100760652 | 351 |
| 375 | 3300028380 | Ga0268265_10000757 | Ga0268265_100007576 | 351 |
| 376 | 3300028380 | Ga0268265_10010381 | Ga0268265_100103817 | 351 |
| 377 | 3300028380 | Ga0268265_10012546 | Ga0268265_100125462 | 351 |
| 378 | 3300028380 | Ga0268265_10101042 | Ga0268265_101010422 | 351 |
| 379 | 3300028381 | Ga0268264_10000021 | Ga0268264_10000021117 | 351 |
| 380 | 3300028381 | Ga0268264_10002331 | Ga0268264_100023313 | 351 |
| 381 | 3300028381 | Ga0268264_10012005 | Ga0268264_100120056 | 351 |
| 382 | 3300028666 | Ga0265336_10000048 | Ga0265336_1000004845 | 351 |
| 383 | 3300028786 | Ga0307517_10004666 | Ga0307517_100046665 | 351 |
| 384 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020272 | 351 |
| 385 | 3300029957 | Ga0265324_10003288 | Ga0265324_100032884 | 351 |
| 386 | 3300030521 | Ga0307511_10061552 | Ga0307511_100615523 | 351 |
| 387 | 3300031235 | Ga0265330_10068397 | Ga0265330_100683971 | 351 |
| 388 | 3300031241 | Ga0265325_10024100 | Ga0265325_100241002 | 351 |
| 389 | 3300031249 | Ga0265339_10002224 | Ga0265339_100022246 | 351 |
| 390 | 3300031251 | Ga0265327_10077631 | Ga0265327_100776312 | 351 |
| 391 | 3300031456 | Ga0307513_10001560 | Ga0307513_1000156023 | 351 |
| 392 | 3300031456 | Ga0307513_10025455 | Ga0307513_100254552 | 351 |
| 393 | 3300031548 | Ga0307408_100098197 | Ga0307408_1000981972 | 351 |
| 394 | 3300031595 | Ga0265313_10000098 | Ga0265313_1000009894 | 351 |
| 395 | 3300031712 | Ga0265342_10099615 | Ga0265342_100996152 | 351 |
| 396 | 3300031712 | Ga0265342_10134189 | Ga0265342_101341892 | 351 |
| 397 | 3300031730 | Ga0307516_10003023 | Ga0307516_100030236 | 351 |
| 398 | 3300033179 | Ga0307507_10128569 | Ga0307507_101285692 | 351 |
| 399 | 3300033180 | Ga0307510_10026020 | Ga0307510_100260203 | 351 |
| 400 | 3300034816 | Ga0373930_0000371 | Ga0373930_0000371_3887_4942 | 351 |
| 401 | 3300034817 | Ga0373948_0000135 | Ga0373948_0000135_4553_5608 | 351 |
| 402 | 3300034818 | Ga0373950_0000327 | Ga0373950_0000327_3600_4655 | 351 |
| 403 | 3300034819 | Ga0373958_0000084 | Ga0373958_0000084_1759_2814 | 351 |
| 404 | 3300034957 | Ga0373938_0000013 | Ga0373938_0000013_18694_19749 | 351 |
| 405 | 3300035084 | Ga0373928_0001053 | Ga0373928_0001053_1166_2221 | 351 |
| 406 | 3300035085 | Ga0373929_0002957 | Ga0373929_0002957_271_1326 | 351 |
| 407 | 3300035088 | Ga0373940_0002191 | Ga0373940_0002191_2175_3230 | 351 |
| 408 | 3300035090 | Ga0373949_0001274 | Ga0373949_0001274_6018_7073 | 351 |
| 409 | 3300035091 | Ga0373951_0006039 | Ga0373951_0006039_1337_2392 | 351 |
| 410 | 3300035092 | Ga0373952_0000880 | Ga0373952_0000880_96_1151 | 351 |
| 411 | 3300035112 | Ga0373932_0000427 | Ga0373932_0000427_737_1792 | 351 |
| 412 | 3300035112 | Ga0373932_0001840 | Ga0373932_0001840_4160_5215 | 351 |
| 413 | 3300035113 | Ga0373936_0005812 | Ga0373936_0005812_772_1827 | 351 |
| 414 | 3300035114 | Ga0373939_0000704 | Ga0373939_0000704_6256_7311 | 351 |
| 415 | 3300035121 | Ga0373960_0000570 | Ga0373960_0000570_6032_7087 | 351 |
| 416 | 3300035207 | Ga0373942_0000725 | Ga0373942_0000725_271_1326 | 351 |
| 417 | 3300035242 | Ga0373962_0000542 | Ga0373962_0000542_2056_3111 | 351 |
| 418 | 3300035242 | Ga0373962_0000610 | Ga0373962_0000610_5928_6983 | 351 |
| 419 | 3300035691 | Ga0373931_0002178 | Ga0373931_0002178_5102_6157 | 351 |
| 420 | 3300035691 | Ga0373931_0046588 | Ga0373931_0046588_737_1792 | 351 |
| 421 | 3300035695 | Ga0373927_0073950 | Ga0373927_0073950_600_1655 | 351 |
| 422 | 3300035695 | Ga0373927_0106094 | Ga0373927_0106094_390_1445 | 351 |
| 423 | 3300035695 | Ga0373927_0163754 | Ga0373927_0163754_45_1100 | 351 |
| 424 | 3300037068 | Ga0373925_0263357 | Ga0373925_0263357_210_1265 | 351 |
| 425 | 3300037312 | Ga0395899_0005491 | Ga0395899_0005491_1914_2969 | 351 |
| 426 | 3300037312 | Ga0395899_0037648 | Ga0395899_0037648_1274_2329 | 351 |
| 427 | 3300037418 | Ga0395900_0004219 | Ga0395900_0004219_12196_13251 | 351 |
| 428 | 3300037418 | Ga0395900_0017348 | Ga0395900_0017348_1902_2957 | 351 |
| 429 | 3300037418 | Ga0395900_0160111 | Ga0395900_0160111_75_1130 | 351 |
| 430 | 3300037418 | Ga0395900_0202164 | Ga0395900_0202164_806_1861 | 351 |
| 431 | 3300037418 | Ga0395900_0316748 | Ga0395900_0316748_32_1087 | 351 |
| 432 | 3300037466 | Ga0395898_0014233 | Ga0395898_0014233_2707_3762 | 351 |
| 433 | 3300037466 | Ga0395898_0015013 | Ga0395898_0015013_2137_3192 | 351 |
| 434 | 3300037466 | Ga0395898_0022197 | Ga0395898_0022197_556_1611 | 351 |
| 435 | 3300037466 | Ga0395898_0352416 | Ga0395898_0352416_200_1255 | 351 |
| 436 | 3300037471 | Ga0395905_0000983 | Ga0395905_0000983_20612_21667 | 351 |
| 437 | 3300038443 | Ga0395901_0022367 | Ga0395901_0022367_3556_4611 | 351 |
| 438 | 3300038443 | Ga0395901_0088277 | Ga0395901_0088277_832_1887 | 351 |
| 439 | 3300038443 | Ga0395901_0130825 | Ga0395901_0130825_683_1738 | 351 |
| 440 | 3300038443 | Ga0395901_0242258 | Ga0395901_0242258_202_1257 | 351 |
| 441 | 3300039437 | Ga0436365_0677869 | Ga0436365_0677869_100_1155 | 351 |
| 442 | 3300039437 | Ga0436365_1378731 | Ga0436365_1378731_101_1156 | 351 |
| 443 | 3300039438 | Ga0436360_0898381 | Ga0436360_0898381_341_1396 | 351 |
| 444 | 3300039438 | Ga0436360_1266199 | Ga0436360_1266199_48_1103 | 351 |
| 445 | 3300039447 | Ga0436361_0180569 | Ga0436361_0180569_1089_2144 | 351 |
| 446 | 3300042876 | Ga0451577_0004901 | Ga0451577_0004901_9476_10531 | 351 |
| 447 | 3300042876 | Ga0451577_0057580 | Ga0451577_0057580_526_1581 | 351 |
| 448 | 3300042876 | Ga0451577_0068162 | Ga0451577_0068162_737_1792 | 351 |
| 449 | 3300042876 | Ga0451577_0146502 | Ga0451577_0146502_527_1582 | 351 |
| 450 | 3300044673 | Ga0453683_0013725 | Ga0453683_0013725_1509_2564 | 351 |
| 451 | 3300044673 | Ga0453683_0048258 | Ga0453683_0048258_620_1675 | 351 |
| 452 | 3300044684 | Ga0466966_0051914 | Ga0466966_0051914_824_1879 | 351 |
| 453 | 3300044694 | Ga0466963_0043929 | Ga0466963_0043929_1289_2344 | 351 |
| 454 | 3300044712 | Ga0453684_0014814 | Ga0453684_0014814_3575_4630 | 351 |
| 455 | 3300044842 | Ga0466957_0188578 | Ga0466957_0188578_147_1202 | 351 |
| 456 | 3300045051 | Ga0451576_0006125 | Ga0451576_0006125_2243_3298 | 351 |
| 457 | 3300045051 | Ga0451576_0024532 | Ga0451576_0024532_1230_2285 | 351 |
| 458 | 3300045051 | Ga0451576_0177053 | Ga0451576_0177053_589_1644 | 351 |
| 459 | 3300045976 | Ga0466967_0003577 | Ga0466967_0003577_9068_10123 | 351 |
| 460 | 3300046455 | Ga0495603_0097030 | Ga0495603_0097030_85_1140 | 351 |
| 461 | 3300046460 | Ga0495638_0159912 | Ga0495638_0159912_148_1203 | 351 |
| 462 | 3300046460 | Ga0495638_0164278 | Ga0495638_0164278_50_1105 | 351 |
| 463 | 3300046475 | Ga0495639_0003100 | Ga0495639_0003100_5463_6518 | 351 |
| 464 | 3300046506 | Ga0495583_0000062 | Ga0495583_0000062_38715_39770 | 351 |
| 465 | 3300046507 | Ga0495606_0001633 | Ga0495606_0001633_11804_12859 | 351 |
| 466 | 3300046520 | Ga0495637_0021073 | Ga0495637_0021073_1246_2301 | 351 |
| 467 | 3300046520 | Ga0495637_0060757 | Ga0495637_0060757_138_1193 | 351 |
| 468 | 3300046533 | Ga0495640_0007537 | Ga0495640_0007537_993_2048 | 351 |
| 469 | 3300046539 | Ga0495621_0030896 | Ga0495621_0030896_35_1090 | 351 |
| 470 | 3300046542 | Ga0495597_0037382 | Ga0495597_0037382_1004_2059 | 351 |
| 471 | 3300046616 | Ga0495668_0065197 | Ga0495668_0065197_415_1470 | 351 |
| 472 | 3300046642 | Ga0495634_0054248 | Ga0495634_0054248_1532_2587 | 351 |
| 473 | 3300046660 | Ga0495625_0007787 | Ga0495625_0007787_2407_3462 | 351 |
| 474 | 3300046660 | Ga0495625_0035033 | Ga0495625_0035033_24_1079 | 351 |
| 475 | 3300046664 | Ga0495659_0005240 | Ga0495659_0005240_1484_2539 | 351 |
| 476 | 3300046684 | Ga0495669_0000009 | Ga0495669_0000009_66440_67495 | 351 |
| 477 | 3300046694 | Ga0495649_0000247 | Ga0495649_0000247_38571_39626 | 351 |
| 478 | 3300046794 | Ga0495589_0003753 | Ga0495589_0003753_2200_3255 | 351 |
| 479 | 3300047319 | Ga0495674_0073619 | Ga0495674_0073619_1854_2909 | 351 |
| 480 | 3300047445 | Ga0495677_0069031 | Ga0495677_0069031_204_1259 | 351 |
| 481 | 3300047472 | Ga0495686_0000049 | Ga0495686_0000049_177711_178766 | 351 |
| 482 | 3300047472 | Ga0495686_0014246 | Ga0495686_0014246_2955_4010 | 351 |
| 483 | 3300048904 | Ga0496101_0000866 | Ga0496101_0000866_13464_14519 | 351 |
| 484 | 3300048905 | Ga0496102_0001833 | Ga0496102_0001833_14711_15766 | 351 |
| 485 | 3300048905 | Ga0496102_0246568 | Ga0496102_0246568_111_1166 | 351 |
| 486 | 3300048906 | Ga0496103_0001022 | Ga0496103_0001022_15272_16327 | 351 |
| 487 | 3300048910 | Ga0496107_0000118 | Ga0496107_0000118_688_1743 | 351 |
| 488 | 3300048911 | Ga0496108_0006961 | Ga0496108_0006961_6491_7546 | 351 |
| 489 | 3300048911 | Ga0496108_0077610 | Ga0496108_0077610_1204_2259 | 351 |
| 490 | 3300048912 | Ga0496109_0002269 | Ga0496109_0002269_1919_2974 | 351 |
| 491 | 3300048912 | Ga0496109_0042716 | Ga0496109_0042716_1000_2055 | 351 |
| 492 | 3300048913 | Ga0496110_0156665 | Ga0496110_0156665_205_1260 | 351 |
| 493 | 3300048915 | Ga0496112_0064319 | Ga0496112_0064319_867_1922 | 351 |
| 494 | 3300048915 | Ga0496112_0102359 | Ga0496112_0102359_415_1470 | 351 |
| 495 | 3300048916 | Ga0496113_0067850 | Ga0496113_0067850_486_1541 | 351 |
| 496 | 3300048917 | Ga0496114_0372423 | Ga0496114_0372423_196_1251 | 351 |
| 497 | 3300048918 | Ga0496115_0000967 | Ga0496115_0000967_14482_15537 | 351 |
| 498 | 3300048918 | Ga0496115_0106814 | Ga0496115_0106814_154_1209 | 351 |
| 499 | 3300049568 | Ga0501031_0222190 | Ga0501031_0222190_56_1111 | 351 |
| 500 | 3300049569 | Ga0501032_0054310 | Ga0501032_0054310_1476_2531 | 351 |
| 501 | 3300049570 | Ga0501033_0033776 | Ga0501033_0033776_341_1396 | 351 |
| 502 | 3300049571 | Ga0501034_0086892 | Ga0501034_0086892_865_1920 | 351 |
| 503 | 3300049574 | Ga0501038_0149809 | Ga0501038_0149809_134_1189 | 351 |
| 504 | 3300049574 | Ga0501038_0187603 | Ga0501038_0187603_74_1129 | 351 |
| 505 | 3300049575 | Ga0501039_0149854 | Ga0501039_0149854_14_1069 | 351 |
| 506 | 3300049579 | Ga0501043_0015687 | Ga0501043_0015687_953_2008 | 351 |
| 507 | 3300049581 | Ga0501047_0000729 | Ga0501047_0000729_29371_30426 | 351 |
| 508 | 3300049581 | Ga0501047_0012289 | Ga0501047_0012289_1630_2685 | 351 |
| 509 | 3300049581 | Ga0501047_0027647 | Ga0501047_0027647_2195_3250 | 351 |
| 510 | 3300049581 | Ga0501047_0106554 | Ga0501047_0106554_576_1631 | 351 |
| 511 | 3300049581 | Ga0501047_0109557 | Ga0501047_0109557_880_1935 | 351 |
| 512 | 3300049581 | Ga0501047_0350892 | Ga0501047_0350892_123_1178 | 351 |
| 513 | 3300049583 | Ga0501067_0065525 | Ga0501067_0065525_186_1241 | 351 |
| 514 | 3300049583 | Ga0501067_0088263 | Ga0501067_0088263_123_1178 | 351 |
| 515 | 3300049584 | Ga0501068_0021679 | Ga0501068_0021679_596_1651 | 351 |
| 516 | 3300049586 | Ga0501070_0039278 | Ga0501070_0039278_1439_2494 | 351 |
| 517 | 3300049586 | Ga0501070_0110901 | Ga0501070_0110901_134_1189 | 351 |
| 518 | 3300049588 | Ga0501072_0097662 | Ga0501072_0097662_994_2049 | 351 |
| 519 | 3300049589 | Ga0501073_0027102 | Ga0501073_0027102_1852_2907 | 351 |
| 520 | 3300049589 | Ga0501073_0091631 | Ga0501073_0091631_573_1628 | 351 |
| 521 | 3300049589 | Ga0501073_0155006 | Ga0501073_0155006_189_1244 | 351 |
| 522 | 3300049590 | Ga0501074_0190975 | Ga0501074_0190975_383_1438 | 351 |
| 523 | 3300049591 | Ga0501075_0114076 | Ga0501075_0114076_11_1066 | 351 |
| 524 | 3300049742 | Ga0501080_0129759 | Ga0501080_0129759_344_1399 | 351 |
| 525 | 3300049742 | Ga0501080_0156434 | Ga0501080_0156434_141_1196 | 351 |
| 526 | 3300049744 | Ga0501083_0014143 | Ga0501083_0014143_166_1221 | 351 |
| 527 | 3300049744 | Ga0501083_0088579 | Ga0501083_0088579_191_1246 | 351 |
| 528 | 3300049822 | Ga0501035_0001116 | Ga0501035_0001116_18532_19587 | 351 |
| 529 | 3300049822 | Ga0501035_0027156 | Ga0501035_0027156_2680_3735 | 351 |
| 530 | 3300049822 | Ga0501035_0087906 | Ga0501035_0087906_616_1671 | 351 |
| 531 | 3300049823 | Ga0501044_0000222 | Ga0501044_0000222_42768_43823 | 351 |
| 532 | 3300049823 | Ga0501044_0006838 | Ga0501044_0006838_8817_9872 | 351 |
| 533 | 3300049823 | Ga0501044_0066214 | Ga0501044_0066214_878_1933 | 351 |
| 534 | 3300050493 | nmdc:mga0k408_34689_c2 | nmdc:mga0k408_34689_c2_288_1343 | 351 |
| 535 | 3300050496 | nmdc:mga07m45_59399_c1 | nmdc:mga07m45_59399_c1_618_1673 | 351 |
| 536 | 3300050509 | nmdc:mga0qj67_151017_c1 | nmdc:mga0qj67_151017_c1_728_1783 | 351 |
| 537 | 3300050510 | nmdc:mga06r32_115174_c1 | nmdc:mga06r32_115174_c1_581_1636 | 351 |
| 538 | 3300050511 | nmdc:mga08y16_13712_c1 | nmdc:mga08y16_13712_c1_3388_4443 | 351 |
| 539 | 3300050511 | nmdc:mga08y16_333_c1 | nmdc:mga08y16_333_c1_18011_19066 | 351 |
| 540 | 3300050512 | nmdc:mga0n895_62_c1 | nmdc:mga0n895_62_c1_77_1132 | 351 |
| 541 | 3300050512 | nmdc:mga0n895_97850_c1 | nmdc:mga0n895_97850_c1_782_1837 | 351 |
| 542 | 3300053077 | Ga0495601_0011855 | Ga0495601_0011855_1095_2150 | 351 |
| 543 | 3300053084 | Ga0495595_0009473 | Ga0495595_0009473_684_1739 | 351 |
| 544 | 3300053085 | Ga0495619_0025558 | Ga0495619_0025558_1247_2302 | 351 |
| 545 | 3300053087 | Ga0500643_004921 | Ga0500643_004921_4437_5492 | 351 |
| 546 | 3300053088 | Ga0500644_0000282 | Ga0500644_0000282_14450_15505 | 351 |
| 547 | 3300053093 | Ga0500651_0001656 | Ga0500651_0001656_7336_8391 | 351 |
| 548 | 3300053096 | Ga0500641_0001396 | Ga0500641_0001396_910_1965 | 351 |
| 549 | 3300053096 | Ga0500641_0008896 | Ga0500641_0008896_656_1711 | 351 |
| 550 | 3300053096 | Ga0500641_0041561 | Ga0500641_0041561_459_1514 | 351 |
| 551 | 3300053108 | Ga0500562_011969 | Ga0500562_011969_793_1848 | 351 |
| 552 | 3300053117 | Ga0500593_032897 | Ga0500593_032897_909_1964 | 351 |
| 553 | 3300053118 | Ga0500594_0013276 | Ga0500594_0013276_463_1518 | 351 |
| 554 | 3300053119 | Ga0500595_000016 | Ga0500595_000016_131296_132351 | 351 |
| 555 | 3300053130 | Ga0500642_0010511 | Ga0500642_0010511_1637_2692 | 351 |
| 556 | 3300053131 | Ga0500652_000024 | Ga0500652_000024_90157_91212 | 351 |
| 557 | 3300053131 | Ga0500652_061781 | Ga0500652_061781_144_1199 | 351 |
| 558 | 3300053133 | Ga0500655_000102 | Ga0500655_000102_3880_4935 | 351 |
| 559 | 3300053148 | Ga0500590_000159 | Ga0500590_000159_5675_6730 | 351 |
| 560 | 3300053151 | Ga0500604_0012877 | Ga0500604_0012877_54_1109 | 351 |
| 561 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_588281_589336 | 351 |
| 562 | 3300053153 | Ga0500616_0012855 | Ga0500616_0012855_2329_3384 | 351 |
| 563 | 3300053153 | Ga0500616_0028109 | Ga0500616_0028109_1745_2800 | 351 |
| 564 | 3300053153 | Ga0500616_0092438 | Ga0500616_0092438_301_1356 | 351 |
| 565 | 3300053156 | Ga0500622_0006073 | Ga0500622_0006073_2995_4050 | 351 |
| 566 | 3300053158 | Ga0500627_0016976 | Ga0500627_0016976_546_1601 | 351 |
| 567 | 3300053724 | Ga0500570_000434 | Ga0500570_000434_5072_6127 | 351 |
| 568 | 3300053730 | Ga0500645_000033 | Ga0500645_000033_106024_107079 | 351 |
| 569 | 3300053730 | Ga0500645_000666 | Ga0500645_000666_18391_19446 | 351 |
| 570 | iso_pu_bacteria | 2513237098 | 2513676117 | 351 |
| 571 | iso_pu_bacteria | 2885383462 | 2885392142 | 351 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5b48-assembly1.cif.gz_D | 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai | 0.8404 | 41 | 214 |
| 5b47-assembly1.cif.gz_B-2 | 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex | 0.8043 | 34 | 221 |
| 6n2o-assembly1.cif.gz_D | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.7396 | 14 | 336 |
| 5b48-assembly1.cif.gz_B | 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai | 0.7176 | 31 | 335 |
| 6n2o-assembly1.cif.gz_D | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.7132 | 14 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58077_321_493_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6823 | 35 | 225 | 3.40.50.970 |
| af_Q2FZ04_70_219_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6698 | 90 | 237 | 3.40.50.970 |
| 3lq1A03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6673 | 39 | 214 | 3.40.50.970 |
| af_P08142_365_562_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6632 | 39 | 216 | 3.40.50.970 |
| af_Q58077_321_493_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.6618 | 35 | 225 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537U0L2-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.8303 | 1 | 351 |
GO:0016625
GO:0030976 GO:0044281 |
| AF-A0A537U0L2-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.8278 | 1 | 351 |
GO:0016625
GO:0030976 GO:0044281 |
| AF-A0A7Y5M726-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.8036 | 1 | 108 |
|
| AF-A0A3A5UYY8-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.8031 | 14 | 224 |
GO:0006082
GO:0016625 GO:0030976 GO:0044272 |
| AF-A0A7C3GBX4-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.7999 | 1 | 214 |
GO:0016625
GO:0030976 GO:0044281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar