F464944

General Info

Members Datasets Scaffolds Average Seq Length
571 310 1142 274

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10143499|Ga0105249_101434992
Length 309
Sequence VLRGGRIFSAPLIDDCLLHTGEKMIRFDYQEPTTLKKAFSLMEKHGDEGRVIAGGTSLLIMMRQRLLTPKVVISLARIPKFDKITFNAKDGLRIGAGARHRDIELSPAVQKHYPLLHETFRKVAQPRIRNMGTVGGNLAAGDPLTDPGASLIALDAEVTLSSSKGQRRLRLDEFFIDYYQTALEPGELLTEIHVPPPQRSGWSHIKFTPRSVEDFATVGVAITLQTRNGTCEDVRVGLNSVASTIVRARKAEEVLRGKTIDDATLQEMGEVASTECDPTDDNRGSADYKREMVKVLVRRAAQEALQRVS

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 2.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 2.8
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 7.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10143499 3300009553 Bacteria 2292
2 Ga0065712_10069069 3300005290 Bacteria 8072
3 Ga0065715_10091849 3300005293 Bacteria 5498
4 Ga0065707_10000897 3300005295 Bacteria 13098
5 Ga0065707_10196364 3300005295 Bacteria 1333
6 Ga0070658_10291319 3300005327 Bacteria 1391
7 Ga0070676_10009521 3300005328 Bacteria 5246
8 Ga0070683_100153227 3300005329 Bacteria 2185
9 Ga0070690_100157330 3300005330 Bacteria 1554
10 Ga0070670_100057751 3300005331 Unclassified 3330
11 Ga0068869_100413952 3300005334 Bacteria 1111
12 Ga0070680_100010152 3300005336 Bacteria 7259
13 Ga0070680_100086567 3300005336 Bacteria 2590
14 Ga0070680_100108694 3300005336 Bacteria 2307
15 Ga0070682_100038420 3300005337 Bacteria 2937
16 Ga0068868_100128458 3300005338 Bacteria 2072
17 Ga0068868_100191113 3300005338 Unclassified 1703
18 Ga0070660_100032856 3300005339 Bacteria 3908
19 Ga0070660_100055612 3300005339 Bacteria 3059
20 Ga0070661_100028026 3300005344 Bacteria 4061
21 Ga0070668_100507313 3300005347 Bacteria 1045
22 Ga0070668_100523786 3300005347 Unclassified 1029
23 Ga0070669_100065191 3300005353 Bacteria 2683
24 Ga0070675_100033013 3300005354 Bacteria 4193
25 Ga0070688_100160145 3300005365 Bacteria 1546
26 Ga0070659_100045026 3300005366 Unclassified 3456
27 Ga0070667_100055988 3300005367 Bacteria 3330
28 Ga0070714_100005734 3300005435 Bacteria 9522
29 Ga0070714_100022768 3300005435 Bacteria 5140
30 Ga0070714_100060340 3300005435 Unclassified 3255
31 Ga0070714_100560551 3300005435 Bacteria 1094
32 Ga0070713_100040716 3300005436 Bacteria 3779
33 Ga0070713_100252611 3300005436 Bacteria 1609
34 Ga0070710_10018321 3300005437 Bacteria 3600
35 Ga0070710_10084167 3300005437 Bacteria 1863
36 Ga0070711_100294391 3300005439 Bacteria 1288
37 Ga0070705_100023280 3300005440 Bacteria 3324
38 Ga0070700_100078558 3300005441 Bacteria 2125
39 Ga0070708_100006628 3300005445 Bacteria 9216
40 Ga0070708_100013426 3300005445 Bacteria 6705
41 Ga0070708_100134361 3300005445 Bacteria 2291
42 Ga0070663_100211583 3300005455 Bacteria 1518
43 Ga0070663_100458591 3300005455 Bacteria 1052
44 Ga0070678_100012951 3300005456 Bacteria 5208
45 Ga0070678_100174832 3300005456 Bacteria 1753
46 Ga0070681_10012237 3300005458 Bacteria 8506
47 Ga0070681_10039272 3300005458 Bacteria 4745
48 Ga0070681_10080206 3300005458 Bacteria 3219
49 Ga0070681_10262670 3300005458 Unclassified 1638
50 Ga0070706_100001524 3300005467 Bacteria 24256
51 Ga0070706_100012983 3300005467 Bacteria 7709
52 Ga0070706_100016434 3300005467 Bacteria 6839
53 Ga0070706_100436973 3300005467 Unclassified 1218
54 Ga0070707_100001338 3300005468 Bacteria 24241
55 Ga0070707_100065525 3300005468 Bacteria 3489
56 Ga0070707_100237308 3300005468 Unclassified 1775
57 Ga0070698_100001853 3300005471 Bacteria 23553
58 Ga0070698_100017092 3300005471 Bacteria 7646
59 Ga0070698_100025151 3300005471 Bacteria 6205
60 Ga0070698_100083027 3300005471 Bacteria 3195
61 Ga0070698_100525522 3300005471 Bacteria 1122
62 Ga0070699_100122789 3300005518 Bacteria 2285
63 Ga0070684_100167230 3300005535 Bacteria 1997
64 Ga0070684_100221634 3300005535 Bacteria 1726
65 Ga0070684_100233425 3300005535 Bacteria 1680
66 Ga0068853_100443507 3300005539 Unclassified 1220
67 Ga0070672_100044720 3300005543 Bacteria 3422
68 Ga0070695_100014391 3300005545 Bacteria 4768
69 Ga0070696_100027577 3300005546 Bacteria 3872
70 Ga0070696_100038330 3300005546 Bacteria 3308
71 Ga0070696_100429072 3300005546 Unclassified 1039
72 Ga0070665_100071106 3300005548 Bacteria 3486
73 Ga0070704_100051954 3300005549 Bacteria 2889
74 Ga0070704_100180668 3300005549 Bacteria 1687
75 Ga0068855_100048211 3300005563 Bacteria 5029
76 Ga0068855_100102209 3300005563 Bacteria 3299
77 Ga0070664_100063052 3300005564 Bacteria 3160
78 Ga0068856_100047777 3300005614 Bacteria 4217
79 Ga0068856_100190846 3300005614 Bacteria 2063
80 Ga0068864_100285856 3300005618 Unclassified 1541
81 Ga0068861_100166076 3300005719 Bacteria 1825
82 Ga0068861_100455009 3300005719 Unclassified 1148
83 Ga0068860_100388946 3300005843 Bacteria 1378
84 Ga0081455_10002474 3300005937 Bacteria 21961
85 Ga0081538_10026394 3300005981 Bacteria 4063
86 Ga0081540_1046952 3300005983 Bacteria 2176
87 Ga0070717_10045732 3300006028 Bacteria 3579
88 Ga0070717_10073906 3300006028 Bacteria 2850
89 Ga0070717_10227472 3300006028 Bacteria 1641
90 Ga0075432_10028730 3300006058 Bacteria 1919
91 Ga0070716_100170151 3300006173 Bacteria 1421
92 Ga0070712_100059592 3300006175 Bacteria 2689
93 Ga0097621_100045660 3300006237 Bacteria 3539
94 Ga0075428_100052988 3300006844 Bacteria 4445
95 Ga0075428_100062502 3300006844 Bacteria 4076
96 Ga0075428_100221195 3300006844 Bacteria 2044
97 Ga0075428_100239732 3300006844 Bacteria 1957
98 Ga0075430_100092425 3300006846 Bacteria 2529
99 Ga0075430_100160938 3300006846 Bacteria 1868
100 Ga0075431_100180342 3300006847 Bacteria 2168
101 Ga0075431_100321500 3300006847 Bacteria 1560
102 Ga0075431_100382767 3300006847 Bacteria 1411
103 Ga0075433_10001637 3300006852 Bacteria 16631
104 Ga0075433_10045676 3300006852 Bacteria 3808
105 Ga0075433_10129980 3300006852 Unclassified 2237
106 Ga0075433_10287032 3300006852 Bacteria 1457
107 Ga0075433_10597989 3300006852 Bacteria 968
108 Ga0075434_100008237 3300006871 Bacteria 9679
109 Ga0075434_100010053 3300006871 Bacteria 8860
110 Ga0075434_100012072 3300006871 Bacteria 8177
111 Ga0075434_100028854 3300006871 Bacteria 5456
112 Ga0075434_100041868 3300006871 Bacteria 4539
113 Ga0075434_100058319 3300006871 Bacteria 3837
114 Ga0075434_100106726 3300006871 Bacteria 2810
115 Ga0075434_100119866 3300006871 Unclassified 2646
116 Ga0075434_100123603 3300006871 Unclassified 2604
117 Ga0075434_100420952 3300006871 Bacteria 1357
118 Ga0075429_100266066 3300006880 Bacteria 1501
119 Ga0068865_100120842 3300006881 Bacteria 1947
120 Ga0075436_100004707 3300006914 Bacteria 9363
121 Ga0075436_100018941 3300006914 Bacteria 4714
122 Ga0075436_100021723 3300006914 Bacteria 4404
123 Ga0075436_100076107 3300006914 Bacteria 2324
124 Ga0075436_100084149 3300006914 Bacteria 2208
125 Ga0075436_100239658 3300006914 Bacteria 1290
126 Ga0075436_100344651 3300006914 Bacteria 1073
127 Ga0075435_100015174 3300007076 Bacteria 5785
128 Ga0075435_100030526 3300007076 Bacteria 4239
129 Ga0075435_100036617 3300007076 Bacteria 3901
130 Ga0075435_100126142 3300007076 Unclassified 2139
131 Ga0075435_100131883 3300007076 Bacteria 2091
132 Ga0075435_100195568 3300007076 Bacteria 1712
133 Ga0075435_100225206 3300007076 Unclassified 1593
134 Ga0111539_10042428 3300009094 Bacteria 5463
135 Ga0111539_10175446 3300009094 Bacteria 2504
136 Ga0111539_10175950 3300009094 Bacteria 2500
137 Ga0111539_10391627 3300009094 Unclassified 1618
138 Ga0105245_10153315 3300009098 Bacteria 2181
139 Ga0114129_10000926 3300009147 Bacteria 38287
140 Ga0114129_10004935 3300009147 Bacteria 18813
141 Ga0114129_10055281 3300009147 Bacteria 5564
142 Ga0114129_10095502 3300009147 Unclassified 4118
143 Ga0114129_10328595 3300009147 Bacteria 2031
144 Ga0114129_10361249 3300009147 Bacteria 1921
145 Ga0114129_10493193 3300009147 Bacteria 1601
146 Ga0114129_10589171 3300009147 Unclassified 1442
147 Ga0105241_10030548 3300009174 Bacteria 4028
148 Ga0105242_10331857 3300009176 Bacteria 1399
149 Ga0105237_10075832 3300009545 Bacteria 3353
150 Ga0105237_10548851 3300009545 Unclassified 1162
151 Ga0105249_10120669 3300009553 Bacteria 2491
152 Ga0105239_10012195 3300010375 Bacteria 9580
153 Ga0157313_1002341 3300012503 Unclassified 1124
154 Ga0157371_10045741 3300013102 Bacteria 3114
155 Ga0157370_10023831 3300013104 Bacteria 6071
156 Ga0157369_10011637 3300013105 Bacteria 9990
157 Ga0157378_10048200 3300013297 Unclassified 3788
158 Ga0163162_10310092 3300013306 Unclassified 1710
159 Ga0157375_10154309 3300013308 Bacteria 2434
160 Ga0157375_10898709 3300013308 Bacteria 1030
161 Ga0157380_10074849 3300014326 Bacteria 2750
162 Ga0157376_10058409 3300014969 Bacteria 3231
163 Ga0197907_10312713 3300020069 Bacteria 3868
164 Ga0206356_10356148 3300020070 Bacteria 1347
165 Ga0206356_10402016 3300020070 Bacteria 3721
166 Ga0206349_1930721 3300020075 Bacteria 3384
167 Ga0206351_10934062 3300020077 Bacteria 1529
168 Ga0206352_10610861 3300020078 Bacteria 3680
169 Ga0206352_11325226 3300020078 Bacteria 900
170 Ga0206350_10144063 3300020080 Bacteria 3689
171 Ga0206353_11139204 3300020082 Bacteria 1219
172 Ga0206353_11793011 3300020082 Bacteria 2104
173 Ga0154015_1177986 3300020610 Bacteria 1220
174 Ga0213875_10002771 3300021388 Bacteria 10347
175 Ga0224712_10004724 3300022467 Bacteria 3708
176 Ga0209148_1009828 3300025254 Bacteria 1841
177 Ga0207692_10009520 3300025898 Bacteria 4062
178 Ga0207692_10021398 3300025898 Bacteria 2958
179 Ga0207692_10182766 3300025898 Bacteria 1222
180 Ga0207647_10111604 3300025904 Bacteria 1616
181 Ga0207685_10000484 3300025905 Bacteria 6738
182 Ga0207699_10006486 3300025906 Bacteria 5671
183 Ga0207699_10285984 3300025906 Bacteria 1147
184 Ga0207699_10477556 3300025906 Bacteria 897
185 Ga0207645_10008914 3300025907 Bacteria 6967
186 Ga0207705_10342823 3300025909 Bacteria 1150
187 Ga0207684_10002896 3300025910 Bacteria 17010
188 Ga0207684_10042543 3300025910 Bacteria 3851
189 Ga0207684_10169588 3300025910 Bacteria 1881
190 Ga0207684_10228542 3300025910 Unclassified 1605
191 Ga0207707_10003223 3300025912 Bacteria 14486
192 Ga0207707_10003645 3300025912 Bacteria 13659
193 Ga0207707_10024765 3300025912 Bacteria 5249
194 Ga0207707_10199268 3300025912 Bacteria 1746
195 Ga0207707_10259179 3300025912 Bacteria 1509
196 Ga0207671_10613282 3300025914 Bacteria 867
197 Ga0207693_10014497 3300025915 Bacteria 6335
198 Ga0207663_10014249 3300025916 Bacteria 4346
199 Ga0207663_10104027 3300025916 Bacteria 1913
200 Ga0207663_10150980 3300025916 Bacteria 1630
201 Ga0207663_10245684 3300025916 Unclassified 1315
202 Ga0207660_10058048 3300025917 Bacteria 2774
203 Ga0207660_10069386 3300025917 Bacteria 2559
204 Ga0207657_10046579 3300025919 Bacteria 3797
205 Ga0207657_10062325 3300025919 Bacteria 3193
206 Ga0207649_10081954 3300025920 Bacteria 2091
207 Ga0207652_10010258 3300025921 Bacteria 7540
208 Ga0207652_10210520 3300025921 Bacteria 1750
209 Ga0207652_10326692 3300025921 Bacteria 1385
210 Ga0207652_10453904 3300025921 Bacteria 1155
211 Ga0207646_10001373 3300025922 Bacteria 30185
212 Ga0207646_10050684 3300025922 Bacteria 3714
213 Ga0207681_10003335 3300025923 Bacteria 10056
214 Ga0207650_10040432 3300025925 Bacteria 3412
215 Ga0207659_10027066 3300025926 Bacteria 3877
216 Ga0207687_10226059 3300025927 Bacteria 1476
217 Ga0207700_10012029 3300025928 Bacteria 5556
218 Ga0207700_10016555 3300025928 Bacteria 4902
219 Ga0207700_10052544 3300025928 Bacteria 3047
220 Ga0207700_10135946 3300025928 Bacteria 2014
221 Ga0207700_10267073 3300025928 Bacteria 1467
222 Ga0207664_10008385 3300025929 Bacteria 7203
223 Ga0207664_10011245 3300025929 Bacteria 6350
224 Ga0207664_10012568 3300025929 Bacteria 6057
225 Ga0207664_10236533 3300025929 Bacteria 1589
226 Ga0207664_10629326 3300025929 Bacteria 964
227 Ga0207690_10010669 3300025932 Bacteria 5475
228 Ga0207706_10047784 3300025933 Bacteria 3786
229 Ga0207670_10351957 3300025936 Unclassified 1167
230 Ga0207665_10015390 3300025939 Bacteria 5023
231 Ga0207691_10013646 3300025940 Bacteria 7765
232 Ga0207689_10008243 3300025942 Bacteria 9079
233 Ga0207679_10001382 3300025945 Bacteria 15290
234 Ga0207667_10013285 3300025949 Bacteria 9433
235 Ga0207667_10693696 3300025949 Bacteria 1021
236 Ga0207712_10081439 3300025961 Bacteria 2357
237 Ga0207712_10308840 3300025961 Bacteria 1301
238 Ga0207668_10213115 3300025972 Bacteria 1546
239 Ga0207658_10041067 3300025986 Bacteria 3348
240 Ga0207677_10220063 3300026023 Unclassified 1522
241 Ga0207678_10068749 3300026067 Bacteria 3038
242 Ga0207678_10068934 3300026067 Bacteria 3033
243 Ga0207708_10035878 3300026075 Bacteria 3772
244 Ga0207641_10169438 3300026088 Bacteria 1992
245 Ga0207648_10216720 3300026089 Bacteria 1700
246 Ga0207674_10116702 3300026116 Bacteria 2640
247 Ga0207674_10170345 3300026116 Bacteria 2131
248 Ga0207675_100158292 3300026118 Bacteria 2159
249 Ga0207683_10001807 3300026121 Bacteria 18948
250 Ga0207683_10110872 3300026121 Bacteria 2456
251 Ga0209970_1010016 3300027614 Unclassified 1548
252 Ga0209971_1011551 3300027682 Bacteria 2091
253 Ga0209966_1026302 3300027695 Unclassified 1159
254 Ga0209974_10006715 3300027876 Bacteria 3996
255 Ga0209974_10017726 3300027876 Bacteria 2361
256 Ga0207428_10075780 3300027907 Bacteria 2636
257 Ga0207428_10323915 3300027907 Bacteria 1138
258 Ga0268266_10173197 3300028379 Bacteria 1960
259 Ga0268264_10209267 3300028381 Bacteria 1789
260 Ga0268264_10447493 3300028381 Bacteria 1251
261 Ga0265337_1001967 3300028556 Bacteria 9770
262 Ga0265326_10001475 3300028558 Bacteria 8264
263 Ga0265319_1000384 3300028563 Bacteria 31990
264 Ga0265334_10000656 3300028573 Bacteria 17383
265 Ga0265318_10011574 3300028577 Bacteria 3792
266 Ga0265323_10100035 3300028653 Bacteria 960
267 Ga0265336_10001658 3300028666 Bacteria 9843
268 Ga0265336_10014245 3300028666 Bacteria 2638
269 Ga0265338_10002834 3300028800 Bacteria 25311
270 Ga0265338_10007756 3300028800 Bacteria 13208
271 Ga0265332_10002186 3300031238 Bacteria 10065
272 Ga0265325_10009409 3300031241 Bacteria 5701
273 Ga0265340_10005033 3300031247 Bacteria 7351
274 Ga0265316_10005078 3300031344 Bacteria 12908
275 Ga0307408_100124677 3300031548 Bacteria 2001
276 Ga0265313_10007737 3300031595 Bacteria 7272
277 Ga0265314_10015706 3300031711 Bacteria 5999
278 Ga0265342_10005279 3300031712 Bacteria 9900
279 Ga0307405_10386080 3300031731 Bacteria 1092
280 Ga0307413_10039475 3300031824 Bacteria 2746
281 Ga0307407_10016454 3300031903 Bacteria 3683
282 Ga0307412_10013710 3300031911 Bacteria 4762
283 Ga0307409_100017880 3300031995 Bacteria 4742
284 Ga0307416_100042163 3300032002 Unclassified 3560
285 Ga0307416_100151670 3300032002 Bacteria 2126
286 Ga0307411_10159809 3300032005 Unclassified 1686
287 Ga0316212_1001334 3300033547 Bacteria 3351
288 Ga0373930_0001486 3300034816 Bacteria 3501
289 Ga0373948_0009110 3300034817 Bacteria 1706
290 Ga0373926_0140461 3300035083 Bacteria 917
291 Ga0373928_0004152 3300035084 Bacteria 2763
292 Ga0373934_0001418 3300035086 Bacteria 8764
293 Ga0373934_0009523 3300035086 Bacteria 3640
294 Ga0373944_0013003 3300035089 Bacteria 2302
295 Ga0373949_0016320 3300035090 Bacteria 1664
296 Ga0373951_0002657 3300035091 Bacteria 4482
297 Ga0373952_0011241 3300035092 Bacteria 1743
298 Ga0373923_0009251 3300035111 Bacteria 3550
299 Ga0373923_0025140 3300035111 Bacteria 2357
300 Ga0373923_0070978 3300035111 Bacteria 1495
301 Ga0373936_0066140 3300035113 Bacteria 1484
302 Ga0373939_0022164 3300035114 Bacteria 1747
303 Ga0373941_0020884 3300035115 Bacteria 1841
304 Ga0373941_0073159 3300035115 Bacteria 1142
305 Ga0373945_0053644 3300035116 Bacteria 1489
306 Ga0373953_0028029 3300035117 Bacteria 2169
307 Ga0373954_0026777 3300035118 Bacteria 2644
308 Ga0373954_0052695 3300035118 Bacteria 1912
309 Ga0373956_0014758 3300035119 Bacteria 3267
310 Ga0373957_0022679 3300035120 Bacteria 2238
311 Ga0373957_0067064 3300035120 Bacteria 1398
312 Ga0373946_0005547 3300035171 Bacteria 4552
313 Ga0373955_0010545 3300035172 Bacteria 4368
314 Ga0373955_0204825 3300035172 Bacteria 1175
315 Ga0373961_0008396 3300035241 Bacteria 2511
316 Ga0373962_0032412 3300035242 Bacteria 1437
317 Ga0373924_0010787 3300035410 Bacteria 3381
318 Ga0373924_0011603 3300035410 Bacteria 3276
319 Ga0373931_0009427 3300035691 Bacteria 4669
320 Ga0373931_0129744 3300035691 Unclassified 1450
321 Ga0373935_0049900 3300035692 Bacteria 2654
322 Ga0373935_0204931 3300035692 Bacteria 1364
323 Ga0373935_0656542 3300035692 Bacteria 769
324 Ga0373927_0077586 3300035695 Bacteria 2152
325 Ga0373933_0082298 3300035724 Bacteria 1975
326 Ga0373933_0188308 3300035724 Bacteria 1318
327 Ga0373947_0010708 3300035725 Bacteria 5265
328 Ga0373947_0119261 3300035725 Bacteria 1674
329 Ga0373947_0149868 3300035725 Bacteria 1501
330 Ga0373947_0378806 3300035725 Bacteria 952
331 Ga0373937_0133294 3300036401 Bacteria 2321
332 Ga0372808_000251 3300036459 Bacteria 3614
333 Ga0373925_0000033 3300037068 Bacteria 144636
334 Ga0373925_0002649 3300037068 Bacteria 14208
335 Ga0373925_0028706 3300037068 Bacteria 4077
336 Ga0373925_0049995 3300037068 Bacteria 3118
337 Ga0373925_0115039 3300037068 Bacteria 2082
338 Ga0436364_0164275 3300037853 Bacteria 26469
339 Ga0436365_0809374 3300039437 Bacteria 3488
340 Ga0436360_0991479 3300039438 Bacteria 1050
341 Ga0439448_0099965 3300042005 Bacteria 985
342 Ga0451577_0174724 3300042876 Bacteria 1936
343 Ga0451577_0360426 3300042876 Bacteria 1319
344 Ga0453683_0003635 3300044673 Bacteria 11301
345 Ga0466963_0020107 3300044694 Bacteria 4197
346 Ga0453684_0530678 3300044712 Bacteria 1299
347 Ga0466957_0179424 3300044842 Bacteria 1383
348 Ga0466957_0289699 3300044842 Bacteria 1098
349 Ga0451576_0136369 3300045051 Bacteria 2559
350 Ga0451576_0561275 3300045051 Bacteria 1199
351 Ga0451576_0657266 3300045051 Bacteria 1101
352 Ga0466958_0335444 3300045836 Bacteria 973
353 Ga0495592_0009374 3300046454 Bacteria 7360
354 Ga0495592_0022620 3300046454 Bacteria 4782
355 Ga0495629_0108561 3300046459 Bacteria 1935
356 Ga0495629_0198973 3300046459 Bacteria 1385
357 Ga0495629_0257276 3300046459 Bacteria 1200
358 Ga0495641_0023129 3300046461 Bacteria 3094
359 Ga0495641_0055171 3300046461 Bacteria 1804
360 Ga0495651_0014782 3300046462 Bacteria 6035
361 Ga0495651_0061477 3300046462 Bacteria 2874
362 Ga0495651_0150591 3300046462 Bacteria 1677
363 Ga0495653_0033058 3300046463 Bacteria 4101
364 Ga0495653_0064875 3300046463 Bacteria 2750
365 Ga0495653_0071430 3300046463 Bacteria 2595
366 Ga0495580_0000837 3300046472 Bacteria 26637
367 Ga0495582_0269606 3300046473 Bacteria 977
368 Ga0495639_0110803 3300046475 Bacteria 1302
369 Ga0495639_0145578 3300046475 Bacteria 1141
370 Ga0495662_0067663 3300046476 Bacteria 1728
371 Ga0495662_0071304 3300046476 Bacteria 1683
372 Ga0495664_0072826 3300046477 Bacteria 2053
373 Ga0495608_0038774 3300046511 Bacteria 3197
374 Ga0495608_0063862 3300046511 Bacteria 2414
375 Ga0495608_0102009 3300046511 Bacteria 1849
376 Ga0495618_0023507 3300046514 Bacteria 3812
377 Ga0495618_0085984 3300046514 Bacteria 2010
378 Ga0495628_0040166 3300046516 Bacteria 3739
379 Ga0495628_0100599 3300046516 Bacteria 2231
380 Ga0495628_0299069 3300046516 Bacteria 1191
381 Ga0495630_0052344 3300046517 Bacteria 3056
382 Ga0495630_0118074 3300046517 Bacteria 2011
383 Ga0495666_0078016 3300046526 Bacteria 1569
384 Ga0495652_0030749 3300046529 Bacteria 4705
385 Ga0495652_0254214 3300046529 Bacteria 1300
386 Ga0495652_0301114 3300046529 Bacteria 1165
387 Ga0495665_0058912 3300046531 Bacteria 2027
388 Ga0495665_0104468 3300046531 Bacteria 1486
389 Ga0495640_0139322 3300046533 Bacteria 1564
390 Ga0495640_0225116 3300046533 Bacteria 1181
391 Ga0495640_0332021 3300046533 Bacteria 940
392 Ga0495586_0024055 3300046535 Bacteria 3253
393 Ga0495586_0233912 3300046535 Bacteria 1046
394 Ga0495587_0007775 3300046536 Bacteria 6926
395 Ga0495587_0016031 3300046536 Bacteria 4664
396 Ga0495587_0028387 3300046536 Bacteria 3402
397 Ga0495598_0045392 3300046537 Bacteria 1302
398 Ga0495645_0032621 3300046543 Bacteria 3799
399 Ga0495633_0212210 3300046558 Unclassified 887
400 Ga0495667_0058314 3300046559 Bacteria 2536
401 Ga0495667_0058852 3300046559 Bacteria 2522
402 Ga0495634_0035589 3300046642 Bacteria 3408
403 Ga0495634_0042446 3300046642 Bacteria 3085
404 Ga0495635_0003352 3300046663 Bacteria 11076
405 Ga0495635_0094019 3300046663 Bacteria 2049
406 Ga0495588_0103726 3300046674 Bacteria 1495
407 Ga0495657_0025689 3300046675 Bacteria 4180
408 Ga0495657_0067749 3300046675 Bacteria 2341
409 Ga0495599_0018421 3300046678 Bacteria 4350
410 Ga0495599_0026071 3300046678 Bacteria 3662
411 Ga0495599_0084739 3300046678 Bacteria 1979
412 Ga0495623_0019067 3300046679 Bacteria 4430
413 Ga0495646_0040507 3300046680 Bacteria 2868
414 Ga0495646_0085740 3300046680 Bacteria 1827
415 Ga0495658_0079688 3300046683 Bacteria 1919
416 Ga0495658_0089704 3300046683 Bacteria 1818
417 Ga0495613_0098532 3300046689 Bacteria 2112
418 Ga0495613_0198475 3300046689 Bacteria 1415
419 Ga0495613_0371778 3300046689 Unclassified 979
420 Ga0495624_0070691 3300046690 Bacteria 2173
421 Ga0495624_0112665 3300046690 Bacteria 1672
422 Ga0495600_0004953 3300046809 Bacteria 7996
423 Ga0495581_0132319 3300047315 Bacteria 1453
424 Ga0495604_0019683 3300047317 Bacteria 5400
425 Ga0495604_0080607 3300047317 Bacteria 2438
426 Ga0495604_0094468 3300047317 Bacteria 2210
427 Ga0495674_0032633 3300047319 Bacteria 4722
428 Ga0495674_0063212 3300047319 Bacteria 3220
429 Ga0495674_0233215 3300047319 Bacteria 1518
430 Ga0495676_0189054 3300047321 Bacteria 1437
431 Ga0495680_0047454 3300047322 Bacteria 3378
432 Ga0495680_0068303 3300047322 Bacteria 2715
433 Ga0495680_0116939 3300047322 Bacteria 1971
434 Ga0495675_0103460 3300047444 Bacteria 1780
435 Ga0495684_0004682 3300047471 Bacteria 10674
436 Ga0495684_0016839 3300047471 Bacteria 5632
437 Ga0495684_0025088 3300047471 Bacteria 4584
438 Ga0495593_0003298 3300047673 Bacteria 9671
439 Ga0495593_0031126 3300047673 Bacteria 2916
440 Ga0495602_0053212 3300048088 Bacteria 3587
441 Ga0495602_0347847 3300048088 Bacteria 1070
442 Ga0496100_0113454 3300048903 Bacteria 1886
443 Ga0496102_0143731 3300048905 Bacteria 2238
444 Ga0496102_0167823 3300048905 Bacteria 2066
445 Ga0496102_0307694 3300048905 Bacteria 1493
446 Ga0496103_0209992 3300048906 Bacteria 1252
447 Ga0496104_0229640 3300048907 Bacteria 1768
448 Ga0496106_0389296 3300048909 Bacteria 1120
449 Ga0496106_0389939 3300048909 Bacteria 1119
450 Ga0496109_0063972 3300048912 Bacteria 3365
451 Ga0496112_0057582 3300048915 Bacteria 3826
452 Ga0496112_0567196 3300048915 Unclassified 1068
453 Ga0496113_0230949 3300048916 Bacteria 1475
454 Ga0496113_0492130 3300048916 Bacteria 985
455 Ga0496114_0011708 3300048917 Bacteria 7014
456 Ga0496114_0302684 3300048917 Bacteria 1412
457 Ga0496115_0016717 3300048918 Bacteria 5590
458 Ga0496119_0134151 3300048922 Bacteria 1345
459 Ga0496119_0141118 3300048922 Bacteria 1301
460 Ga0496126_0230333 3300048929 Bacteria 1552
461 Ga0496126_0411184 3300048929 Bacteria 1095
462 Ga0501031_0071939 3300049568 Bacteria 2251
463 Ga0501033_0014310 3300049570 Bacteria 6029
464 Ga0501034_0085034 3300049571 Bacteria 3165
465 Ga0501036_0042197 3300049572 Bacteria 3862
466 Ga0501036_0381820 3300049572 Bacteria 1176
467 Ga0501037_0010400 3300049573 Bacteria 6828
468 Ga0501038_0001188 3300049574 Bacteria 23655
469 Ga0501038_0135004 3300049574 Bacteria 2022
470 Ga0501039_0004304 3300049575 Bacteria 10733
471 Ga0501040_0000199 3300049576 Bacteria 34815
472 Ga0501040_0252198 3300049576 Bacteria 1259
473 Ga0501040_0310369 3300049576 Unclassified 1128
474 Ga0501040_0348079 3300049576 Bacteria 1061
475 Ga0501041_0000053 3300049577 Bacteria 41379
476 Ga0501041_0027147 3300049577 Bacteria 3449
477 Ga0501042_0021459 3300049578 Bacteria 4501
478 Ga0501043_0019650 3300049579 Bacteria 5304
479 Ga0501043_0049883 3300049579 Bacteria 3290
480 Ga0501046_0002982 3300049580 Bacteria 15643
481 Ga0501046_0098312 3300049580 Bacteria 2247
482 Ga0501047_0504362 3300049581 Bacteria 1037
483 Ga0501048_0104437 3300049582 Bacteria 1999
484 Ga0501067_0045583 3300049583 Bacteria 2434
485 Ga0501068_0009647 3300049584 Bacteria 5405
486 Ga0501068_0073926 3300049584 Bacteria 2082
487 Ga0501069_0015828 3300049585 Bacteria 4043
488 Ga0501070_0070852 3300049586 Bacteria 2886
489 Ga0501071_0057992 3300049587 Bacteria 2798
490 Ga0501071_0310631 3300049587 Bacteria 1196
491 Ga0501072_0163704 3300049588 Bacteria 1774
492 Ga0501073_0018140 3300049589 Bacteria 5087
493 Ga0501073_0151846 3300049589 Bacteria 1605
494 Ga0501074_0015120 3300049590 Bacteria 5611
495 Ga0501074_0027613 3300049590 Bacteria 4115
496 Ga0501074_0220609 3300049590 Bacteria 1350
497 Ga0501075_0000657 3300049591 Bacteria 21245
498 Ga0501075_0006705 3300049591 Bacteria 7944
499 Ga0501075_0076889 3300049591 Bacteria 2525
500 Ga0501076_0091868 3300049592 Bacteria 2442
501 Ga0501076_0147953 3300049592 Bacteria 1910
502 Ga0501076_0409920 3300049592 Unclassified 1115
503 Ga0501077_0000756 3300049593 Bacteria 19572
504 Ga0501077_0003939 3300049593 Bacteria 8950
505 Ga0501079_0004874 3300049741 Bacteria 9946
506 Ga0501080_0008309 3300049742 Bacteria 9404
507 Ga0501080_0176031 3300049742 Bacteria 1970
508 Ga0501080_0575113 3300049742 Bacteria 1002
509 Ga0501081_0001710 3300049743 Bacteria 13629
510 Ga0501081_0014618 3300049743 Bacteria 5179
511 Ga0501081_0365194 3300049743 Bacteria 1065
512 Ga0501083_0057464 3300049744 Bacteria 2604
513 Ga0501083_0063854 3300049744 Unclassified 2455
514 Ga0501035_0044562 3300049822 Bacteria 3994
515 Ga0501044_0028389 3300049823 Bacteria 5906
516 Ga0501045_0000501 3300049824 Bacteria 24351
517 Ga0501045_0114015 3300049824 Unclassified 2005
518 Ga0501045_0127789 3300049824 Bacteria 1888
519 nmdc:mga05p37_128946_c1 3300050507 Bacteria 3105
520 nmdc:mga05p37_318890_c1 3300050507 Bacteria 1840
521 nmdc:mga05p37_40829_c1 3300050507 Bacteria 5697
522 nmdc:mga05p37_524126_c1 3300050507 Bacteria 1355
523 nmdc:mga05p37_6579_c1 3300050507 Bacteria 13699
524 nmdc:mga09592_86402_c1 3300050508 Bacteria 2676
525 nmdc:mga06r32_40242_c1 3300050510 Bacteria 4436
526 nmdc:mga08y16_32409_c1 3300050511 Bacteria 5494
527 nmdc:mga08y16_402124_c1 3300050511 Bacteria 1401
528 nmdc:mga08y16_53822_c1 3300050511 Bacteria 4206
529 nmdc:mga0n895_115893_c1 3300050512 Bacteria 2698
530 nmdc:mga0n895_16099_c1 3300050512 Bacteria 6853
531 nmdc:mga0n895_230226_c1 3300050512 Bacteria 1881
532 nmdc:mga0n895_300340_c1 3300050512 Bacteria 1628
533 nmdc:mga0n895_35530_c1 3300050512 Bacteria 4805
534 nmdc:mga0n895_431452_c1 3300050512 Bacteria 1332
535 nmdc:mga0n895_55910_c1 3300050512 Bacteria 3886
536 nmdc:mga0n895_86040_c1 3300050512 Bacteria 3140
537 nmdc:mga0rr50_126397_c1 3300050513 Bacteria 2042
538 nmdc:mga0rr50_274127_c1 3300050513 Unclassified 1406
539 nmdc:mga0rr50_4742_c1 3300050513 Bacteria 8018
540 nmdc:mga0rr50_5474_c1 3300050513 Bacteria 7579
541 nmdc:mga0rr50_79277_c1 3300050513 Unclassified 2529
542 nmdc:mga0rr50_98909_c1 3300050513 Bacteria 2288
543 nmdc:mga08x19_16424_c1 3300050514 Bacteria 4516
544 nmdc:mga08x19_22185_c1 3300050514 Bacteria 3930
545 nmdc:mga08x19_280881_c1 3300050514 Bacteria 1154
546 nmdc:mga08x19_305865_c1 3300050514 Bacteria 1105
547 nmdc:mga08x19_51596_c1 3300050514 Bacteria 2643
548 nmdc:mga08x19_5513_c1 3300050514 Bacteria 7486
549 nmdc:mga08x19_58124_c1 3300050514 Unclassified 2501
550 nmdc:mga0a205_16094_c1 3300050515 Bacteria 7002
551 nmdc:mga0a205_24150_c1 3300050515 Bacteria 5774
552 nmdc:mga0a205_35403_c1 3300050515 Bacteria 4794
553 nmdc:mga0a205_538_c1 3300050515 Bacteria 29936
554 nmdc:mga0a205_554860_c1 3300050515 Bacteria 1004
555 nmdc:mga0a205_74821_c1 3300050515 Unclassified 3272
556 Ga0495601_0009890 3300053077 Bacteria 5648
557 Ga0495601_0082629 3300053077 Bacteria 2062
558 Ga0495612_0047835 3300053078 Bacteria 1753
559 Ga0495595_0046980 3300053084 Bacteria 1990
560 Ga0495619_0013390 3300053085 Bacteria 5168
561 Ga0495619_0029677 3300053085 Bacteria 3535
562 Ga0495619_0193821 3300053085 Bacteria 1406
563 Ga0501084_0000573 3300054114 Bacteria 28128
564 Ga0501084_0271267 3300054114 Bacteria 1432
565 Ga0501084_0340873 3300054114 Bacteria 1266
566 Ga0501084_0364134 3300054114 Bacteria 1222
567 Ga0590071_001728 3300059421 Bacteria 5639
568 Ga0590071_056414 3300059421 Bacteria 956
569 Ga0501082_0010944 3300060353 Bacteria 7807
570 Ga0501082_0071274 3300060353 Bacteria 2992
571 Ga0530510_0310501 3300061734 Bacteria 1181
572 Ga0105249_10143499
573 Ga0065712_10069069
574 Ga0065715_10091849
575 Ga0065707_10000897
576 Ga0065707_10196364
577 Ga0070658_10291319
578 Ga0070676_10009521
579 Ga0070683_100153227
580 Ga0070690_100157330
581 Ga0070670_100057751
582 Ga0068869_100413952
583 Ga0070680_100010152
584 Ga0070680_100086567
585 Ga0070680_100108694
586 Ga0070682_100038420
587 Ga0068868_100128458
588 Ga0068868_100191113
589 Ga0070660_100032856
590 Ga0070660_100055612
591 Ga0070661_100028026
592 Ga0070668_100507313
593 Ga0070668_100523786
594 Ga0070669_100065191
595 Ga0070675_100033013
596 Ga0070688_100160145
597 Ga0070659_100045026
598 Ga0070667_100055988
599 Ga0070714_100005734
600 Ga0070714_100022768
601 Ga0070714_100060340
602 Ga0070714_100560551
603 Ga0070713_100040716
604 Ga0070713_100252611
605 Ga0070710_10018321
606 Ga0070710_10084167
607 Ga0070711_100294391
608 Ga0070705_100023280
609 Ga0070700_100078558
610 Ga0070708_100006628
611 Ga0070708_100013426
612 Ga0070708_100134361
613 Ga0070663_100211583
614 Ga0070663_100458591
615 Ga0070678_100012951
616 Ga0070678_100174832
617 Ga0070681_10012237
618 Ga0070681_10039272
619 Ga0070681_10080206
620 Ga0070681_10262670
621 Ga0070706_100001524
622 Ga0070706_100012983
623 Ga0070706_100016434
624 Ga0070706_100436973
625 Ga0070707_100001338
626 Ga0070707_100065525
627 Ga0070707_100237308
628 Ga0070698_100001853
629 Ga0070698_100017092
630 Ga0070698_100025151
631 Ga0070698_100083027
632 Ga0070698_100525522
633 Ga0070699_100122789
634 Ga0070684_100167230
635 Ga0070684_100221634
636 Ga0070684_100233425
637 Ga0068853_100443507
638 Ga0070672_100044720
639 Ga0070695_100014391
640 Ga0070696_100027577
641 Ga0070696_100038330
642 Ga0070696_100429072
643 Ga0070665_100071106
644 Ga0070704_100051954
645 Ga0070704_100180668
646 Ga0068855_100048211
647 Ga0068855_100102209
648 Ga0070664_100063052
649 Ga0068856_100047777
650 Ga0068856_100190846
651 Ga0068864_100285856
652 Ga0068861_100166076
653 Ga0068861_100455009
654 Ga0068860_100388946
655 Ga0081455_10002474
656 Ga0081538_10026394
657 Ga0081540_1046952
658 Ga0070717_10045732
659 Ga0070717_10073906
660 Ga0070717_10227472
661 Ga0075432_10028730
662 Ga0070716_100170151
663 Ga0070712_100059592
664 Ga0097621_100045660
665 Ga0075428_100052988
666 Ga0075428_100062502
667 Ga0075428_100221195
668 Ga0075428_100239732
669 Ga0075430_100092425
670 Ga0075430_100160938
671 Ga0075431_100180342
672 Ga0075431_100321500
673 Ga0075431_100382767
674 Ga0075433_10001637
675 Ga0075433_10045676
676 Ga0075433_10129980
677 Ga0075433_10287032
678 Ga0075433_10597989
679 Ga0075434_100008237
680 Ga0075434_100010053
681 Ga0075434_100012072
682 Ga0075434_100028854
683 Ga0075434_100041868
684 Ga0075434_100058319
685 Ga0075434_100106726
686 Ga0075434_100119866
687 Ga0075434_100123603
688 Ga0075434_100420952
689 Ga0075429_100266066
690 Ga0068865_100120842
691 Ga0075436_100004707
692 Ga0075436_100018941
693 Ga0075436_100021723
694 Ga0075436_100076107
695 Ga0075436_100084149
696 Ga0075436_100239658
697 Ga0075436_100344651
698 Ga0075435_100015174
699 Ga0075435_100030526
700 Ga0075435_100036617
701 Ga0075435_100126142
702 Ga0075435_100131883
703 Ga0075435_100195568
704 Ga0075435_100225206
705 Ga0111539_10042428
706 Ga0111539_10175446
707 Ga0111539_10175950
708 Ga0111539_10391627
709 Ga0105245_10153315
710 Ga0114129_10000926
711 Ga0114129_10004935
712 Ga0114129_10055281
713 Ga0114129_10095502
714 Ga0114129_10328595
715 Ga0114129_10361249
716 Ga0114129_10493193
717 Ga0114129_10589171
718 Ga0105241_10030548
719 Ga0105242_10331857
720 Ga0105237_10075832
721 Ga0105237_10548851
722 Ga0105249_10120669
723 Ga0105239_10012195
724 Ga0157313_1002341
725 Ga0157371_10045741
726 Ga0157370_10023831
727 Ga0157369_10011637
728 Ga0157378_10048200
729 Ga0163162_10310092
730 Ga0157375_10154309
731 Ga0157375_10898709
732 Ga0157380_10074849
733 Ga0157376_10058409
734 Ga0197907_10312713
735 Ga0206356_10356148
736 Ga0206356_10402016
737 Ga0206349_1930721
738 Ga0206351_10934062
739 Ga0206352_10610861
740 Ga0206352_11325226
741 Ga0206350_10144063
742 Ga0206353_11139204
743 Ga0206353_11793011
744 Ga0154015_1177986
745 Ga0213875_10002771
746 Ga0224712_10004724
747 Ga0209148_1009828
748 Ga0207692_10009520
749 Ga0207692_10021398
750 Ga0207692_10182766
751 Ga0207647_10111604
752 Ga0207685_10000484
753 Ga0207699_10006486
754 Ga0207699_10285984
755 Ga0207699_10477556
756 Ga0207645_10008914
757 Ga0207705_10342823
758 Ga0207684_10002896
759 Ga0207684_10042543
760 Ga0207684_10169588
761 Ga0207684_10228542
762 Ga0207707_10003223
763 Ga0207707_10003645
764 Ga0207707_10024765
765 Ga0207707_10199268
766 Ga0207707_10259179
767 Ga0207671_10613282
768 Ga0207693_10014497
769 Ga0207663_10014249
770 Ga0207663_10104027
771 Ga0207663_10150980
772 Ga0207663_10245684
773 Ga0207660_10058048
774 Ga0207660_10069386
775 Ga0207657_10046579
776 Ga0207657_10062325
777 Ga0207649_10081954
778 Ga0207652_10010258
779 Ga0207652_10210520
780 Ga0207652_10326692
781 Ga0207652_10453904
782 Ga0207646_10001373
783 Ga0207646_10050684
784 Ga0207681_10003335
785 Ga0207650_10040432
786 Ga0207659_10027066
787 Ga0207687_10226059
788 Ga0207700_10012029
789 Ga0207700_10016555
790 Ga0207700_10052544
791 Ga0207700_10135946
792 Ga0207700_10267073
793 Ga0207664_10008385
794 Ga0207664_10011245
795 Ga0207664_10012568
796 Ga0207664_10236533
797 Ga0207664_10629326
798 Ga0207690_10010669
799 Ga0207706_10047784
800 Ga0207670_10351957
801 Ga0207665_10015390
802 Ga0207691_10013646
803 Ga0207689_10008243
804 Ga0207679_10001382
805 Ga0207667_10013285
806 Ga0207667_10693696
807 Ga0207712_10081439
808 Ga0207712_10308840
809 Ga0207668_10213115
810 Ga0207658_10041067
811 Ga0207677_10220063
812 Ga0207678_10068749
813 Ga0207678_10068934
814 Ga0207708_10035878
815 Ga0207641_10169438
816 Ga0207648_10216720
817 Ga0207674_10116702
818 Ga0207674_10170345
819 Ga0207675_100158292
820 Ga0207683_10001807
821 Ga0207683_10110872
822 Ga0209970_1010016
823 Ga0209971_1011551
824 Ga0209966_1026302
825 Ga0209974_10006715
826 Ga0209974_10017726
827 Ga0207428_10075780
828 Ga0207428_10323915
829 Ga0268266_10173197
830 Ga0268264_10209267
831 Ga0268264_10447493
832 Ga0265337_1001967
833 Ga0265326_10001475
834 Ga0265319_1000384
835 Ga0265334_10000656
836 Ga0265318_10011574
837 Ga0265323_10100035
838 Ga0265336_10001658
839 Ga0265336_10014245
840 Ga0265338_10002834
841 Ga0265338_10007756
842 Ga0265332_10002186
843 Ga0265325_10009409
844 Ga0265340_10005033
845 Ga0265316_10005078
846 Ga0307408_100124677
847 Ga0265313_10007737
848 Ga0265314_10015706
849 Ga0265342_10005279
850 Ga0307405_10386080
851 Ga0307413_10039475
852 Ga0307407_10016454
853 Ga0307412_10013710
854 Ga0307409_100017880
855 Ga0307416_100042163
856 Ga0307416_100151670
857 Ga0307411_10159809
858 Ga0316212_1001334
859 Ga0373930_0001486
860 Ga0373948_0009110
861 Ga0373926_0140461
862 Ga0373928_0004152
863 Ga0373934_0001418
864 Ga0373934_0009523
865 Ga0373944_0013003
866 Ga0373949_0016320
867 Ga0373951_0002657
868 Ga0373952_0011241
869 Ga0373923_0009251
870 Ga0373923_0025140
871 Ga0373923_0070978
872 Ga0373936_0066140
873 Ga0373939_0022164
874 Ga0373941_0020884
875 Ga0373941_0073159
876 Ga0373945_0053644
877 Ga0373953_0028029
878 Ga0373954_0026777
879 Ga0373954_0052695
880 Ga0373956_0014758
881 Ga0373957_0022679
882 Ga0373957_0067064
883 Ga0373946_0005547
884 Ga0373955_0010545
885 Ga0373955_0204825
886 Ga0373961_0008396
887 Ga0373962_0032412
888 Ga0373924_0010787
889 Ga0373924_0011603
890 Ga0373931_0009427
891 Ga0373931_0129744
892 Ga0373935_0049900
893 Ga0373935_0204931
894 Ga0373935_0656542
895 Ga0373927_0077586
896 Ga0373933_0082298
897 Ga0373933_0188308
898 Ga0373947_0010708
899 Ga0373947_0119261
900 Ga0373947_0149868
901 Ga0373947_0378806
902 Ga0373937_0133294
903 Ga0372808_000251
904 Ga0373925_0000033
905 Ga0373925_0002649
906 Ga0373925_0028706
907 Ga0373925_0049995
908 Ga0373925_0115039
909 Ga0436364_0164275
910 Ga0436365_0809374
911 Ga0436360_0991479
912 Ga0439448_0099965
913 Ga0451577_0174724
914 Ga0451577_0360426
915 Ga0453683_0003635
916 Ga0466963_0020107
917 Ga0453684_0530678
918 Ga0466957_0179424
919 Ga0466957_0289699
920 Ga0451576_0136369
921 Ga0451576_0561275
922 Ga0451576_0657266
923 Ga0466958_0335444
924 Ga0495592_0009374
925 Ga0495592_0022620
926 Ga0495629_0108561
927 Ga0495629_0198973
928 Ga0495629_0257276
929 Ga0495641_0023129
930 Ga0495641_0055171
931 Ga0495651_0014782
932 Ga0495651_0061477
933 Ga0495651_0150591
934 Ga0495653_0033058
935 Ga0495653_0064875
936 Ga0495653_0071430
937 Ga0495580_0000837
938 Ga0495582_0269606
939 Ga0495639_0110803
940 Ga0495639_0145578
941 Ga0495662_0067663
942 Ga0495662_0071304
943 Ga0495664_0072826
944 Ga0495608_0038774
945 Ga0495608_0063862
946 Ga0495608_0102009
947 Ga0495618_0023507
948 Ga0495618_0085984
949 Ga0495628_0040166
950 Ga0495628_0100599
951 Ga0495628_0299069
952 Ga0495630_0052344
953 Ga0495630_0118074
954 Ga0495666_0078016
955 Ga0495652_0030749
956 Ga0495652_0254214
957 Ga0495652_0301114
958 Ga0495665_0058912
959 Ga0495665_0104468
960 Ga0495640_0139322
961 Ga0495640_0225116
962 Ga0495640_0332021
963 Ga0495586_0024055
964 Ga0495586_0233912
965 Ga0495587_0007775
966 Ga0495587_0016031
967 Ga0495587_0028387
968 Ga0495598_0045392
969 Ga0495645_0032621
970 Ga0495633_0212210
971 Ga0495667_0058314
972 Ga0495667_0058852
973 Ga0495634_0035589
974 Ga0495634_0042446
975 Ga0495635_0003352
976 Ga0495635_0094019
977 Ga0495588_0103726
978 Ga0495657_0025689
979 Ga0495657_0067749
980 Ga0495599_0018421
981 Ga0495599_0026071
982 Ga0495599_0084739
983 Ga0495623_0019067
984 Ga0495646_0040507
985 Ga0495646_0085740
986 Ga0495658_0079688
987 Ga0495658_0089704
988 Ga0495613_0098532
989 Ga0495613_0198475
990 Ga0495613_0371778
991 Ga0495624_0070691
992 Ga0495624_0112665
993 Ga0495600_0004953
994 Ga0495581_0132319
995 Ga0495604_0019683
996 Ga0495604_0080607
997 Ga0495604_0094468
998 Ga0495674_0032633
999 Ga0495674_0063212
1000 Ga0495674_0233215
1001 Ga0495676_0189054
1002 Ga0495680_0047454
1003 Ga0495680_0068303
1004 Ga0495680_0116939
1005 Ga0495675_0103460
1006 Ga0495684_0004682
1007 Ga0495684_0016839
1008 Ga0495684_0025088
1009 Ga0495593_0003298
1010 Ga0495593_0031126
1011 Ga0495602_0053212
1012 Ga0495602_0347847
1013 Ga0496100_0113454
1014 Ga0496102_0143731
1015 Ga0496102_0167823
1016 Ga0496102_0307694
1017 Ga0496103_0209992
1018 Ga0496104_0229640
1019 Ga0496106_0389296
1020 Ga0496106_0389939
1021 Ga0496109_0063972
1022 Ga0496112_0057582
1023 Ga0496112_0567196
1024 Ga0496113_0230949
1025 Ga0496113_0492130
1026 Ga0496114_0011708
1027 Ga0496114_0302684
1028 Ga0496115_0016717
1029 Ga0496119_0134151
1030 Ga0496119_0141118
1031 Ga0496126_0230333
1032 Ga0496126_0411184
1033 Ga0501031_0071939
1034 Ga0501033_0014310
1035 Ga0501034_0085034
1036 Ga0501036_0042197
1037 Ga0501036_0381820
1038 Ga0501037_0010400
1039 Ga0501038_0001188
1040 Ga0501038_0135004
1041 Ga0501039_0004304
1042 Ga0501040_0000199
1043 Ga0501040_0252198
1044 Ga0501040_0310369
1045 Ga0501040_0348079
1046 Ga0501041_0000053
1047 Ga0501041_0027147
1048 Ga0501042_0021459
1049 Ga0501043_0019650
1050 Ga0501043_0049883
1051 Ga0501046_0002982
1052 Ga0501046_0098312
1053 Ga0501047_0504362
1054 Ga0501048_0104437
1055 Ga0501067_0045583
1056 Ga0501068_0009647
1057 Ga0501068_0073926
1058 Ga0501069_0015828
1059 Ga0501070_0070852
1060 Ga0501071_0057992
1061 Ga0501071_0310631
1062 Ga0501072_0163704
1063 Ga0501073_0018140
1064 Ga0501073_0151846
1065 Ga0501074_0015120
1066 Ga0501074_0027613
1067 Ga0501074_0220609
1068 Ga0501075_0000657
1069 Ga0501075_0006705
1070 Ga0501075_0076889
1071 Ga0501076_0091868
1072 Ga0501076_0147953
1073 Ga0501076_0409920
1074 Ga0501077_0000756
1075 Ga0501077_0003939
1076 Ga0501079_0004874
1077 Ga0501080_0008309
1078 Ga0501080_0176031
1079 Ga0501080_0575113
1080 Ga0501081_0001710
1081 Ga0501081_0014618
1082 Ga0501081_0365194
1083 Ga0501083_0057464
1084 Ga0501083_0063854
1085 Ga0501035_0044562
1086 Ga0501044_0028389
1087 Ga0501045_0000501
1088 Ga0501045_0114015
1089 Ga0501045_0127789
1090 nmdc:mga05p37_128946_c1
1091 nmdc:mga05p37_318890_c1
1092 nmdc:mga05p37_40829_c1
1093 nmdc:mga05p37_524126_c1
1094 nmdc:mga05p37_6579_c1
1095 nmdc:mga09592_86402_c1
1096 nmdc:mga06r32_40242_c1
1097 nmdc:mga08y16_32409_c1
1098 nmdc:mga08y16_402124_c1
1099 nmdc:mga08y16_53822_c1
1100 nmdc:mga0n895_115893_c1
1101 nmdc:mga0n895_16099_c1
1102 nmdc:mga0n895_230226_c1
1103 nmdc:mga0n895_300340_c1
1104 nmdc:mga0n895_35530_c1
1105 nmdc:mga0n895_431452_c1
1106 nmdc:mga0n895_55910_c1
1107 nmdc:mga0n895_86040_c1
1108 nmdc:mga0rr50_126397_c1
1109 nmdc:mga0rr50_274127_c1
1110 nmdc:mga0rr50_4742_c1
1111 nmdc:mga0rr50_5474_c1
1112 nmdc:mga0rr50_79277_c1
1113 nmdc:mga0rr50_98909_c1
1114 nmdc:mga08x19_16424_c1
1115 nmdc:mga08x19_22185_c1
1116 nmdc:mga08x19_280881_c1
1117 nmdc:mga08x19_305865_c1
1118 nmdc:mga08x19_51596_c1
1119 nmdc:mga08x19_5513_c1
1120 nmdc:mga08x19_58124_c1
1121 nmdc:mga0a205_16094_c1
1122 nmdc:mga0a205_24150_c1
1123 nmdc:mga0a205_35403_c1
1124 nmdc:mga0a205_538_c1
1125 nmdc:mga0a205_554860_c1
1126 nmdc:mga0a205_74821_c1
1127 Ga0495601_0009890
1128 Ga0495601_0082629
1129 Ga0495612_0047835
1130 Ga0495595_0046980
1131 Ga0495619_0013390
1132 Ga0495619_0029677
1133 Ga0495619_0193821
1134 Ga0501084_0000573
1135 Ga0501084_0271267
1136 Ga0501084_0340873
1137 Ga0501084_0364134
1138 Ga0590071_001728
1139 Ga0590071_056414
1140 Ga0501082_0010944
1141 Ga0501082_0071274
1142 Ga0530510_0310501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

25

197

0.98

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

203

304

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9509 1 286
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9507 1 286
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9477 1 286
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9475 1 286
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9345 1 285
ID Description Score Start End Superfamily
1ffvF02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9846 178 282 3.30.390.50
4zohB03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9695 179 282 3.30.390.50
1ffvF02 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9662 178 282 3.30.390.50
af_Q46800_181_289_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.9647 180 285 3.30.390.50
1t3qF01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9609 2 55 3.30.43.10
ID Description Score Start End GO Terms
AF-A0A7V3ENU2-F1-model_v4 CO dehydrogenase flavoprotein C-terminal domain-containing protein 0.988 191 285 GO:0000166
AF-A0A6I1R2V8-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9854 1 249 GO:0016491
GO:0071949
AF-A0A7C3NL63-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9837 1 286 GO:0016491
GO:0071949
AF-A0A535DSG7-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9817 178 285
AF-A0A1F9A1E1-F1-model_v4 CO dehydrogenase flavoprotein C-terminal domain-containing protein 0.9808 179 279

Map