F464722
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 224 | 569 | 251 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10474286|Ga0114129_104742862 |
| Length | 266 |
| Sequence | MPRETEGVMELQGQVAIVTGGGRGIGRATALELARLGADVVVAELDKAGAERXXXXVAALGRKALAIATDVTRRGDLAAMVERTKAELGRVDVLVNNAGIYRAASNLDVTEEHWDAIMTINAKAVFFASQAVLPVMIAQKRGAIVNLASMAGKIGSKTNLPYNASKAAVISMTKSLALAHAVDGIRVNCVCPGFVETDMWKMVARDQGALLGMSAEEFTRQRASQVPLGRMERAEDVAAVIGFLASPRAGYMTGQALSVDGGLVMH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 139 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 142 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 155 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 156 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 157 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 158 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 159 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 160 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 161 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 162 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 163 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 189 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.05 |
| Rhizosphere | 98.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10002664 | 3300003911 | Bacteria | 3091 |
| 2 | Ga0065707_10002362 | 3300005295 | Bacteria | 4687 |
| 3 | Ga0065707_10154868 | 3300005295 | Bacteria | 1619 |
| 4 | Ga0070690_100386359 | 3300005330 | Bacteria | 1024 |
| 5 | Ga0070670_100010274 | 3300005331 | Bacteria | 7989 |
| 6 | Ga0068869_100006037 | 3300005334 | Bacteria | 7663 |
| 7 | Ga0068869_100021375 | 3300005334 | Bacteria | 4451 |
| 8 | Ga0068869_100212349 | 3300005334 | Bacteria | 1530 |
| 9 | Ga0070680_100000760 | 3300005336 | Bacteria | 22551 |
| 10 | Ga0070680_100052537 | 3300005336 | Bacteria | 3326 |
| 11 | Ga0070682_100000576 | 3300005337 | Bacteria | 22513 |
| 12 | Ga0068868_100067540 | 3300005338 | Bacteria | 2846 |
| 13 | Ga0070660_100015018 | 3300005339 | Bacteria | 5585 |
| 14 | Ga0070691_10014801 | 3300005341 | Bacteria | 3581 |
| 15 | Ga0070691_10160146 | 3300005341 | Bacteria | 1160 |
| 16 | Ga0070661_100010023 | 3300005344 | Bacteria | 6576 |
| 17 | Ga0070692_10066530 | 3300005345 | Bacteria | 1910 |
| 18 | Ga0070692_10151914 | 3300005345 | Bacteria | 1319 |
| 19 | Ga0070668_100370341 | 3300005347 | Bacteria | 1217 |
| 20 | Ga0070669_100045049 | 3300005353 | Bacteria | 3214 |
| 21 | Ga0070669_100075120 | 3300005353 | Bacteria | 2506 |
| 22 | Ga0070669_100184261 | 3300005353 | Bacteria | 1635 |
| 23 | Ga0070659_100001314 | 3300005366 | Bacteria | 18007 |
| 24 | Ga0070703_10019267 | 3300005406 | Bacteria | 1978 |
| 25 | Ga0070703_10033763 | 3300005406 | Bacteria | 1559 |
| 26 | Ga0070709_10194395 | 3300005434 | Bacteria | 1433 |
| 27 | Ga0070713_100093895 | 3300005436 | Bacteria | 2585 |
| 28 | Ga0070710_10096970 | 3300005437 | Bacteria | 1748 |
| 29 | Ga0070705_100013522 | 3300005440 | Bacteria | 4177 |
| 30 | Ga0070705_100370725 | 3300005440 | Bacteria | 1050 |
| 31 | Ga0070705_100433594 | 3300005440 | Bacteria | 982 |
| 32 | Ga0070700_100033620 | 3300005441 | Bacteria | 3090 |
| 33 | Ga0070700_100149350 | 3300005441 | Bacteria | 1597 |
| 34 | Ga0070700_100157761 | 3300005441 | Bacteria | 1559 |
| 35 | Ga0070694_100069442 | 3300005444 | Bacteria | 2424 |
| 36 | Ga0070694_100136842 | 3300005444 | Bacteria | 1776 |
| 37 | Ga0070694_100385712 | 3300005444 | Bacteria | 1094 |
| 38 | Ga0070708_100010003 | 3300005445 | Bacteria | 7674 |
| 39 | Ga0070708_100016993 | 3300005445 | Bacteria | 6055 |
| 40 | Ga0070708_100030939 | 3300005445 | Bacteria | 4630 |
| 41 | Ga0070708_100405866 | 3300005445 | Bacteria | 1285 |
| 42 | Ga0070663_100022880 | 3300005455 | Bacteria | 4183 |
| 43 | Ga0070662_100340349 | 3300005457 | Bacteria | 1227 |
| 44 | Ga0070681_10330952 | 3300005458 | Bacteria | 1433 |
| 45 | Ga0070681_10354790 | 3300005458 | Bacteria | 1377 |
| 46 | Ga0068867_100023240 | 3300005459 | Bacteria | 4438 |
| 47 | Ga0068867_100126813 | 3300005459 | Bacteria | 1979 |
| 48 | Ga0070706_100015079 | 3300005467 | Bacteria | 7139 |
| 49 | Ga0070706_100032255 | 3300005467 | Bacteria | 4832 |
| 50 | Ga0070706_100037818 | 3300005467 | Bacteria | 4456 |
| 51 | Ga0070706_100105679 | 3300005467 | Bacteria | 2619 |
| 52 | Ga0070706_100119502 | 3300005467 | Bacteria | 2456 |
| 53 | Ga0070706_100351685 | 3300005467 | Bacteria | 1373 |
| 54 | Ga0070707_100004351 | 3300005468 | Bacteria | 13272 |
| 55 | Ga0070707_100035375 | 3300005468 | Unclassified | 4764 |
| 56 | Ga0070707_100066676 | 3300005468 | Bacteria | 3460 |
| 57 | Ga0070707_100098328 | 3300005468 | Bacteria | 2834 |
| 58 | Ga0070707_100359352 | 3300005468 | Bacteria | 1415 |
| 59 | Ga0070707_100497676 | 3300005468 | Bacteria | 1180 |
| 60 | Ga0070698_100021719 | 3300005471 | Bacteria | 6720 |
| 61 | Ga0070698_100041112 | 3300005471 | Bacteria | 4748 |
| 62 | Ga0070698_100084836 | 3300005471 | Bacteria | 3155 |
| 63 | Ga0070698_100178249 | 3300005471 | Unclassified | 2064 |
| 64 | Ga0070698_100278315 | 3300005471 | Bacteria | 1605 |
| 65 | Ga0070698_100494405 | 3300005471 | Bacteria | 1161 |
| 66 | Ga0070699_100001996 | 3300005518 | Bacteria | 18409 |
| 67 | Ga0070699_100013157 | 3300005518 | Bacteria | 7135 |
| 68 | Ga0070699_100013971 | 3300005518 | Bacteria | 6907 |
| 69 | Ga0070699_100016965 | 3300005518 | Bacteria | 6251 |
| 70 | Ga0070699_100080611 | 3300005518 | Bacteria | 2837 |
| 71 | Ga0070699_100461149 | 3300005518 | Bacteria | 1152 |
| 72 | Ga0070699_100644703 | 3300005518 | Bacteria | 967 |
| 73 | Ga0070697_100000352 | 3300005536 | Bacteria | 36213 |
| 74 | Ga0070697_100036933 | 3300005536 | Bacteria | 3946 |
| 75 | Ga0070697_100060327 | 3300005536 | Bacteria | 3091 |
| 76 | Ga0070697_100100908 | 3300005536 | Bacteria | 2398 |
| 77 | Ga0070697_100104836 | 3300005536 | Bacteria | 2351 |
| 78 | Ga0070697_100301253 | 3300005536 | Bacteria | 1378 |
| 79 | Ga0068853_100010427 | 3300005539 | Bacteria | 7519 |
| 80 | Ga0070695_100005280 | 3300005545 | Bacteria | 7607 |
| 81 | Ga0070695_100052947 | 3300005545 | Bacteria | 2610 |
| 82 | Ga0070695_100142521 | 3300005545 | Bacteria | 1663 |
| 83 | Ga0070696_100000633 | 3300005546 | Bacteria | 22426 |
| 84 | Ga0070696_100019756 | 3300005546 | Bacteria | 4565 |
| 85 | Ga0070696_100055165 | 3300005546 | Bacteria | 2771 |
| 86 | Ga0070696_100184857 | 3300005546 | Bacteria | 1548 |
| 87 | Ga0070693_100001427 | 3300005547 | Bacteria | 10789 |
| 88 | Ga0070704_100010857 | 3300005549 | Bacteria | 5556 |
| 89 | Ga0070704_100787945 | 3300005549 | Bacteria | 848 |
| 90 | Ga0068855_100002556 | 3300005563 | Bacteria | 22426 |
| 91 | Ga0070664_100038039 | 3300005564 | Bacteria | 4048 |
| 92 | Ga0068857_100015869 | 3300005577 | Bacteria | 6592 |
| 93 | Ga0068857_100065521 | 3300005577 | Bacteria | 3231 |
| 94 | Ga0068857_100079276 | 3300005577 | Bacteria | 2932 |
| 95 | Ga0068854_100005247 | 3300005578 | Bacteria | 8174 |
| 96 | Ga0068856_100006151 | 3300005614 | Bacteria | 11778 |
| 97 | Ga0068859_100191402 | 3300005617 | Bacteria | 2130 |
| 98 | Ga0068864_100083860 | 3300005618 | Bacteria | 2799 |
| 99 | Ga0068864_100145596 | 3300005618 | Bacteria | 2141 |
| 100 | Ga0068866_10251868 | 3300005718 | Bacteria | 1081 |
| 101 | Ga0068861_100018437 | 3300005719 | Bacteria | 4972 |
| 102 | Ga0068861_100629091 | 3300005719 | Bacteria | 989 |
| 103 | Ga0068870_10002863 | 3300005840 | Bacteria | 7259 |
| 104 | Ga0068870_10128167 | 3300005840 | Bacteria | 1470 |
| 105 | Ga0068863_100048853 | 3300005841 | Bacteria | 4011 |
| 106 | Ga0068858_100098485 | 3300005842 | Bacteria | 2726 |
| 107 | Ga0068858_100098762 | 3300005842 | Bacteria | 2722 |
| 108 | Ga0068858_100165090 | 3300005842 | Bacteria | 2086 |
| 109 | Ga0068860_100153741 | 3300005843 | Bacteria | 2217 |
| 110 | Ga0068860_100239173 | 3300005843 | Bacteria | 1766 |
| 111 | Ga0068860_100526227 | 3300005843 | Bacteria | 1183 |
| 112 | Ga0068862_100075931 | 3300005844 | Bacteria | 2908 |
| 113 | Ga0068862_100193739 | 3300005844 | Bacteria | 1830 |
| 114 | Ga0068862_100271736 | 3300005844 | Bacteria | 1550 |
| 115 | Ga0068862_100304193 | 3300005844 | Bacteria | 1468 |
| 116 | Ga0068862_100330435 | 3300005844 | Bacteria | 1409 |
| 117 | Ga0081455_10000411 | 3300005937 | Bacteria | 56303 |
| 118 | Ga0081455_10059776 | 3300005937 | Bacteria | 3216 |
| 119 | Ga0081538_10006480 | 3300005981 | Bacteria | 10301 |
| 120 | Ga0081538_10048880 | 3300005981 | Bacteria | 2573 |
| 121 | Ga0081538_10092478 | 3300005981 | Bacteria | 1557 |
| 122 | Ga0081538_10094691 | 3300005981 | Bacteria | 1528 |
| 123 | Ga0081540_1018028 | 3300005983 | Bacteria | 4346 |
| 124 | Ga0081539_10000083 | 3300005985 | Bacteria | 218881 |
| 125 | Ga0070717_10346012 | 3300006028 | Bacteria | 1328 |
| 126 | Ga0070712_100013947 | 3300006175 | Bacteria | 5148 |
| 127 | Ga0075428_100000136 | 3300006844 | Bacteria | 64933 |
| 128 | Ga0075428_100000176 | 3300006844 | Bacteria | 59684 |
| 129 | Ga0075428_100006989 | 3300006844 | Bacteria | 12517 |
| 130 | Ga0075428_100011008 | 3300006844 | Bacteria | 10059 |
| 131 | Ga0075428_100033421 | 3300006844 | Bacteria | 5680 |
| 132 | Ga0075428_100052536 | 3300006844 | Bacteria | 4466 |
| 133 | Ga0075428_100110125 | 3300006844 | Bacteria | 3000 |
| 134 | Ga0075428_100394630 | 3300006844 | Bacteria | 1483 |
| 135 | Ga0075428_100404442 | 3300006844 | Bacteria | 1463 |
| 136 | Ga0075430_100000813 | 3300006846 | Bacteria | 24298 |
| 137 | Ga0075430_100003852 | 3300006846 | Bacteria | 12635 |
| 138 | Ga0075430_100008443 | 3300006846 | Bacteria | 8704 |
| 139 | Ga0075430_100013412 | 3300006846 | Bacteria | 6985 |
| 140 | Ga0075430_100218626 | 3300006846 | Bacteria | 1581 |
| 141 | Ga0075430_100405406 | 3300006846 | Bacteria | 1125 |
| 142 | Ga0075431_100000061 | 3300006847 | Bacteria | 61386 |
| 143 | Ga0075431_100002555 | 3300006847 | Bacteria | 17564 |
| 144 | Ga0075431_100002933 | 3300006847 | Bacteria | 16517 |
| 145 | Ga0075431_100003953 | 3300006847 | Bacteria | 14440 |
| 146 | Ga0075431_100005544 | 3300006847 | Bacteria | 12458 |
| 147 | Ga0075431_100005602 | 3300006847 | Bacteria | 12402 |
| 148 | Ga0075431_100063427 | 3300006847 | Bacteria | 3813 |
| 149 | Ga0075431_100565111 | 3300006847 | Bacteria | 1124 |
| 150 | Ga0075431_100669665 | 3300006847 | Bacteria | 1017 |
| 151 | Ga0075433_10003076 | 3300006852 | Bacteria | 12819 |
| 152 | Ga0075433_10010743 | 3300006852 | Bacteria | 7364 |
| 153 | Ga0075433_10010749 | 3300006852 | Bacteria | 7361 |
| 154 | Ga0075433_10016394 | 3300006852 | Bacteria | 6105 |
| 155 | Ga0075433_10027291 | 3300006852 | Bacteria | 4841 |
| 156 | Ga0075433_10041664 | 3300006852 | Bacteria | 3979 |
| 157 | Ga0075433_10067125 | 3300006852 | Bacteria | 3148 |
| 158 | Ga0075433_10099954 | 3300006852 | Bacteria | 2568 |
| 159 | Ga0075433_10102366 | 3300006852 | Bacteria | 2536 |
| 160 | Ga0075433_10178939 | 3300006852 | Bacteria | 1887 |
| 161 | Ga0075433_10271500 | 3300006852 | Bacteria | 1503 |
| 162 | Ga0075433_10649871 | 3300006852 | Bacteria | 925 |
| 163 | Ga0075434_100000404 | 3300006871 | Bacteria | 31777 |
| 164 | Ga0075434_100013058 | 3300006871 | Bacteria | 7887 |
| 165 | Ga0075434_100109151 | 3300006871 | Bacteria | 2777 |
| 166 | Ga0075434_100117773 | 3300006871 | Bacteria | 2669 |
| 167 | Ga0075434_100136042 | 3300006871 | Bacteria | 2476 |
| 168 | Ga0075434_100202773 | 3300006871 | Bacteria | 2004 |
| 169 | Ga0075429_100000739 | 3300006880 | Bacteria | 25629 |
| 170 | Ga0075429_100028874 | 3300006880 | Bacteria | 4818 |
| 171 | Ga0075429_100030126 | 3300006880 | Bacteria | 4714 |
| 172 | Ga0075429_100108151 | 3300006880 | Bacteria | 2430 |
| 173 | Ga0075429_100136700 | 3300006880 | Bacteria | 2145 |
| 174 | Ga0075429_100209009 | 3300006880 | Bacteria | 1710 |
| 175 | Ga0075429_100471773 | 3300006880 | Bacteria | 1099 |
| 176 | Ga0075429_100480469 | 3300006880 | Bacteria | 1089 |
| 177 | Ga0075429_100502349 | 3300006880 | Bacteria | 1063 |
| 178 | Ga0068865_100430459 | 3300006881 | Bacteria | 1087 |
| 179 | Ga0075436_100002609 | 3300006914 | Bacteria | 12389 |
| 180 | Ga0075436_100017258 | 3300006914 | Bacteria | 4941 |
| 181 | Ga0075436_100037820 | 3300006914 | Bacteria | 3332 |
| 182 | Ga0075436_100476898 | 3300006914 | Bacteria | 911 |
| 183 | Ga0097620_100191413 | 3300006931 | Bacteria | 2130 |
| 184 | Ga0075435_100006024 | 3300007076 | Bacteria | 8538 |
| 185 | Ga0075435_100009151 | 3300007076 | Bacteria | 7150 |
| 186 | Ga0075435_100013417 | 3300007076 | Bacteria | 6095 |
| 187 | Ga0075435_100027634 | 3300007076 | Bacteria | 4441 |
| 188 | Ga0075435_100048090 | 3300007076 | Bacteria | 3426 |
| 189 | Ga0075435_100066977 | 3300007076 | Bacteria | 2923 |
| 190 | Ga0075435_100108626 | 3300007076 | Bacteria | 2305 |
| 191 | Ga0075435_100276348 | 3300007076 | Bacteria | 1433 |
| 192 | Ga0099794_10002483 | 3300007265 | Bacteria | 6806 |
| 193 | Ga0099794_10109786 | 3300007265 | Bacteria | 1381 |
| 194 | Ga0099795_10124545 | 3300007788 | Bacteria | 1034 |
| 195 | Ga0111539_10000715 | 3300009094 | Bacteria | 43156 |
| 196 | Ga0111539_10000988 | 3300009094 | Bacteria | 37262 |
| 197 | Ga0111539_10011434 | 3300009094 | Bacteria | 11142 |
| 198 | Ga0111539_10014429 | 3300009094 | Bacteria | 9861 |
| 199 | Ga0111539_10150951 | 3300009094 | Bacteria | 2719 |
| 200 | Ga0105245_10677664 | 3300009098 | Bacteria | 1063 |
| 201 | Ga0105247_10320765 | 3300009101 | Bacteria | 1081 |
| 202 | Ga0114129_10000847 | 3300009147 | Bacteria | 39608 |
| 203 | Ga0114129_10003560 | 3300009147 | Bacteria | 21926 |
| 204 | Ga0114129_10006715 | 3300009147 | Bacteria | 16338 |
| 205 | Ga0114129_10009764 | 3300009147 | Bacteria | 13684 |
| 206 | Ga0114129_10011521 | 3300009147 | Bacteria | 12592 |
| 207 | Ga0114129_10019275 | 3300009147 | Bacteria | 9717 |
| 208 | Ga0114129_10036621 | 3300009147 | Bacteria | 6927 |
| 209 | Ga0114129_10038128 | 3300009147 | Bacteria | 6781 |
| 210 | Ga0114129_10040737 | 3300009147 | Bacteria | 6547 |
| 211 | Ga0114129_10042610 | 3300009147 | Bacteria | 6390 |
| 212 | Ga0114129_10092345 | 3300009147 | Bacteria | 4194 |
| 213 | Ga0114129_10142971 | 3300009147 | Bacteria | 3278 |
| 214 | Ga0114129_10203024 | 3300009147 | Bacteria | 2683 |
| 215 | Ga0114129_10268708 | 3300009147 | Bacteria | 2282 |
| 216 | Ga0114129_10409453 | 3300009147 | Bacteria | 1786 |
| 217 | Ga0114129_10474286 | 3300009147 | Bacteria | 1638 |
| 218 | Ga0114129_10588943 | 3300009147 | Bacteria | 1442 |
| 219 | Ga0114129_11159610 | 3300009147 | Bacteria | 964 |
| 220 | Ga0114129_11219138 | 3300009147 | Bacteria | 936 |
| 221 | Ga0105243_10021187 | 3300009148 | Bacteria | 4933 |
| 222 | Ga0105243_10089083 | 3300009148 | Bacteria | 2536 |
| 223 | Ga0105243_10193877 | 3300009148 | Bacteria | 1777 |
| 224 | Ga0105243_10383788 | 3300009148 | Bacteria | 1300 |
| 225 | Ga0105241_10003228 | 3300009174 | Bacteria | 12131 |
| 226 | Ga0105241_10436654 | 3300009174 | Bacteria | 1155 |
| 227 | Ga0105242_10013532 | 3300009176 | Bacteria | 6309 |
| 228 | Ga0105249_10101021 | 3300009553 | Bacteria | 2712 |
| 229 | Ga0105249_10180012 | 3300009553 | Bacteria | 2056 |
| 230 | Ga0105249_10287600 | 3300009553 | Bacteria | 1644 |
| 231 | Ga0105249_10327155 | 3300009553 | Bacteria | 1545 |
| 232 | Ga0099796_10078649 | 3300010159 | Bacteria | 1205 |
| 233 | Ga0105239_10121292 | 3300010375 | Bacteria | 2904 |
| 234 | Ga0105246_10182810 | 3300011119 | Bacteria | 1616 |
| 235 | Ga0157373_10003300 | 3300013100 | Bacteria | 12193 |
| 236 | Ga0163162_10036621 | 3300013306 | Bacteria | 4892 |
| 237 | Ga0163162_10190710 | 3300013306 | Bacteria | 2177 |
| 238 | Ga0163162_10421869 | 3300013306 | Bacteria | 1466 |
| 239 | Ga0163162_10853799 | 3300013306 | Bacteria | 1025 |
| 240 | Ga0163162_11108454 | 3300013306 | Bacteria | 897 |
| 241 | Ga0157372_10009405 | 3300013307 | Bacteria | 10396 |
| 242 | Ga0157375_10789909 | 3300013308 | Bacteria | 1098 |
| 243 | Ga0157380_10703356 | 3300014326 | Bacteria | 1016 |
| 244 | Ga0157380_11087757 | 3300014326 | Bacteria | 838 |
| 245 | Ga0157379_10053779 | 3300014968 | Bacteria | 3597 |
| 246 | Ga0157379_10208994 | 3300014968 | Bacteria | 1766 |
| 247 | Ga0182007_10013413 | 3300015262 | Bacteria | 3125 |
| 248 | Ga0207653_10007017 | 3300025885 | Bacteria | 3516 |
| 249 | Ga0207645_10018926 | 3300025907 | Bacteria | 4522 |
| 250 | Ga0207645_10196909 | 3300025907 | Bacteria | 1325 |
| 251 | Ga0207643_10003668 | 3300025908 | Bacteria | 8275 |
| 252 | Ga0207643_10173079 | 3300025908 | Bacteria | 1304 |
| 253 | Ga0207684_10000566 | 3300025910 | Bacteria | 45187 |
| 254 | Ga0207684_10009022 | 3300025910 | Bacteria | 8839 |
| 255 | Ga0207684_10013553 | 3300025910 | Bacteria | 7050 |
| 256 | Ga0207684_10054361 | 3300025910 | Bacteria | 3397 |
| 257 | Ga0207684_10074444 | 3300025910 | Bacteria | 2885 |
| 258 | Ga0207684_10097849 | 3300025910 | Bacteria | 2505 |
| 259 | Ga0207684_10121595 | 3300025910 | Bacteria | 2238 |
| 260 | Ga0207684_10142825 | 3300025910 | Bacteria | 2058 |
| 261 | Ga0207654_10124269 | 3300025911 | Bacteria | 1625 |
| 262 | Ga0207654_10371744 | 3300025911 | Bacteria | 988 |
| 263 | Ga0207707_10000056 | 3300025912 | Bacteria | 113344 |
| 264 | Ga0207707_10254187 | 3300025912 | Bacteria | 1526 |
| 265 | Ga0207693_10003246 | 3300025915 | Bacteria | 13955 |
| 266 | Ga0207693_10035398 | 3300025915 | Bacteria | 3937 |
| 267 | Ga0207660_10289789 | 3300025917 | Bacteria | 1301 |
| 268 | Ga0207657_10000306 | 3300025919 | Bacteria | 51970 |
| 269 | Ga0207649_10006470 | 3300025920 | Bacteria | 6362 |
| 270 | Ga0207652_10002550 | 3300025921 | Bacteria | 15297 |
| 271 | Ga0207652_10561556 | 3300025921 | Bacteria | 1025 |
| 272 | Ga0207646_10000948 | 3300025922 | Bacteria | 37329 |
| 273 | Ga0207646_10007532 | 3300025922 | Bacteria | 11044 |
| 274 | Ga0207646_10012657 | 3300025922 | Bacteria | 8097 |
| 275 | Ga0207646_10062196 | 3300025922 | Bacteria | 3333 |
| 276 | Ga0207646_10110506 | 3300025922 | Bacteria | 2466 |
| 277 | Ga0207646_10256011 | 3300025922 | Bacteria | 1582 |
| 278 | Ga0207646_10269474 | 3300025922 | Bacteria | 1539 |
| 279 | Ga0207646_10370563 | 3300025922 | Bacteria | 1294 |
| 280 | Ga0207681_10014687 | 3300025923 | Bacteria | 4875 |
| 281 | Ga0207681_10035929 | 3300025923 | Bacteria | 3266 |
| 282 | Ga0207681_10369393 | 3300025923 | Bacteria | 1152 |
| 283 | Ga0207687_10419317 | 3300025927 | Bacteria | 1104 |
| 284 | Ga0207664_10223286 | 3300025929 | Bacteria | 1635 |
| 285 | Ga0207690_10011140 | 3300025932 | Bacteria | 5366 |
| 286 | Ga0207706_10235849 | 3300025933 | Bacteria | 1600 |
| 287 | Ga0207709_10008877 | 3300025935 | Bacteria | 5548 |
| 288 | Ga0207709_10328912 | 3300025935 | Bacteria | 1147 |
| 289 | Ga0207704_10307805 | 3300025938 | Bacteria | 1217 |
| 290 | Ga0207691_10015290 | 3300025940 | Bacteria | 7302 |
| 291 | Ga0207691_10033639 | 3300025940 | Bacteria | 4773 |
| 292 | Ga0207689_10017813 | 3300025942 | Bacteria | 6002 |
| 293 | Ga0207689_10020104 | 3300025942 | Bacteria | 5622 |
| 294 | Ga0207689_10024260 | 3300025942 | Bacteria | 5088 |
| 295 | Ga0207661_10786064 | 3300025944 | Bacteria | 876 |
| 296 | Ga0207679_10023975 | 3300025945 | Bacteria | 4179 |
| 297 | Ga0207667_10004946 | 3300025949 | Bacteria | 16274 |
| 298 | Ga0207651_10212295 | 3300025960 | Bacteria | 1559 |
| 299 | Ga0207712_10105510 | 3300025961 | Bacteria | 2103 |
| 300 | Ga0207712_10157312 | 3300025961 | Bacteria | 1762 |
| 301 | Ga0207712_10459295 | 3300025961 | Bacteria | 1082 |
| 302 | Ga0207668_10336284 | 3300025972 | Bacteria | 1258 |
| 303 | Ga0207677_10164913 | 3300026023 | Bacteria | 1726 |
| 304 | Ga0207703_10067126 | 3300026035 | Bacteria | 2952 |
| 305 | Ga0207703_10075319 | 3300026035 | Bacteria | 2797 |
| 306 | Ga0207639_10011217 | 3300026041 | Bacteria | 6216 |
| 307 | Ga0207678_10037207 | 3300026067 | Bacteria | 4234 |
| 308 | Ga0207708_10096551 | 3300026075 | Bacteria | 2284 |
| 309 | Ga0207708_10098046 | 3300026075 | Bacteria | 2265 |
| 310 | Ga0207708_10111939 | 3300026075 | Bacteria | 2120 |
| 311 | Ga0207708_10334691 | 3300026075 | Bacteria | 1238 |
| 312 | Ga0207702_10005604 | 3300026078 | Bacteria | 10958 |
| 313 | Ga0207641_10030042 | 3300026088 | Bacteria | 4499 |
| 314 | Ga0207641_10144558 | 3300026088 | Bacteria | 2149 |
| 315 | Ga0207648_10003466 | 3300026089 | Bacteria | 16541 |
| 316 | Ga0207648_10279191 | 3300026089 | Bacteria | 1493 |
| 317 | Ga0207674_10038305 | 3300026116 | Bacteria | 4978 |
| 318 | Ga0207674_10092257 | 3300026116 | Bacteria | 3018 |
| 319 | Ga0207674_10104086 | 3300026116 | Bacteria | 2817 |
| 320 | Ga0207675_100009557 | 3300026118 | Bacteria | 9068 |
| 321 | Ga0207675_100032298 | 3300026118 | Bacteria | 4875 |
| 322 | Ga0209971_1024648 | 3300027682 | Bacteria | 1436 |
| 323 | Ga0209971_1032359 | 3300027682 | Bacteria | 1255 |
| 324 | Ga0207428_10000631 | 3300027907 | Bacteria | 41443 |
| 325 | Ga0207428_10029258 | 3300027907 | Bacteria | 4568 |
| 326 | Ga0207428_10203504 | 3300027907 | Bacteria | 1489 |
| 327 | Ga0207428_10203922 | 3300027907 | Bacteria | 1488 |
| 328 | Ga0268265_10174361 | 3300028380 | Bacteria | 1841 |
| 329 | Ga0268265_10178033 | 3300028380 | Bacteria | 1824 |
| 330 | Ga0268265_10218322 | 3300028380 | Bacteria | 1666 |
| 331 | Ga0268265_10609919 | 3300028380 | Bacteria | 1044 |
| 332 | Ga0268264_10099197 | 3300028381 | Bacteria | 2527 |
| 333 | Ga0268264_10130013 | 3300028381 | Bacteria | 2230 |
| 334 | Ga0268264_10156617 | 3300028381 | Unclassified | 2048 |
| 335 | Ga0307408_100032622 | 3300031548 | Bacteria | 3632 |
| 336 | Ga0307408_100136295 | 3300031548 | Bacteria | 1921 |
| 337 | Ga0307408_100177142 | 3300031548 | Bacteria | 1707 |
| 338 | Ga0307408_100231905 | 3300031548 | Bacteria | 1512 |
| 339 | Ga0307405_10413840 | 3300031731 | Bacteria | 1059 |
| 340 | Ga0307410_10067961 | 3300031852 | Bacteria | 2460 |
| 341 | Ga0307406_10242178 | 3300031901 | Bacteria | 1353 |
| 342 | Ga0307407_10522664 | 3300031903 | Bacteria | 873 |
| 343 | Ga0307409_100092962 | 3300031995 | Bacteria | 2477 |
| 344 | Ga0307409_100185056 | 3300031995 | Bacteria | 1848 |
| 345 | Ga0307416_100030872 | 3300032002 | Bacteria | 4027 |
| 346 | Ga0307411_10137337 | 3300032005 | Bacteria | 1797 |
| 347 | Ga0307415_100298298 | 3300032126 | Bacteria | 1334 |
| 348 | Ga0373948_0006772 | 3300034817 | Bacteria | 1907 |
| 349 | Ga0373958_0008796 | 3300034819 | Bacteria | 1646 |
| 350 | Ga0373928_0064619 | 3300035084 | Bacteria | 892 |
| 351 | Ga0373929_0056057 | 3300035085 | Bacteria | 912 |
| 352 | Ga0373940_0017138 | 3300035088 | Bacteria | 1804 |
| 353 | Ga0373940_0053525 | 3300035088 | Bacteria | 1139 |
| 354 | Ga0373932_0058930 | 3300035112 | Bacteria | 1162 |
| 355 | Ga0373939_0012710 | 3300035114 | Bacteria | 2152 |
| 356 | Ga0373939_0034440 | 3300035114 | Bacteria | 1486 |
| 357 | Ga0373941_0124474 | 3300035115 | Bacteria | 922 |
| 358 | Ga0373955_0091241 | 3300035172 | Bacteria | 1736 |
| 359 | Ga0373962_0003976 | 3300035242 | Bacteria | 3560 |
| 360 | Ga0373931_0002462 | 3300035691 | Bacteria | 8202 |
| 361 | Ga0373931_0014161 | 3300035691 | Bacteria | 3895 |
| 362 | Ga0373931_0025011 | 3300035691 | Bacteria | 3031 |
| 363 | Ga0373933_0212673 | 3300035724 | Bacteria | 1239 |
| 364 | Ga0395899_0109495 | 3300037312 | Bacteria | 1987 |
| 365 | Ga0395900_0069327 | 3300037418 | Bacteria | 3624 |
| 366 | Ga0395898_0006319 | 3300037466 | Bacteria | 12657 |
| 367 | Ga0395901_0018617 | 3300038443 | Bacteria | 7093 |
| 368 | Ga0242420_005053 | 3300038996 | Bacteria | 2025 |
| 369 | Ga0436360_1132788 | 3300039438 | Bacteria | 2237 |
| 370 | Ga0436361_0287624 | 3300039447 | Bacteria | 2141 |
| 371 | Ga0436361_0473175 | 3300039447 | Bacteria | 1620 |
| 372 | Ga0436362_0719549 | 3300039453 | Bacteria | 2973 |
| 373 | Ga0436362_1277602 | 3300039453 | Bacteria | 2225 |
| 374 | Ga0439448_0002910 | 3300042005 | Bacteria | 4694 |
| 375 | Ga0439446_0043444 | 3300042156 | Bacteria | 1328 |
| 376 | Ga0439459_0001197 | 3300042438 | Bacteria | 3784 |
| 377 | Ga0439460_0055316 | 3300042461 | Bacteria | 1199 |
| 378 | Ga0451577_0003386 | 3300042876 | Bacteria | 17836 |
| 379 | Ga0451577_0115739 | 3300042876 | Bacteria | 2401 |
| 380 | Ga0451577_0381527 | 3300042876 | Bacteria | 1279 |
| 381 | Ga0451577_0780446 | 3300042876 | Bacteria | 863 |
| 382 | Ga0453684_0039914 | 3300044712 | Bacteria | 6384 |
| 383 | Ga0451576_0008215 | 3300045051 | Bacteria | 12282 |
| 384 | Ga0451576_0014614 | 3300045051 | Bacteria | 8725 |
| 385 | Ga0451576_0173678 | 3300045051 | Bacteria | 2249 |
| 386 | Ga0451576_0261071 | 3300045051 | Bacteria | 1810 |
| 387 | Ga0451576_0276457 | 3300045051 | Bacteria | 1756 |
| 388 | Ga0451576_0557773 | 3300045051 | Bacteria | 1203 |
| 389 | Ga0495592_0238744 | 3300046454 | Bacteria | 1207 |
| 390 | Ga0495580_0000719 | 3300046472 | Bacteria | 28283 |
| 391 | Ga0495664_0147786 | 3300046477 | Bacteria | 1425 |
| 392 | Ga0495584_0135346 | 3300046491 | Bacteria | 1251 |
| 393 | Ga0495608_0071871 | 3300046511 | Bacteria | 2257 |
| 394 | Ga0495628_0160573 | 3300046516 | Bacteria | 1708 |
| 395 | Ga0495642_0071644 | 3300046528 | Bacteria | 1450 |
| 396 | Ga0495640_0108072 | 3300046533 | Bacteria | 1820 |
| 397 | Ga0495587_0151328 | 3300046536 | Bacteria | 1322 |
| 398 | Ga0495667_0006813 | 3300046559 | Bacteria | 7758 |
| 399 | Ga0495656_0210400 | 3300046615 | Bacteria | 969 |
| 400 | Ga0495635_0476475 | 3300046663 | Bacteria | 823 |
| 401 | Ga0495659_0044197 | 3300046664 | Bacteria | 1601 |
| 402 | Ga0495657_0087703 | 3300046675 | Bacteria | 2002 |
| 403 | Ga0495599_0093123 | 3300046678 | Bacteria | 1880 |
| 404 | Ga0495669_0028433 | 3300046684 | Bacteria | 2449 |
| 405 | Ga0495669_0084786 | 3300046684 | Bacteria | 1457 |
| 406 | Ga0495674_0126303 | 3300047319 | Bacteria | 2158 |
| 407 | Ga0495680_0130519 | 3300047322 | Bacteria | 1847 |
| 408 | Ga0495675_0157974 | 3300047444 | Bacteria | 1397 |
| 409 | Ga0495684_0160671 | 3300047471 | Bacteria | 1676 |
| 410 | Ga0495602_0033380 | 3300048088 | Bacteria | 4828 |
| 411 | Ga0496102_0170442 | 3300048905 | Bacteria | 2049 |
| 412 | Ga0496103_0025766 | 3300048906 | Bacteria | 3557 |
| 413 | Ga0496105_0402525 | 3300048908 | Bacteria | 1086 |
| 414 | Ga0496106_0221179 | 3300048909 | Bacteria | 1510 |
| 415 | Ga0496106_0226817 | 3300048909 | Bacteria | 1491 |
| 416 | Ga0496112_0127246 | 3300048915 | Bacteria | 2518 |
| 417 | Ga0501031_0150816 | 3300049568 | Bacteria | 1519 |
| 418 | Ga0501036_0017276 | 3300049572 | Bacteria | 6030 |
| 419 | Ga0501036_0187049 | 3300049572 | Bacteria | 1743 |
| 420 | Ga0501036_0251842 | 3300049572 | Bacteria | 1480 |
| 421 | Ga0501038_0326733 | 3300049574 | Bacteria | 1199 |
| 422 | Ga0501040_0001722 | 3300049576 | Bacteria | 14034 |
| 423 | Ga0501040_0015346 | 3300049576 | Bacteria | 5066 |
| 424 | Ga0501040_0074384 | 3300049576 | Bacteria | 2348 |
| 425 | Ga0501041_0144029 | 3300049577 | Bacteria | 1487 |
| 426 | Ga0501041_0200304 | 3300049577 | Bacteria | 1251 |
| 427 | Ga0501042_0159885 | 3300049578 | Bacteria | 1625 |
| 428 | Ga0501042_0167283 | 3300049578 | Bacteria | 1586 |
| 429 | Ga0501043_0285299 | 3300049579 | Bacteria | 1265 |
| 430 | Ga0501043_0360030 | 3300049579 | Bacteria | 1104 |
| 431 | Ga0501046_0236893 | 3300049580 | Bacteria | 1347 |
| 432 | Ga0501048_0110168 | 3300049582 | Bacteria | 1944 |
| 433 | Ga0501048_0471037 | 3300049582 | Bacteria | 900 |
| 434 | Ga0501069_0006893 | 3300049585 | Bacteria | 5939 |
| 435 | Ga0501071_0035691 | 3300049587 | Bacteria | 3543 |
| 436 | Ga0501071_0082215 | 3300049587 | Bacteria | 2358 |
| 437 | Ga0501072_0023067 | 3300049588 | Bacteria | 4832 |
| 438 | Ga0501072_0046125 | 3300049588 | Bacteria | 3428 |
| 439 | Ga0501072_0054393 | 3300049588 | Bacteria | 3153 |
| 440 | Ga0501072_0155942 | 3300049588 | Bacteria | 1821 |
| 441 | Ga0501072_0202838 | 3300049588 | Bacteria | 1581 |
| 442 | Ga0501072_0369273 | 3300049588 | Bacteria | 1139 |
| 443 | Ga0501072_0383404 | 3300049588 | Bacteria | 1115 |
| 444 | Ga0501072_0423031 | 3300049588 | Bacteria | 1056 |
| 445 | Ga0501073_0332027 | 3300049589 | Bacteria | 1050 |
| 446 | Ga0501074_0196933 | 3300049590 | Bacteria | 1436 |
| 447 | Ga0501074_0205915 | 3300049590 | Bacteria | 1402 |
| 448 | Ga0501074_0319903 | 3300049590 | Bacteria | 1102 |
| 449 | Ga0501075_0032000 | 3300049591 | Bacteria | 3907 |
| 450 | Ga0501075_0050613 | 3300049591 | Bacteria | 3123 |
| 451 | Ga0501076_0056360 | 3300049592 | Bacteria | 3119 |
| 452 | Ga0501076_0201183 | 3300049592 | Bacteria | 1626 |
| 453 | Ga0501076_0607984 | 3300049592 | Bacteria | 902 |
| 454 | Ga0501077_0016474 | 3300049593 | Bacteria | 4657 |
| 455 | Ga0501077_0031103 | 3300049593 | Bacteria | 3395 |
| 456 | Ga0501077_0248959 | 3300049593 | Bacteria | 1130 |
| 457 | Ga0501079_0006563 | 3300049741 | Bacteria | 8748 |
| 458 | Ga0501079_0023810 | 3300049741 | Bacteria | 4698 |
| 459 | Ga0501079_0320853 | 3300049741 | Bacteria | 1213 |
| 460 | Ga0501079_0326395 | 3300049741 | Bacteria | 1202 |
| 461 | Ga0501080_0060236 | 3300049742 | Bacteria | 3533 |
| 462 | Ga0501080_0266499 | 3300049742 | Bacteria | 1560 |
| 463 | Ga0501081_0001399 | 3300049743 | Bacteria | 14723 |
| 464 | Ga0501081_0035410 | 3300049743 | Bacteria | 3398 |
| 465 | Ga0501081_0187589 | 3300049743 | Bacteria | 1497 |
| 466 | Ga0501081_0205737 | 3300049743 | Bacteria | 1428 |
| 467 | Ga0501081_0260273 | 3300049743 | Bacteria | 1268 |
| 468 | Ga0501081_0364450 | 3300049743 | Bacteria | 1066 |
| 469 | Ga0501083_0291660 | 3300049744 | Bacteria | 1061 |
| 470 | Ga0501045_0004907 | 3300049824 | Bacteria | 9265 |
| 471 | Ga0501045_0125327 | 3300049824 | Bacteria | 1908 |
| 472 | Ga0501045_0263284 | 3300049824 | Bacteria | 1284 |
| 473 | nmdc:mga05p37_1115_c1 | 3300050507 | Bacteria | 30862 |
| 474 | nmdc:mga05p37_144398_c1 | 3300050507 | Bacteria | 2915 |
| 475 | nmdc:mga05p37_181644_c2 | 3300050507 | Bacteria | 1638 |
| 476 | nmdc:mga05p37_205798_c1 | 3300050507 | Bacteria | 2381 |
| 477 | nmdc:mga05p37_26113_c1 | 3300050507 | Bacteria | 7102 |
| 478 | nmdc:mga05p37_2666_c1 | 3300050507 | Bacteria | 20793 |
| 479 | nmdc:mga05p37_282394_c1 | 3300050507 | Bacteria | 1979 |
| 480 | nmdc:mga05p37_32895_c1 | 3300050507 | Bacteria | 6347 |
| 481 | nmdc:mga05p37_352555_c1 | 3300050507 | Bacteria | 1732 |
| 482 | nmdc:mga05p37_421958_c1 | 3300050507 | Bacteria | 1552 |
| 483 | nmdc:mga05p37_44761_c1 | 3300050507 | Bacteria | 5445 |
| 484 | nmdc:mga05p37_49840_c1 | 3300050507 | Bacteria | 5150 |
| 485 | nmdc:mga05p37_62605_c1 | 3300050507 | Bacteria | 4578 |
| 486 | nmdc:mga05p37_66563_c1 | 3300050507 | Bacteria | 4432 |
| 487 | nmdc:mga05p37_7018_c1 | 3300050507 | Bacteria | 13275 |
| 488 | nmdc:mga05p37_82108_c1 | 3300050507 | Bacteria | 3971 |
| 489 | nmdc:mga05p37_838348_c1 | 3300050507 | Bacteria | 1000 |
| 490 | nmdc:mga05p37_8685_c1 | 3300050507 | Bacteria | 12004 |
| 491 | nmdc:mga05p37_95941_c1 | 3300050507 | Bacteria | 3653 |
| 492 | nmdc:mga09592_16452_c1 | 3300050508 | Bacteria | 6050 |
| 493 | nmdc:mga09592_197142_c1 | 3300050508 | Bacteria | 1743 |
| 494 | nmdc:mga09592_22344_c1 | 3300050508 | Bacteria | 5220 |
| 495 | nmdc:mga09592_230753_c1 | 3300050508 | Bacteria | 1604 |
| 496 | nmdc:mga09592_25659_c1 | 3300050508 | Bacteria | 4880 |
| 497 | nmdc:mga09592_274842_c1 | 3300050508 | Bacteria | 1461 |
| 498 | nmdc:mga09592_291318_c1 | 3300050508 | Bacteria | 1415 |
| 499 | nmdc:mga09592_30550_c1 | 3300050508 | Bacteria | 4484 |
| 500 | nmdc:mga09592_3336_c1 | 3300050508 | Bacteria | 12983 |
| 501 | nmdc:mga09592_443704_c1 | 3300050508 | Bacteria | 1120 |
| 502 | nmdc:mga09592_476514_c1 | 3300050508 | Bacteria | 1076 |
| 503 | nmdc:mga09592_49101_c1 | 3300050508 | Bacteria | 3558 |
| 504 | nmdc:mga09592_77272_c1 | 3300050508 | Bacteria | 2832 |
| 505 | nmdc:mga09592_8095_c1 | 3300050508 | Bacteria | 8549 |
| 506 | nmdc:mga0qj67_358651_c1 | 3300050509 | Bacteria | 1178 |
| 507 | nmdc:mga0qj67_4472_c1 | 3300050509 | Bacteria | 10129 |
| 508 | nmdc:mga0qj67_48553_c1 | 3300050509 | Bacteria | 3353 |
| 509 | nmdc:mga0qj67_609_c1 | 3300050509 | Bacteria | 24498 |
| 510 | nmdc:mga0qj67_69540_c1 | 3300050509 | Bacteria | 2808 |
| 511 | nmdc:mga0qj67_71335_c2 | 3300050509 | Bacteria | 1833 |
| 512 | nmdc:mga06r32_11477_c1 | 3300050510 | Bacteria | 7980 |
| 513 | nmdc:mga06r32_176462_c1 | 3300050510 | Bacteria | 2121 |
| 514 | nmdc:mga06r32_20839_c1 | 3300050510 | Bacteria | 6041 |
| 515 | nmdc:mga06r32_270747_c1 | 3300050510 | Bacteria | 1686 |
| 516 | nmdc:mga06r32_3086_c1 | 3300050510 | Bacteria | 14908 |
| 517 | nmdc:mga06r32_319_c1 | 3300050510 | Bacteria | 40297 |
| 518 | nmdc:mga06r32_33390_c1 | 3300050510 | Bacteria | 4847 |
| 519 | nmdc:mga06r32_356225_c1 | 3300050510 | Bacteria | 1448 |
| 520 | nmdc:mga06r32_472021_c1 | 3300050510 | Bacteria | 1233 |
| 521 | nmdc:mga06r32_4823_c1 | 3300050510 | Bacteria | 12141 |
| 522 | nmdc:mga06r32_49068_c1 | 3300050510 | Bacteria | 4037 |
| 523 | nmdc:mga06r32_80429_c1 | 3300050510 | Bacteria | 3171 |
| 524 | nmdc:mga06r32_86432_c1 | 3300050510 | Bacteria | 3058 |
| 525 | nmdc:mga08y16_17679_c1 | 3300050511 | Bacteria | 7510 |
| 526 | nmdc:mga08y16_246357_c1 | 3300050511 | Bacteria | 1847 |
| 527 | nmdc:mga08y16_284684_c1 | 3300050511 | Bacteria | 1704 |
| 528 | nmdc:mga08y16_404511_c1 | 3300050511 | Bacteria | 1397 |
| 529 | nmdc:mga08y16_5741_c1 | 3300050511 | Bacteria | 13003 |
| 530 | nmdc:mga0n895_115880_c1 | 3300050512 | Bacteria | 2698 |
| 531 | nmdc:mga0n895_128409_c1 | 3300050512 | Bacteria | 2560 |
| 532 | nmdc:mga0n895_3154_c1 | 3300050512 | Bacteria | 13165 |
| 533 | nmdc:mga0n895_42081_c1 | 3300050512 | Bacteria | 4444 |
| 534 | nmdc:mga0n895_865643_c1 | 3300050512 | Bacteria | 891 |
| 535 | nmdc:mga0n895_9717_c1 | 3300050512 | Bacteria | 8436 |
| 536 | nmdc:mga0n895_992_c1 | 3300050512 | Bacteria | 20574 |
| 537 | nmdc:mga0rr50_12950_c1 | 3300050513 | Bacteria | 5410 |
| 538 | nmdc:mga0rr50_164877_c1 | 3300050513 | Bacteria | 1801 |
| 539 | nmdc:mga0rr50_27253_c1 | 3300050513 | Bacteria | 3998 |
| 540 | nmdc:mga0rr50_469_c1 | 3300050513 | Bacteria | 21469 |
| 541 | nmdc:mga0rr50_9425_c1 | 3300050513 | Bacteria | 6136 |
| 542 | nmdc:mga08x19_170810_c1 | 3300050514 | Bacteria | 1481 |
| 543 | nmdc:mga08x19_26629_c1 | 3300050514 | Bacteria | 3609 |
| 544 | nmdc:mga08x19_842_c1 | 3300050514 | Bacteria | 19460 |
| 545 | nmdc:mga0a205_103657_c1 | 3300050515 | Bacteria | 2743 |
| 546 | nmdc:mga0a205_193_c1 | 3300050515 | Bacteria | 42226 |
| 547 | nmdc:mga0a205_198_c1 | 3300050515 | Bacteria | 41752 |
| 548 | nmdc:mga0a205_20187_c2 | 3300050515 | Bacteria | 2242 |
| 549 | nmdc:mga0a205_2405_c1 | 3300050515 | Bacteria | 16511 |
| 550 | nmdc:mga0a205_3331_c2 | 3300050515 | Bacteria | 10909 |
| 551 | nmdc:mga0a205_33794_c1 | 3300050515 | Bacteria | 4904 |
| 552 | nmdc:mga0a205_33852_c1 | 3300050515 | Bacteria | 4900 |
| 553 | nmdc:mga0a205_411_c1 | 3300050515 | Bacteria | 32848 |
| 554 | nmdc:mga0a205_415374_c1 | 3300050515 | Bacteria | 1208 |
| 555 | nmdc:mga0a205_487895_c1 | 3300050515 | Bacteria | 1090 |
| 556 | nmdc:mga0a205_66395_c1 | 3300050515 | Bacteria | 3486 |
| 557 | nmdc:mga0a205_86642_c1 | 3300050515 | Bacteria | 3025 |
| 558 | nmdc:mga0a205_92134_c1 | 3300050515 | Bacteria | 2929 |
| 559 | Ga0501084_0003957 | 3300054114 | Bacteria | 12064 |
| 560 | Ga0501084_0006688 | 3300054114 | Bacteria | 9478 |
| 561 | Ga0501084_0141413 | 3300054114 | Bacteria | 2027 |
| 562 | Ga0501082_0001594 | 3300060353 | Bacteria | 20004 |
| 563 | Ga0501082_0031615 | 3300060353 | Bacteria | 4565 |
| 564 | Ga0501082_0159377 | 3300060353 | Bacteria | 1961 |
| 565 | Ga0501082_0548207 | 3300060353 | Bacteria | 1011 |
| 566 | Ga0530510_0006155 | 3300061734 | Bacteria | 8335 |
| 567 | Ga0530510_0597357 | 3300061734 | Bacteria | 839 |
| 568 | Ga0530510_0600302 | 3300061734 | Bacteria | 837 |
| 569 | Ga0530510_0638503 | 3300061734 | Bacteria | 810 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009553 | Ga0105249_10287600 | Ga0105249_102876002 | 213 |
| 2 | 3300006871 | Ga0075434_100136042 | Ga0075434_1001360421 | 214 |
| 3 | 3300007076 | Ga0075435_100013417 | Ga0075435_1000134174 | 214 |
| 4 | 3300009147 | Ga0114129_11219138 | Ga0114129_112191381 | 214 |
| 5 | 3300050507 | nmdc:mga05p37_352555_c1 | nmdc:mga05p37_352555_c1_893_1669 | 214 |
| 6 | 3300005536 | Ga0070697_100000352 | Ga0070697_10000035214 | 215 |
| 7 | 3300005468 | Ga0070707_100035375 | Ga0070707_1000353755 | 218 |
| 8 | 3300005471 | Ga0070698_100178249 | Ga0070698_1001782492 | 218 |
| 9 | 3300006880 | Ga0075429_100502349 | Ga0075429_1005023491 | 219 |
| 10 | 3300009147 | Ga0114129_10019275 | Ga0114129_100192757 | 219 |
| 11 | 3300050507 | nmdc:mga05p37_32895_c1 | nmdc:mga05p37_32895_c1_1169_1984 | 219 |
| 12 | 3300005445 | Ga0070708_100010003 | Ga0070708_1000100034 | 221 |
| 13 | 3300005546 | Ga0070696_100184857 | Ga0070696_1001848572 | 221 |
| 14 | 3300006846 | Ga0075430_100003852 | Ga0075430_10000385211 | 221 |
| 15 | 3300006847 | Ga0075431_100005602 | Ga0075431_1000056027 | 221 |
| 16 | 3300006880 | Ga0075429_100108151 | Ga0075429_1001081512 | 221 |
| 17 | 3300031548 | Ga0307408_100231905 | Ga0307408_1002319052 | 221 |
| 18 | 3300050509 | nmdc:mga0qj67_69540_c1 | nmdc:mga0qj67_69540_c1_435_1235 | 221 |
| 19 | 3300050510 | nmdc:mga06r32_270747_c1 | nmdc:mga06r32_270747_c1_52_828 | 221 |
| 20 | 3300007265 | Ga0099794_10109786 | Ga0099794_101097862 | 222 |
| 21 | 3300049572 | Ga0501036_0251842 | Ga0501036_0251842_527_1315 | 224 |
| 22 | 3300049578 | Ga0501042_0159885 | Ga0501042_0159885_159_947 | 224 |
| 23 | 3300049580 | Ga0501046_0236893 | Ga0501046_0236893_111_899 | 224 |
| 24 | 3300049582 | Ga0501048_0110168 | Ga0501048_0110168_717_1505 | 224 |
| 25 | 3300049587 | Ga0501071_0082215 | Ga0501071_0082215_755_1543 | 224 |
| 26 | 3300049588 | Ga0501072_0054393 | Ga0501072_0054393_1364_2152 | 224 |
| 27 | 3300049591 | Ga0501075_0032000 | Ga0501075_0032000_59_847 | 224 |
| 28 | 3300049592 | Ga0501076_0201183 | Ga0501076_0201183_54_830 | 224 |
| 29 | 3300049593 | Ga0501077_0031103 | Ga0501077_0031103_1712_2500 | 224 |
| 30 | 3300049741 | Ga0501079_0023810 | Ga0501079_0023810_3006_3794 | 224 |
| 31 | 3300049743 | Ga0501081_0001399 | Ga0501081_0001399_12932_13720 | 224 |
| 32 | 3300050507 | nmdc:mga05p37_838348_c1 | nmdc:mga05p37_838348_c1_62_838 | 224 |
| 33 | 3300054114 | Ga0501084_0003957 | Ga0501084_0003957_5672_6460 | 224 |
| 34 | 3300060353 | Ga0501082_0031615 | Ga0501082_0031615_613_1401 | 224 |
| 35 | 3300038996 | Ga0242420_005053 | Ga0242420_005053_1338_2015 | 225 |
| 36 | 3300006846 | Ga0075430_100013412 | Ga0075430_1000134126 | 226 |
| 37 | 3300006847 | Ga0075431_100002555 | Ga0075431_10000255511 | 226 |
| 38 | 3300006914 | Ga0075436_100037820 | Ga0075436_1000378202 | 226 |
| 39 | 3300009147 | Ga0114129_10036621 | Ga0114129_100366214 | 226 |
| 40 | 3300027682 | Ga0209971_1032359 | Ga0209971_10323592 | 226 |
| 41 | 3300050507 | nmdc:mga05p37_49840_c1 | nmdc:mga05p37_49840_c1_4089_4865 | 226 |
| 42 | 3300050508 | nmdc:mga09592_3336_c1 | nmdc:mga09592_3336_c1_8380_9156 | 226 |
| 43 | 3300050509 | nmdc:mga0qj67_48553_c1 | nmdc:mga0qj67_48553_c1_128_904 | 226 |
| 44 | 3300050510 | nmdc:mga06r32_4823_c1 | nmdc:mga06r32_4823_c1_9151_9927 | 226 |
| 45 | 3300050514 | nmdc:mga08x19_26629_c1 | nmdc:mga08x19_26629_c1_2174_2953 | 226 |
| 46 | 3300006844 | Ga0075428_100110125 | Ga0075428_1001101254 | 229 |
| 47 | 3300050511 | nmdc:mga08y16_284684_c1 | nmdc:mga08y16_284684_c1_780_1556 | 229 |
| 48 | 3300025910 | Ga0207684_10121595 | Ga0207684_101215954 | 231 |
| 49 | 3300034817 | Ga0373948_0006772 | Ga0373948_0006772_1172_1870 | 231 |
| 50 | 3300042876 | Ga0451577_0115739 | Ga0451577_0115739_1650_2348 | 231 |
| 51 | 3300049588 | Ga0501072_0155942 | Ga0501072_0155942_241_1017 | 231 |
| 52 | 3300049592 | Ga0501076_0607984 | Ga0501076_0607984_50_829 | 231 |
| 53 | 3300049743 | Ga0501081_0364450 | Ga0501081_0364450_74_850 | 231 |
| 54 | 3300049824 | Ga0501045_0125327 | Ga0501045_0125327_623_1399 | 231 |
| 55 | 3300060353 | Ga0501082_0159377 | Ga0501082_0159377_1246_1944 | 231 |
| 56 | 3300061734 | Ga0530510_0638503 | Ga0530510_0638503_77_775 | 231 |
| 57 | 3300046511 | Ga0495608_0071871 | Ga0495608_0071871_1176_1955 | 232 |
| 58 | 3300060353 | Ga0501082_0001594 | Ga0501082_0001594_5031_5810 | 232 |
| 59 | 3300061734 | Ga0530510_0006155 | Ga0530510_0006155_6094_6873 | 232 |
| 60 | 3300006852 | Ga0075433_10271500 | Ga0075433_102715001 | 233 |
| 61 | 3300007076 | Ga0075435_100276348 | Ga0075435_1002763482 | 233 |
| 62 | 3300031995 | Ga0307409_100185056 | Ga0307409_1001850562 | 234 |
| 63 | 3300046472 | Ga0495580_0000719 | Ga0495580_0000719_6621_7397 | 235 |
| 64 | 3300005445 | Ga0070708_100030939 | Ga0070708_1000309393 | 236 |
| 65 | 3300005467 | Ga0070706_100032255 | Ga0070706_1000322553 | 236 |
| 66 | 3300005468 | Ga0070707_100497676 | Ga0070707_1004976761 | 236 |
| 67 | 3300005471 | Ga0070698_100084836 | Ga0070698_1000848362 | 236 |
| 68 | 3300005518 | Ga0070699_100013971 | Ga0070699_1000139712 | 236 |
| 69 | 3300005546 | Ga0070696_100019756 | Ga0070696_1000197564 | 236 |
| 70 | 3300025910 | Ga0207684_10097849 | Ga0207684_100978493 | 236 |
| 71 | 3300025922 | Ga0207646_10269474 | Ga0207646_102694741 | 236 |
| 72 | 3300049568 | Ga0501031_0150816 | Ga0501031_0150816_65_847 | 236 |
| 73 | 3300049572 | Ga0501036_0017276 | Ga0501036_0017276_222_1001 | 236 |
| 74 | 3300049576 | Ga0501040_0015346 | Ga0501040_0015346_3216_3995 | 236 |
| 75 | 3300049577 | Ga0501041_0200304 | Ga0501041_0200304_225_1004 | 236 |
| 76 | 3300049579 | Ga0501043_0285299 | Ga0501043_0285299_209_988 | 236 |
| 77 | 3300049587 | Ga0501071_0035691 | Ga0501071_0035691_760_1539 | 236 |
| 78 | 3300049588 | Ga0501072_0023067 | Ga0501072_0023067_1850_2629 | 236 |
| 79 | 3300049588 | Ga0501072_0423031 | Ga0501072_0423031_65_841 | 236 |
| 80 | 3300049590 | Ga0501074_0196933 | Ga0501074_0196933_48_827 | 236 |
| 81 | 3300049593 | Ga0501077_0016474 | Ga0501077_0016474_225_1004 | 236 |
| 82 | 3300049741 | Ga0501079_0006563 | Ga0501079_0006563_6959_7738 | 236 |
| 83 | 3300049742 | Ga0501080_0060236 | Ga0501080_0060236_202_981 | 236 |
| 84 | 3300049743 | Ga0501081_0205737 | Ga0501081_0205737_413_1192 | 236 |
| 85 | 3300049744 | Ga0501083_0291660 | Ga0501083_0291660_68_847 | 236 |
| 86 | 3300049824 | Ga0501045_0004907 | Ga0501045_0004907_1301_2080 | 236 |
| 87 | 3300054114 | Ga0501084_0006688 | Ga0501084_0006688_2904_3683 | 236 |
| 88 | 3300005334 | Ga0068869_100021375 | Ga0068869_1000213756 | 237 |
| 89 | 3300005341 | Ga0070691_10014801 | Ga0070691_100148012 | 237 |
| 90 | 3300005345 | Ga0070692_10151914 | Ga0070692_101519142 | 237 |
| 91 | 3300005406 | Ga0070703_10033763 | Ga0070703_100337632 | 237 |
| 92 | 3300005440 | Ga0070705_100013522 | Ga0070705_1000135224 | 237 |
| 93 | 3300005441 | Ga0070700_100033620 | Ga0070700_1000336203 | 237 |
| 94 | 3300005445 | Ga0070708_100405866 | Ga0070708_1004058662 | 237 |
| 95 | 3300005518 | Ga0070699_100016965 | Ga0070699_1000169653 | 237 |
| 96 | 3300005545 | Ga0070695_100005280 | Ga0070695_1000052808 | 237 |
| 97 | 3300005549 | Ga0070704_100010857 | Ga0070704_1000108573 | 237 |
| 98 | 3300005577 | Ga0068857_100065521 | Ga0068857_1000655213 | 237 |
| 99 | 3300005840 | Ga0068870_10128167 | Ga0068870_101281671 | 237 |
| 100 | 3300005843 | Ga0068860_100526227 | Ga0068860_1005262272 | 237 |
| 101 | 3300005844 | Ga0068862_100304193 | Ga0068862_1003041932 | 237 |
| 102 | 3300009148 | Ga0105243_10021187 | Ga0105243_100211873 | 237 |
| 103 | 3300009176 | Ga0105242_10013532 | Ga0105242_100135326 | 237 |
| 104 | 3300009553 | Ga0105249_10327155 | Ga0105249_103271552 | 237 |
| 105 | 3300014326 | Ga0157380_11087757 | Ga0157380_110877571 | 237 |
| 106 | 3300025885 | Ga0207653_10007017 | Ga0207653_100070171 | 237 |
| 107 | 3300025935 | Ga0207709_10008877 | Ga0207709_100088773 | 237 |
| 108 | 3300025942 | Ga0207689_10020104 | Ga0207689_100201047 | 237 |
| 109 | 3300025961 | Ga0207712_10459295 | Ga0207712_104592952 | 237 |
| 110 | 3300026116 | Ga0207674_10038305 | Ga0207674_100383052 | 237 |
| 111 | 3300005471 | Ga0070698_100494405 | Ga0070698_1004944052 | 238 |
| 112 | 3300005718 | Ga0068866_10251868 | Ga0068866_102518682 | 238 |
| 113 | 3300005844 | Ga0068862_100330435 | Ga0068862_1003304352 | 238 |
| 114 | 3300006847 | Ga0075431_100063427 | Ga0075431_1000634273 | 238 |
| 115 | 3300006880 | Ga0075429_100471773 | Ga0075429_1004717732 | 238 |
| 116 | 3300007076 | Ga0075435_100048090 | Ga0075435_1000480904 | 238 |
| 117 | 3300009094 | Ga0111539_10000988 | Ga0111539_1000098814 | 238 |
| 118 | 3300009147 | Ga0114129_10409453 | Ga0114129_104094532 | 238 |
| 119 | 3300025908 | Ga0207643_10173079 | Ga0207643_101730792 | 238 |
| 120 | 3300025911 | Ga0207654_10371744 | Ga0207654_103717441 | 238 |
| 121 | 3300025917 | Ga0207660_10289789 | Ga0207660_102897892 | 238 |
| 122 | 3300028380 | Ga0268265_10609919 | Ga0268265_106099192 | 238 |
| 123 | 3300032126 | Ga0307415_100298298 | Ga0307415_1002982981 | 238 |
| 124 | 3300035088 | Ga0373940_0017138 | Ga0373940_0017138_1012_1788 | 238 |
| 125 | 3300035691 | Ga0373931_0025011 | Ga0373931_0025011_543_1319 | 238 |
| 126 | 3300045051 | Ga0451576_0173678 | Ga0451576_0173678_308_1084 | 238 |
| 127 | 3300045051 | Ga0451576_0557773 | Ga0451576_0557773_121_897 | 238 |
| 128 | 3300048908 | Ga0496105_0402525 | Ga0496105_0402525_163_939 | 238 |
| 129 | 3300050507 | nmdc:mga05p37_282394_c1 | nmdc:mga05p37_282394_c1_410_1189 | 238 |
| 130 | 3300050508 | nmdc:mga09592_443704_c1 | nmdc:mga09592_443704_c1_208_987 | 238 |
| 131 | 3300050510 | nmdc:mga06r32_33390_c1 | nmdc:mga06r32_33390_c1_250_1029 | 238 |
| 132 | 3300050512 | nmdc:mga0n895_865643_c1 | nmdc:mga0n895_865643_c1_32_811 | 238 |
| 133 | 3300050513 | nmdc:mga0rr50_9425_c1 | nmdc:mga0rr50_9425_c1_1822_2601 | 238 |
| 134 | 3300050515 | nmdc:mga0a205_33794_c1 | nmdc:mga0a205_33794_c1_3453_4229 | 238 |
| 135 | 3300006846 | Ga0075430_100405406 | Ga0075430_1004054062 | 239 |
| 136 | 3300006847 | Ga0075431_100669665 | Ga0075431_1006696651 | 239 |
| 137 | 3300035172 | Ga0373955_0091241 | Ga0373955_0091241_211_990 | 239 |
| 138 | 3300035724 | Ga0373933_0212673 | Ga0373933_0212673_311_1090 | 239 |
| 139 | 3300046454 | Ga0495592_0238744 | Ga0495592_0238744_393_1172 | 239 |
| 140 | 3300046477 | Ga0495664_0147786 | Ga0495664_0147786_325_1104 | 239 |
| 141 | 3300046516 | Ga0495628_0160573 | Ga0495628_0160573_708_1487 | 239 |
| 142 | 3300046533 | Ga0495640_0108072 | Ga0495640_0108072_894_1673 | 239 |
| 143 | 3300046536 | Ga0495587_0151328 | Ga0495587_0151328_95_874 | 239 |
| 144 | 3300046559 | Ga0495667_0006813 | Ga0495667_0006813_311_1090 | 239 |
| 145 | 3300046663 | Ga0495635_0476475 | Ga0495635_0476475_25_804 | 239 |
| 146 | 3300046675 | Ga0495657_0087703 | Ga0495657_0087703_1132_1911 | 239 |
| 147 | 3300046678 | Ga0495599_0093123 | Ga0495599_0093123_798_1577 | 239 |
| 148 | 3300047319 | Ga0495674_0126303 | Ga0495674_0126303_1102_1881 | 239 |
| 149 | 3300047322 | Ga0495680_0130519 | Ga0495680_0130519_755_1534 | 239 |
| 150 | 3300047444 | Ga0495675_0157974 | Ga0495675_0157974_286_1065 | 239 |
| 151 | 3300047471 | Ga0495684_0160671 | Ga0495684_0160671_870_1649 | 239 |
| 152 | 3300048088 | Ga0495602_0033380 | Ga0495602_0033380_3863_4642 | 239 |
| 153 | 3300050508 | nmdc:mga09592_230753_c1 | nmdc:mga09592_230753_c1_547_1323 | 239 |
| 154 | 3300050510 | nmdc:mga06r32_356225_c1 | nmdc:mga06r32_356225_c1_126_902 | 239 |
| 155 | 3300061734 | Ga0530510_0600302 | Ga0530510_0600302_25_801 | 239 |
| 156 | 3300028381 | Ga0268264_10156617 | Ga0268264_101566173 | 240 |
| 157 | 3300031548 | Ga0307408_100032622 | Ga0307408_1000326224 | 240 |
| 158 | 3300031901 | Ga0307406_10242178 | Ga0307406_102421782 | 240 |
| 159 | 3300049741 | Ga0501079_0326395 | Ga0501079_0326395_122_901 | 240 |
| 160 | 3300013306 | Ga0163162_11108454 | Ga0163162_111084542 | 241 |
| 161 | 3300014326 | Ga0157380_10703356 | Ga0157380_107033561 | 241 |
| 162 | 3300045051 | Ga0451576_0276457 | Ga0451576_0276457_262_1038 | 241 |
| 163 | 3300046491 | Ga0495584_0135346 | Ga0495584_0135346_79_855 | 241 |
| 164 | 3300046684 | Ga0495669_0084786 | Ga0495669_0084786_358_1134 | 241 |
| 165 | 3300005445 | Ga0070708_100016993 | Ga0070708_1000169936 | 242 |
| 166 | 3300005467 | Ga0070706_100037818 | Ga0070706_1000378184 | 242 |
| 167 | 3300005843 | Ga0068860_100239173 | Ga0068860_1002391732 | 242 |
| 168 | 3300006844 | Ga0075428_100394630 | Ga0075428_1003946302 | 242 |
| 169 | 3300025910 | Ga0207684_10054361 | Ga0207684_100543613 | 242 |
| 170 | 3300025910 | Ga0207684_10074444 | Ga0207684_100744443 | 242 |
| 171 | 3300025922 | Ga0207646_10256011 | Ga0207646_102560112 | 242 |
| 172 | 3300028381 | Ga0268264_10130013 | Ga0268264_101300133 | 242 |
| 173 | 3300050512 | nmdc:mga0n895_115880_c1 | nmdc:mga0n895_115880_c1_1076_1852 | 243 |
| 174 | 3300005468 | Ga0070707_100359352 | Ga0070707_1003593521 | 244 |
| 175 | 3300049743 | Ga0501081_0035410 | Ga0501081_0035410_318_1109 | 245 |
| 176 | 3300046684 | Ga0495669_0028433 | Ga0495669_0028433_934_1713 | 246 |
| 177 | 3300005434 | Ga0070709_10194395 | Ga0070709_101943952 | 248 |
| 178 | 3300005539 | Ga0068853_100010427 | Ga0068853_1000104275 | 250 |
| 179 | 3300026041 | Ga0207639_10011217 | Ga0207639_100112175 | 250 |
| 180 | 3300042438 | Ga0439459_0001197 | Ga0439459_0001197_280_1056 | 250 |
| 181 | 3300046615 | Ga0495656_0210400 | Ga0495656_0210400_32_808 | 250 |
| 182 | 3300005341 | Ga0070691_10160146 | Ga0070691_101601461 | 251 |
| 183 | 3300005536 | Ga0070697_100036933 | Ga0070697_1000369333 | 251 |
| 184 | 3300031731 | Ga0307405_10413840 | Ga0307405_104138402 | 252 |
| 185 | 3300032005 | Ga0307411_10137337 | Ga0307411_101373372 | 252 |
| 186 | 3300049582 | Ga0501048_0471037 | Ga0501048_0471037_11_793 | 255 |
| 187 | 3300026088 | Ga0207641_10144558 | Ga0207641_101445581 | 257 |
| 188 | 3300050515 | nmdc:mga0a205_103657_c1 | nmdc:mga0a205_103657_c1_1495_2271 | 257 |
| 189 | 3300003911 | JGI25405J52794_10002664 | JGI25405J52794_100026641 | 258 |
| 190 | 3300005295 | Ga0065707_10002362 | Ga0065707_100023623 | 258 |
| 191 | 3300005295 | Ga0065707_10154868 | Ga0065707_101548681 | 258 |
| 192 | 3300005330 | Ga0070690_100386359 | Ga0070690_1003863591 | 258 |
| 193 | 3300005331 | Ga0070670_100010274 | Ga0070670_1000102742 | 258 |
| 194 | 3300005334 | Ga0068869_100006037 | Ga0068869_1000060375 | 258 |
| 195 | 3300005334 | Ga0068869_100212349 | Ga0068869_1002123491 | 258 |
| 196 | 3300005336 | Ga0070680_100000760 | Ga0070680_10000076015 | 258 |
| 197 | 3300005336 | Ga0070680_100052537 | Ga0070680_1000525372 | 258 |
| 198 | 3300005337 | Ga0070682_100000576 | Ga0070682_10000057615 | 258 |
| 199 | 3300005338 | Ga0068868_100067540 | Ga0068868_1000675401 | 258 |
| 200 | 3300005339 | Ga0070660_100015018 | Ga0070660_1000150185 | 258 |
| 201 | 3300005344 | Ga0070661_100010023 | Ga0070661_1000100232 | 258 |
| 202 | 3300005345 | Ga0070692_10066530 | Ga0070692_100665302 | 258 |
| 203 | 3300005347 | Ga0070668_100370341 | Ga0070668_1003703412 | 258 |
| 204 | 3300005353 | Ga0070669_100045049 | Ga0070669_1000450494 | 258 |
| 205 | 3300005353 | Ga0070669_100075120 | Ga0070669_1000751202 | 258 |
| 206 | 3300005353 | Ga0070669_100184261 | Ga0070669_1001842612 | 258 |
| 207 | 3300005366 | Ga0070659_100001314 | Ga0070659_10000131413 | 258 |
| 208 | 3300005406 | Ga0070703_10019267 | Ga0070703_100192671 | 258 |
| 209 | 3300005436 | Ga0070713_100093895 | Ga0070713_1000938953 | 258 |
| 210 | 3300005437 | Ga0070710_10096970 | Ga0070710_100969702 | 258 |
| 211 | 3300005440 | Ga0070705_100370725 | Ga0070705_1003707251 | 258 |
| 212 | 3300005440 | Ga0070705_100433594 | Ga0070705_1004335941 | 258 |
| 213 | 3300005441 | Ga0070700_100149350 | Ga0070700_1001493501 | 258 |
| 214 | 3300005441 | Ga0070700_100157761 | Ga0070700_1001577612 | 258 |
| 215 | 3300005444 | Ga0070694_100069442 | Ga0070694_1000694422 | 258 |
| 216 | 3300005444 | Ga0070694_100136842 | Ga0070694_1001368423 | 258 |
| 217 | 3300005444 | Ga0070694_100385712 | Ga0070694_1003857121 | 258 |
| 218 | 3300005455 | Ga0070663_100022880 | Ga0070663_1000228802 | 258 |
| 219 | 3300005457 | Ga0070662_100340349 | Ga0070662_1003403492 | 258 |
| 220 | 3300005458 | Ga0070681_10330952 | Ga0070681_103309521 | 258 |
| 221 | 3300005458 | Ga0070681_10354790 | Ga0070681_103547902 | 258 |
| 222 | 3300005459 | Ga0068867_100023240 | Ga0068867_1000232402 | 258 |
| 223 | 3300005459 | Ga0068867_100126813 | Ga0068867_1001268132 | 258 |
| 224 | 3300005467 | Ga0070706_100015079 | Ga0070706_1000150796 | 258 |
| 225 | 3300005467 | Ga0070706_100105679 | Ga0070706_1001056793 | 258 |
| 226 | 3300005467 | Ga0070706_100119502 | Ga0070706_1001195023 | 258 |
| 227 | 3300005467 | Ga0070706_100351685 | Ga0070706_1003516852 | 258 |
| 228 | 3300005468 | Ga0070707_100004351 | Ga0070707_10000435110 | 258 |
| 229 | 3300005468 | Ga0070707_100066676 | Ga0070707_1000666762 | 258 |
| 230 | 3300005468 | Ga0070707_100098328 | Ga0070707_1000983282 | 258 |
| 231 | 3300005471 | Ga0070698_100021719 | Ga0070698_1000217198 | 258 |
| 232 | 3300005471 | Ga0070698_100041112 | Ga0070698_1000411122 | 258 |
| 233 | 3300005471 | Ga0070698_100278315 | Ga0070698_1002783152 | 258 |
| 234 | 3300005518 | Ga0070699_100001996 | Ga0070699_1000019963 | 258 |
| 235 | 3300005518 | Ga0070699_100013157 | Ga0070699_10001315713 | 258 |
| 236 | 3300005518 | Ga0070699_100080611 | Ga0070699_1000806114 | 258 |
| 237 | 3300005518 | Ga0070699_100461149 | Ga0070699_1004611492 | 258 |
| 238 | 3300005518 | Ga0070699_100644703 | Ga0070699_1006447031 | 258 |
| 239 | 3300005536 | Ga0070697_100060327 | Ga0070697_1000603273 | 258 |
| 240 | 3300005536 | Ga0070697_100100908 | Ga0070697_1001009083 | 258 |
| 241 | 3300005536 | Ga0070697_100104836 | Ga0070697_1001048363 | 258 |
| 242 | 3300005536 | Ga0070697_100301253 | Ga0070697_1003012531 | 258 |
| 243 | 3300005545 | Ga0070695_100052947 | Ga0070695_1000529473 | 258 |
| 244 | 3300005545 | Ga0070695_100142521 | Ga0070695_1001425211 | 258 |
| 245 | 3300005546 | Ga0070696_100000633 | Ga0070696_10000063315 | 258 |
| 246 | 3300005546 | Ga0070696_100055165 | Ga0070696_1000551653 | 258 |
| 247 | 3300005547 | Ga0070693_100001427 | Ga0070693_1000014275 | 258 |
| 248 | 3300005549 | Ga0070704_100787945 | Ga0070704_1007879451 | 258 |
| 249 | 3300005563 | Ga0068855_100002556 | Ga0068855_10000255615 | 258 |
| 250 | 3300005564 | Ga0070664_100038039 | Ga0070664_1000380391 | 258 |
| 251 | 3300005577 | Ga0068857_100015869 | Ga0068857_1000158696 | 258 |
| 252 | 3300005577 | Ga0068857_100079276 | Ga0068857_1000792761 | 258 |
| 253 | 3300005578 | Ga0068854_100005247 | Ga0068854_1000052475 | 258 |
| 254 | 3300005614 | Ga0068856_100006151 | Ga0068856_1000061516 | 258 |
| 255 | 3300005617 | Ga0068859_100191402 | Ga0068859_1001914022 | 258 |
| 256 | 3300005618 | Ga0068864_100083860 | Ga0068864_1000838602 | 258 |
| 257 | 3300005618 | Ga0068864_100145596 | Ga0068864_1001455963 | 258 |
| 258 | 3300005719 | Ga0068861_100018437 | Ga0068861_1000184374 | 258 |
| 259 | 3300005719 | Ga0068861_100629091 | Ga0068861_1006290911 | 258 |
| 260 | 3300005840 | Ga0068870_10002863 | Ga0068870_100028634 | 258 |
| 261 | 3300005841 | Ga0068863_100048853 | Ga0068863_1000488533 | 258 |
| 262 | 3300005842 | Ga0068858_100098485 | Ga0068858_1000984851 | 258 |
| 263 | 3300005842 | Ga0068858_100098762 | Ga0068858_1000987622 | 258 |
| 264 | 3300005842 | Ga0068858_100165090 | Ga0068858_1001650902 | 258 |
| 265 | 3300005843 | Ga0068860_100153741 | Ga0068860_1001537412 | 258 |
| 266 | 3300005844 | Ga0068862_100075931 | Ga0068862_1000759312 | 258 |
| 267 | 3300005844 | Ga0068862_100193739 | Ga0068862_1001937392 | 258 |
| 268 | 3300005844 | Ga0068862_100271736 | Ga0068862_1002717362 | 258 |
| 269 | 3300005937 | Ga0081455_10000411 | Ga0081455_1000041154 | 258 |
| 270 | 3300005937 | Ga0081455_10059776 | Ga0081455_100597762 | 258 |
| 271 | 3300005981 | Ga0081538_10006480 | Ga0081538_100064803 | 258 |
| 272 | 3300005981 | Ga0081538_10048880 | Ga0081538_100488802 | 258 |
| 273 | 3300005981 | Ga0081538_10092478 | Ga0081538_100924782 | 258 |
| 274 | 3300005981 | Ga0081538_10094691 | Ga0081538_100946911 | 258 |
| 275 | 3300005983 | Ga0081540_1018028 | Ga0081540_10180285 | 258 |
| 276 | 3300005985 | Ga0081539_10000083 | Ga0081539_10000083100 | 258 |
| 277 | 3300006028 | Ga0070717_10346012 | Ga0070717_103460121 | 258 |
| 278 | 3300006175 | Ga0070712_100013947 | Ga0070712_1000139473 | 258 |
| 279 | 3300006844 | Ga0075428_100000136 | Ga0075428_10000013669 | 258 |
| 280 | 3300006844 | Ga0075428_100000176 | Ga0075428_10000017658 | 258 |
| 281 | 3300006844 | Ga0075428_100006989 | Ga0075428_1000069898 | 258 |
| 282 | 3300006844 | Ga0075428_100011008 | Ga0075428_1000110086 | 258 |
| 283 | 3300006844 | Ga0075428_100033421 | Ga0075428_1000334213 | 258 |
| 284 | 3300006844 | Ga0075428_100052536 | Ga0075428_1000525362 | 258 |
| 285 | 3300006844 | Ga0075428_100404442 | Ga0075428_1004044422 | 258 |
| 286 | 3300006846 | Ga0075430_100000813 | Ga0075430_1000008132 | 258 |
| 287 | 3300006846 | Ga0075430_100008443 | Ga0075430_1000084439 | 258 |
| 288 | 3300006846 | Ga0075430_100218626 | Ga0075430_1002186262 | 258 |
| 289 | 3300006847 | Ga0075431_100000061 | Ga0075431_10000006120 | 258 |
| 290 | 3300006847 | Ga0075431_100002933 | Ga0075431_1000029335 | 258 |
| 291 | 3300006847 | Ga0075431_100003953 | Ga0075431_1000039537 | 258 |
| 292 | 3300006847 | Ga0075431_100005544 | Ga0075431_1000055449 | 258 |
| 293 | 3300006847 | Ga0075431_100565111 | Ga0075431_1005651112 | 258 |
| 294 | 3300006852 | Ga0075433_10003076 | Ga0075433_100030765 | 258 |
| 295 | 3300006852 | Ga0075433_10010743 | Ga0075433_100107432 | 258 |
| 296 | 3300006852 | Ga0075433_10010749 | Ga0075433_100107497 | 258 |
| 297 | 3300006852 | Ga0075433_10016394 | Ga0075433_100163947 | 258 |
| 298 | 3300006852 | Ga0075433_10027291 | Ga0075433_100272912 | 258 |
| 299 | 3300006852 | Ga0075433_10041664 | Ga0075433_100416641 | 258 |
| 300 | 3300006852 | Ga0075433_10067125 | Ga0075433_100671253 | 258 |
| 301 | 3300006852 | Ga0075433_10099954 | Ga0075433_100999542 | 258 |
| 302 | 3300006852 | Ga0075433_10102366 | Ga0075433_101023662 | 258 |
| 303 | 3300006852 | Ga0075433_10178939 | Ga0075433_101789393 | 258 |
| 304 | 3300006852 | Ga0075433_10649871 | Ga0075433_106498711 | 258 |
| 305 | 3300006871 | Ga0075434_100000404 | Ga0075434_10000040430 | 258 |
| 306 | 3300006871 | Ga0075434_100013058 | Ga0075434_1000130585 | 258 |
| 307 | 3300006871 | Ga0075434_100109151 | Ga0075434_1001091512 | 258 |
| 308 | 3300006871 | Ga0075434_100117773 | Ga0075434_1001177732 | 258 |
| 309 | 3300006871 | Ga0075434_100202773 | Ga0075434_1002027732 | 258 |
| 310 | 3300006880 | Ga0075429_100000739 | Ga0075429_10000073925 | 258 |
| 311 | 3300006880 | Ga0075429_100028874 | Ga0075429_1000288742 | 258 |
| 312 | 3300006880 | Ga0075429_100030126 | Ga0075429_1000301263 | 258 |
| 313 | 3300006880 | Ga0075429_100136700 | Ga0075429_1001367003 | 258 |
| 314 | 3300006880 | Ga0075429_100209009 | Ga0075429_1002090092 | 258 |
| 315 | 3300006880 | Ga0075429_100480469 | Ga0075429_1004804692 | 258 |
| 316 | 3300006881 | Ga0068865_100430459 | Ga0068865_1004304592 | 258 |
| 317 | 3300006914 | Ga0075436_100002609 | Ga0075436_10000260912 | 258 |
| 318 | 3300006914 | Ga0075436_100017258 | Ga0075436_1000172585 | 258 |
| 319 | 3300006914 | Ga0075436_100476898 | Ga0075436_1004768981 | 258 |
| 320 | 3300006931 | Ga0097620_100191413 | Ga0097620_1001914131 | 258 |
| 321 | 3300007076 | Ga0075435_100006024 | Ga0075435_1000060245 | 258 |
| 322 | 3300007076 | Ga0075435_100009151 | Ga0075435_1000091513 | 258 |
| 323 | 3300007076 | Ga0075435_100027634 | Ga0075435_1000276343 | 258 |
| 324 | 3300007076 | Ga0075435_100066977 | Ga0075435_1000669772 | 258 |
| 325 | 3300007076 | Ga0075435_100108626 | Ga0075435_1001086262 | 258 |
| 326 | 3300007265 | Ga0099794_10002483 | Ga0099794_100024835 | 258 |
| 327 | 3300007788 | Ga0099795_10124545 | Ga0099795_101245451 | 258 |
| 328 | 3300009094 | Ga0111539_10000715 | Ga0111539_1000071532 | 258 |
| 329 | 3300009094 | Ga0111539_10011434 | Ga0111539_100114345 | 258 |
| 330 | 3300009094 | Ga0111539_10014429 | Ga0111539_100144298 | 258 |
| 331 | 3300009094 | Ga0111539_10150951 | Ga0111539_101509512 | 258 |
| 332 | 3300009098 | Ga0105245_10677664 | Ga0105245_106776641 | 258 |
| 333 | 3300009101 | Ga0105247_10320765 | Ga0105247_103207652 | 258 |
| 334 | 3300009147 | Ga0114129_10000847 | Ga0114129_100008475 | 258 |
| 335 | 3300009147 | Ga0114129_10003560 | Ga0114129_100035607 | 258 |
| 336 | 3300009147 | Ga0114129_10006715 | Ga0114129_100067152 | 258 |
| 337 | 3300009147 | Ga0114129_10009764 | Ga0114129_1000976414 | 258 |
| 338 | 3300009147 | Ga0114129_10011521 | Ga0114129_1001152112 | 258 |
| 339 | 3300009147 | Ga0114129_10038128 | Ga0114129_100381288 | 258 |
| 340 | 3300009147 | Ga0114129_10040737 | Ga0114129_100407374 | 258 |
| 341 | 3300009147 | Ga0114129_10042610 | Ga0114129_100426105 | 258 |
| 342 | 3300009147 | Ga0114129_10092345 | Ga0114129_100923452 | 258 |
| 343 | 3300009147 | Ga0114129_10142971 | Ga0114129_101429712 | 258 |
| 344 | 3300009147 | Ga0114129_10203024 | Ga0114129_102030242 | 258 |
| 345 | 3300009147 | Ga0114129_10268708 | Ga0114129_102687082 | 258 |
| 346 | 3300009147 | Ga0114129_10474286 | Ga0114129_104742862 | 258 |
| 347 | 3300009147 | Ga0114129_10588943 | Ga0114129_105889431 | 258 |
| 348 | 3300009147 | Ga0114129_11159610 | Ga0114129_111596102 | 258 |
| 349 | 3300009148 | Ga0105243_10089083 | Ga0105243_100890832 | 258 |
| 350 | 3300009148 | Ga0105243_10193877 | Ga0105243_101938772 | 258 |
| 351 | 3300009148 | Ga0105243_10383788 | Ga0105243_103837882 | 258 |
| 352 | 3300009174 | Ga0105241_10003228 | Ga0105241_100032282 | 258 |
| 353 | 3300009174 | Ga0105241_10436654 | Ga0105241_104366541 | 258 |
| 354 | 3300009553 | Ga0105249_10101021 | Ga0105249_101010213 | 258 |
| 355 | 3300009553 | Ga0105249_10180012 | Ga0105249_101800123 | 258 |
| 356 | 3300010159 | Ga0099796_10078649 | Ga0099796_100786491 | 258 |
| 357 | 3300010375 | Ga0105239_10121292 | Ga0105239_101212922 | 258 |
| 358 | 3300011119 | Ga0105246_10182810 | Ga0105246_101828102 | 258 |
| 359 | 3300013100 | Ga0157373_10003300 | Ga0157373_100033007 | 258 |
| 360 | 3300013306 | Ga0163162_10036621 | Ga0163162_100366213 | 258 |
| 361 | 3300013306 | Ga0163162_10190710 | Ga0163162_101907102 | 258 |
| 362 | 3300013306 | Ga0163162_10421869 | Ga0163162_104218692 | 258 |
| 363 | 3300013306 | Ga0163162_10853799 | Ga0163162_108537992 | 258 |
| 364 | 3300013307 | Ga0157372_10009405 | Ga0157372_100094057 | 258 |
| 365 | 3300013308 | Ga0157375_10789909 | Ga0157375_107899092 | 258 |
| 366 | 3300014968 | Ga0157379_10053779 | Ga0157379_100537792 | 258 |
| 367 | 3300014968 | Ga0157379_10208994 | Ga0157379_102089941 | 258 |
| 368 | 3300015262 | Ga0182007_10013413 | Ga0182007_100134131 | 258 |
| 369 | 3300025907 | Ga0207645_10018926 | Ga0207645_100189263 | 258 |
| 370 | 3300025907 | Ga0207645_10196909 | Ga0207645_101969092 | 258 |
| 371 | 3300025908 | Ga0207643_10003668 | Ga0207643_100036683 | 258 |
| 372 | 3300025910 | Ga0207684_10000566 | Ga0207684_1000056614 | 258 |
| 373 | 3300025910 | Ga0207684_10009022 | Ga0207684_100090227 | 258 |
| 374 | 3300025910 | Ga0207684_10013553 | Ga0207684_100135537 | 258 |
| 375 | 3300025910 | Ga0207684_10142825 | Ga0207684_101428252 | 258 |
| 376 | 3300025911 | Ga0207654_10124269 | Ga0207654_101242691 | 258 |
| 377 | 3300025912 | Ga0207707_10000056 | Ga0207707_100000567 | 258 |
| 378 | 3300025912 | Ga0207707_10254187 | Ga0207707_102541872 | 258 |
| 379 | 3300025915 | Ga0207693_10003246 | Ga0207693_100032469 | 258 |
| 380 | 3300025915 | Ga0207693_10035398 | Ga0207693_100353984 | 258 |
| 381 | 3300025919 | Ga0207657_10000306 | Ga0207657_100003066 | 258 |
| 382 | 3300025920 | Ga0207649_10006470 | Ga0207649_100064705 | 258 |
| 383 | 3300025921 | Ga0207652_10002550 | Ga0207652_1000255010 | 258 |
| 384 | 3300025921 | Ga0207652_10561556 | Ga0207652_105615561 | 258 |
| 385 | 3300025922 | Ga0207646_10000948 | Ga0207646_1000094821 | 258 |
| 386 | 3300025922 | Ga0207646_10007532 | Ga0207646_100075321 | 258 |
| 387 | 3300025922 | Ga0207646_10012657 | Ga0207646_100126572 | 258 |
| 388 | 3300025922 | Ga0207646_10062196 | Ga0207646_100621962 | 258 |
| 389 | 3300025922 | Ga0207646_10110506 | Ga0207646_101105062 | 258 |
| 390 | 3300025922 | Ga0207646_10370563 | Ga0207646_103705632 | 258 |
| 391 | 3300025923 | Ga0207681_10014687 | Ga0207681_100146874 | 258 |
| 392 | 3300025923 | Ga0207681_10035929 | Ga0207681_100359292 | 258 |
| 393 | 3300025923 | Ga0207681_10369393 | Ga0207681_103693932 | 258 |
| 394 | 3300025927 | Ga0207687_10419317 | Ga0207687_104193172 | 258 |
| 395 | 3300025929 | Ga0207664_10223286 | Ga0207664_102232862 | 258 |
| 396 | 3300025932 | Ga0207690_10011140 | Ga0207690_100111404 | 258 |
| 397 | 3300025933 | Ga0207706_10235849 | Ga0207706_102358492 | 258 |
| 398 | 3300025935 | Ga0207709_10328912 | Ga0207709_103289122 | 258 |
| 399 | 3300025938 | Ga0207704_10307805 | Ga0207704_103078051 | 258 |
| 400 | 3300025940 | Ga0207691_10015290 | Ga0207691_100152905 | 258 |
| 401 | 3300025940 | Ga0207691_10033639 | Ga0207691_100336395 | 258 |
| 402 | 3300025942 | Ga0207689_10017813 | Ga0207689_100178136 | 258 |
| 403 | 3300025942 | Ga0207689_10024260 | Ga0207689_100242601 | 258 |
| 404 | 3300025944 | Ga0207661_10786064 | Ga0207661_107860641 | 258 |
| 405 | 3300025945 | Ga0207679_10023975 | Ga0207679_100239752 | 258 |
| 406 | 3300025949 | Ga0207667_10004946 | Ga0207667_1000494610 | 258 |
| 407 | 3300025960 | Ga0207651_10212295 | Ga0207651_102122952 | 258 |
| 408 | 3300025961 | Ga0207712_10105510 | Ga0207712_101055101 | 258 |
| 409 | 3300025961 | Ga0207712_10157312 | Ga0207712_101573121 | 258 |
| 410 | 3300025972 | Ga0207668_10336284 | Ga0207668_103362842 | 258 |
| 411 | 3300026023 | Ga0207677_10164913 | Ga0207677_101649132 | 258 |
| 412 | 3300026035 | Ga0207703_10067126 | Ga0207703_100671263 | 258 |
| 413 | 3300026035 | Ga0207703_10075319 | Ga0207703_100753192 | 258 |
| 414 | 3300026067 | Ga0207678_10037207 | Ga0207678_100372074 | 258 |
| 415 | 3300026075 | Ga0207708_10096551 | Ga0207708_100965512 | 258 |
| 416 | 3300026075 | Ga0207708_10098046 | Ga0207708_100980462 | 258 |
| 417 | 3300026075 | Ga0207708_10111939 | Ga0207708_101119392 | 258 |
| 418 | 3300026075 | Ga0207708_10334691 | Ga0207708_103346912 | 258 |
| 419 | 3300026078 | Ga0207702_10005604 | Ga0207702_100056045 | 258 |
| 420 | 3300026088 | Ga0207641_10030042 | Ga0207641_100300424 | 258 |
| 421 | 3300026089 | Ga0207648_10003466 | Ga0207648_100034665 | 258 |
| 422 | 3300026089 | Ga0207648_10279191 | Ga0207648_102791912 | 258 |
| 423 | 3300026116 | Ga0207674_10092257 | Ga0207674_100922571 | 258 |
| 424 | 3300026116 | Ga0207674_10104086 | Ga0207674_101040861 | 258 |
| 425 | 3300026118 | Ga0207675_100009557 | Ga0207675_1000095576 | 258 |
| 426 | 3300026118 | Ga0207675_100032298 | Ga0207675_1000322985 | 258 |
| 427 | 3300027682 | Ga0209971_1024648 | Ga0209971_10246482 | 258 |
| 428 | 3300027907 | Ga0207428_10000631 | Ga0207428_1000063112 | 258 |
| 429 | 3300027907 | Ga0207428_10029258 | Ga0207428_100292583 | 258 |
| 430 | 3300027907 | Ga0207428_10203504 | Ga0207428_102035042 | 258 |
| 431 | 3300027907 | Ga0207428_10203922 | Ga0207428_102039222 | 258 |
| 432 | 3300028380 | Ga0268265_10174361 | Ga0268265_101743612 | 258 |
| 433 | 3300028380 | Ga0268265_10178033 | Ga0268265_101780331 | 258 |
| 434 | 3300028380 | Ga0268265_10218322 | Ga0268265_102183222 | 258 |
| 435 | 3300028381 | Ga0268264_10099197 | Ga0268264_100991973 | 258 |
| 436 | 3300031548 | Ga0307408_100136295 | Ga0307408_1001362952 | 258 |
| 437 | 3300031548 | Ga0307408_100177142 | Ga0307408_1001771422 | 258 |
| 438 | 3300031852 | Ga0307410_10067961 | Ga0307410_100679612 | 258 |
| 439 | 3300031903 | Ga0307407_10522664 | Ga0307407_105226641 | 258 |
| 440 | 3300031995 | Ga0307409_100092962 | Ga0307409_1000929623 | 258 |
| 441 | 3300032002 | Ga0307416_100030872 | Ga0307416_1000308722 | 258 |
| 442 | 3300034819 | Ga0373958_0008796 | Ga0373958_0008796_189_965 | 258 |
| 443 | 3300035084 | Ga0373928_0064619 | Ga0373928_0064619_87_866 | 258 |
| 444 | 3300035085 | Ga0373929_0056057 | Ga0373929_0056057_31_807 | 258 |
| 445 | 3300035088 | Ga0373940_0053525 | Ga0373940_0053525_324_1100 | 258 |
| 446 | 3300035112 | Ga0373932_0058930 | Ga0373932_0058930_294_1070 | 258 |
| 447 | 3300035114 | Ga0373939_0012710 | Ga0373939_0012710_949_1725 | 258 |
| 448 | 3300035114 | Ga0373939_0034440 | Ga0373939_0034440_217_993 | 258 |
| 449 | 3300035115 | Ga0373941_0124474 | Ga0373941_0124474_37_813 | 258 |
| 450 | 3300035242 | Ga0373962_0003976 | Ga0373962_0003976_671_1447 | 258 |
| 451 | 3300035691 | Ga0373931_0002462 | Ga0373931_0002462_3398_4177 | 258 |
| 452 | 3300035691 | Ga0373931_0014161 | Ga0373931_0014161_1410_2186 | 258 |
| 453 | 3300037312 | Ga0395899_0109495 | Ga0395899_0109495_78_857 | 258 |
| 454 | 3300037418 | Ga0395900_0069327 | Ga0395900_0069327_1826_2605 | 258 |
| 455 | 3300037466 | Ga0395898_0006319 | Ga0395898_0006319_3150_3929 | 258 |
| 456 | 3300038443 | Ga0395901_0018617 | Ga0395901_0018617_5843_6622 | 258 |
| 457 | 3300039438 | Ga0436360_1132788 | Ga0436360_1132788_529_1308 | 258 |
| 458 | 3300039447 | Ga0436361_0287624 | Ga0436361_0287624_488_1267 | 258 |
| 459 | 3300039447 | Ga0436361_0473175 | Ga0436361_0473175_514_1293 | 258 |
| 460 | 3300039453 | Ga0436362_0719549 | Ga0436362_0719549_393_1172 | 258 |
| 461 | 3300039453 | Ga0436362_1277602 | Ga0436362_1277602_644_1423 | 258 |
| 462 | 3300042005 | Ga0439448_0002910 | Ga0439448_0002910_824_1600 | 258 |
| 463 | 3300042156 | Ga0439446_0043444 | Ga0439446_0043444_529_1305 | 258 |
| 464 | 3300042461 | Ga0439460_0055316 | Ga0439460_0055316_114_893 | 258 |
| 465 | 3300042876 | Ga0451577_0003386 | Ga0451577_0003386_5762_6544 | 258 |
| 466 | 3300042876 | Ga0451577_0381527 | Ga0451577_0381527_22_801 | 258 |
| 467 | 3300042876 | Ga0451577_0780446 | Ga0451577_0780446_58_834 | 258 |
| 468 | 3300044712 | Ga0453684_0039914 | Ga0453684_0039914_3184_3966 | 258 |
| 469 | 3300045051 | Ga0451576_0008215 | Ga0451576_0008215_6660_7442 | 258 |
| 470 | 3300045051 | Ga0451576_0014614 | Ga0451576_0014614_3049_3825 | 258 |
| 471 | 3300045051 | Ga0451576_0261071 | Ga0451576_0261071_650_1426 | 258 |
| 472 | 3300046528 | Ga0495642_0071644 | Ga0495642_0071644_445_1224 | 258 |
| 473 | 3300046664 | Ga0495659_0044197 | Ga0495659_0044197_564_1343 | 258 |
| 474 | 3300048905 | Ga0496102_0170442 | Ga0496102_0170442_1174_1953 | 258 |
| 475 | 3300048906 | Ga0496103_0025766 | Ga0496103_0025766_1893_2672 | 258 |
| 476 | 3300048909 | Ga0496106_0221179 | Ga0496106_0221179_25_804 | 258 |
| 477 | 3300048909 | Ga0496106_0226817 | Ga0496106_0226817_615_1394 | 258 |
| 478 | 3300048915 | Ga0496112_0127246 | Ga0496112_0127246_1318_2094 | 258 |
| 479 | 3300049572 | Ga0501036_0187049 | Ga0501036_0187049_899_1675 | 258 |
| 480 | 3300049574 | Ga0501038_0326733 | Ga0501038_0326733_136_912 | 258 |
| 481 | 3300049576 | Ga0501040_0001722 | Ga0501040_0001722_11591_12367 | 258 |
| 482 | 3300049576 | Ga0501040_0074384 | Ga0501040_0074384_827_1603 | 258 |
| 483 | 3300049577 | Ga0501041_0144029 | Ga0501041_0144029_364_1143 | 258 |
| 484 | 3300049578 | Ga0501042_0167283 | Ga0501042_0167283_89_865 | 258 |
| 485 | 3300049579 | Ga0501043_0360030 | Ga0501043_0360030_221_997 | 258 |
| 486 | 3300049585 | Ga0501069_0006893 | Ga0501069_0006893_5032_5808 | 258 |
| 487 | 3300049588 | Ga0501072_0046125 | Ga0501072_0046125_935_1714 | 258 |
| 488 | 3300049588 | Ga0501072_0202838 | Ga0501072_0202838_65_844 | 258 |
| 489 | 3300049588 | Ga0501072_0369273 | Ga0501072_0369273_193_969 | 258 |
| 490 | 3300049588 | Ga0501072_0383404 | Ga0501072_0383404_219_995 | 258 |
| 491 | 3300049589 | Ga0501073_0332027 | Ga0501073_0332027_143_919 | 258 |
| 492 | 3300049590 | Ga0501074_0205915 | Ga0501074_0205915_279_1055 | 258 |
| 493 | 3300049590 | Ga0501074_0319903 | Ga0501074_0319903_104_883 | 258 |
| 494 | 3300049591 | Ga0501075_0050613 | Ga0501075_0050613_1545_2324 | 258 |
| 495 | 3300049592 | Ga0501076_0056360 | Ga0501076_0056360_1226_2005 | 258 |
| 496 | 3300049593 | Ga0501077_0248959 | Ga0501077_0248959_270_1046 | 258 |
| 497 | 3300049741 | Ga0501079_0320853 | Ga0501079_0320853_394_1173 | 258 |
| 498 | 3300049742 | Ga0501080_0266499 | Ga0501080_0266499_149_925 | 258 |
| 499 | 3300049743 | Ga0501081_0187589 | Ga0501081_0187589_650_1429 | 258 |
| 500 | 3300049743 | Ga0501081_0260273 | Ga0501081_0260273_220_996 | 258 |
| 501 | 3300049824 | Ga0501045_0263284 | Ga0501045_0263284_276_1052 | 258 |
| 502 | 3300050507 | nmdc:mga05p37_1115_c1 | nmdc:mga05p37_1115_c1_25808_26605 | 258 |
| 503 | 3300050507 | nmdc:mga05p37_144398_c1 | nmdc:mga05p37_144398_c1_1641_2417 | 258 |
| 504 | 3300050507 | nmdc:mga05p37_181644_c2 | nmdc:mga05p37_181644_c2_412_1188 | 258 |
| 505 | 3300050507 | nmdc:mga05p37_205798_c1 | nmdc:mga05p37_205798_c1_1162_1941 | 258 |
| 506 | 3300050507 | nmdc:mga05p37_26113_c1 | nmdc:mga05p37_26113_c1_3746_4522 | 258 |
| 507 | 3300050507 | nmdc:mga05p37_2666_c1 | nmdc:mga05p37_2666_c1_6870_7667 | 258 |
| 508 | 3300050507 | nmdc:mga05p37_421958_c1 | nmdc:mga05p37_421958_c1_285_1061 | 258 |
| 509 | 3300050507 | nmdc:mga05p37_44761_c1 | nmdc:mga05p37_44761_c1_1208_1984 | 258 |
| 510 | 3300050507 | nmdc:mga05p37_62605_c1 | nmdc:mga05p37_62605_c1_1837_2613 | 258 |
| 511 | 3300050507 | nmdc:mga05p37_66563_c1 | nmdc:mga05p37_66563_c1_708_1484 | 258 |
| 512 | 3300050507 | nmdc:mga05p37_7018_c1 | nmdc:mga05p37_7018_c1_7712_8509 | 258 |
| 513 | 3300050507 | nmdc:mga05p37_82108_c1 | nmdc:mga05p37_82108_c1_1826_2608 | 258 |
| 514 | 3300050507 | nmdc:mga05p37_8685_c1 | nmdc:mga05p37_8685_c1_23_802 | 258 |
| 515 | 3300050507 | nmdc:mga05p37_95941_c1 | nmdc:mga05p37_95941_c1_2786_3565 | 258 |
| 516 | 3300050508 | nmdc:mga09592_16452_c1 | nmdc:mga09592_16452_c1_1585_2382 | 258 |
| 517 | 3300050508 | nmdc:mga09592_197142_c1 | nmdc:mga09592_197142_c1_216_998 | 258 |
| 518 | 3300050508 | nmdc:mga09592_22344_c1 | nmdc:mga09592_22344_c1_3537_4334 | 258 |
| 519 | 3300050508 | nmdc:mga09592_25659_c1 | nmdc:mga09592_25659_c1_3112_3888 | 258 |
| 520 | 3300050508 | nmdc:mga09592_274842_c1 | nmdc:mga09592_274842_c1_358_1140 | 258 |
| 521 | 3300050508 | nmdc:mga09592_291318_c1 | nmdc:mga09592_291318_c1_93_875 | 258 |
| 522 | 3300050508 | nmdc:mga09592_30550_c1 | nmdc:mga09592_30550_c1_71_850 | 258 |
| 523 | 3300050508 | nmdc:mga09592_476514_c1 | nmdc:mga09592_476514_c1_60_836 | 258 |
| 524 | 3300050508 | nmdc:mga09592_49101_c1 | nmdc:mga09592_49101_c1_1208_2005 | 258 |
| 525 | 3300050508 | nmdc:mga09592_77272_c1 | nmdc:mga09592_77272_c1_204_980 | 258 |
| 526 | 3300050508 | nmdc:mga09592_8095_c1 | nmdc:mga09592_8095_c1_5836_6612 | 258 |
| 527 | 3300050509 | nmdc:mga0qj67_358651_c1 | nmdc:mga0qj67_358651_c1_78_875 | 258 |
| 528 | 3300050509 | nmdc:mga0qj67_4472_c1 | nmdc:mga0qj67_4472_c1_5721_6503 | 258 |
| 529 | 3300050509 | nmdc:mga0qj67_609_c1 | nmdc:mga0qj67_609_c1_13357_14136 | 258 |
| 530 | 3300050509 | nmdc:mga0qj67_71335_c2 | nmdc:mga0qj67_71335_c2_379_1176 | 258 |
| 531 | 3300050510 | nmdc:mga06r32_11477_c1 | nmdc:mga06r32_11477_c1_6868_7644 | 258 |
| 532 | 3300050510 | nmdc:mga06r32_176462_c1 | nmdc:mga06r32_176462_c1_1226_2023 | 258 |
| 533 | 3300050510 | nmdc:mga06r32_20839_c1 | nmdc:mga06r32_20839_c1_1790_2572 | 258 |
| 534 | 3300050510 | nmdc:mga06r32_3086_c1 | nmdc:mga06r32_3086_c1_895_1692 | 258 |
| 535 | 3300050510 | nmdc:mga06r32_319_c1 | nmdc:mga06r32_319_c1_19973_20749 | 258 |
| 536 | 3300050510 | nmdc:mga06r32_472021_c1 | nmdc:mga06r32_472021_c1_98_874 | 258 |
| 537 | 3300050510 | nmdc:mga06r32_49068_c1 | nmdc:mga06r32_49068_c1_212_1009 | 258 |
| 538 | 3300050510 | nmdc:mga06r32_80429_c1 | nmdc:mga06r32_80429_c1_1917_2693 | 258 |
| 539 | 3300050510 | nmdc:mga06r32_86432_c1 | nmdc:mga06r32_86432_c1_1932_2708 | 258 |
| 540 | 3300050511 | nmdc:mga08y16_17679_c1 | nmdc:mga08y16_17679_c1_2572_3354 | 258 |
| 541 | 3300050511 | nmdc:mga08y16_246357_c1 | nmdc:mga08y16_246357_c1_545_1327 | 258 |
| 542 | 3300050511 | nmdc:mga08y16_404511_c1 | nmdc:mga08y16_404511_c1_498_1274 | 258 |
| 543 | 3300050511 | nmdc:mga08y16_5741_c1 | nmdc:mga08y16_5741_c1_10649_11431 | 258 |
| 544 | 3300050512 | nmdc:mga0n895_128409_c1 | nmdc:mga0n895_128409_c1_272_1048 | 258 |
| 545 | 3300050512 | nmdc:mga0n895_3154_c1 | nmdc:mga0n895_3154_c1_318_1115 | 258 |
| 546 | 3300050512 | nmdc:mga0n895_42081_c1 | nmdc:mga0n895_42081_c1_516_1295 | 258 |
| 547 | 3300050512 | nmdc:mga0n895_9717_c1 | nmdc:mga0n895_9717_c1_5387_6169 | 258 |
| 548 | 3300050512 | nmdc:mga0n895_992_c1 | nmdc:mga0n895_992_c1_18486_19262 | 258 |
| 549 | 3300050513 | nmdc:mga0rr50_12950_c1 | nmdc:mga0rr50_12950_c1_3551_4327 | 258 |
| 550 | 3300050513 | nmdc:mga0rr50_164877_c1 | nmdc:mga0rr50_164877_c1_796_1578 | 258 |
| 551 | 3300050513 | nmdc:mga0rr50_27253_c1 | nmdc:mga0rr50_27253_c1_1002_1778 | 258 |
| 552 | 3300050513 | nmdc:mga0rr50_469_c1 | nmdc:mga0rr50_469_c1_9370_10167 | 258 |
| 553 | 3300050514 | nmdc:mga08x19_170810_c1 | nmdc:mga08x19_170810_c1_273_1052 | 258 |
| 554 | 3300050514 | nmdc:mga08x19_842_c1 | nmdc:mga08x19_842_c1_7347_8144 | 258 |
| 555 | 3300050515 | nmdc:mga0a205_193_c1 | nmdc:mga0a205_193_c1_13399_14196 | 258 |
| 556 | 3300050515 | nmdc:mga0a205_198_c1 | nmdc:mga0a205_198_c1_39733_40509 | 258 |
| 557 | 3300050515 | nmdc:mga0a205_20187_c2 | nmdc:mga0a205_20187_c2_234_1010 | 258 |
| 558 | 3300050515 | nmdc:mga0a205_2405_c1 | nmdc:mga0a205_2405_c1_6397_7179 | 258 |
| 559 | 3300050515 | nmdc:mga0a205_3331_c2 | nmdc:mga0a205_3331_c2_4498_5280 | 258 |
| 560 | 3300050515 | nmdc:mga0a205_33852_c1 | nmdc:mga0a205_33852_c1_204_980 | 258 |
| 561 | 3300050515 | nmdc:mga0a205_411_c1 | nmdc:mga0a205_411_c1_19254_20030 | 258 |
| 562 | 3300050515 | nmdc:mga0a205_415374_c1 | nmdc:mga0a205_415374_c1_231_1007 | 258 |
| 563 | 3300050515 | nmdc:mga0a205_487895_c1 | nmdc:mga0a205_487895_c1_35_814 | 258 |
| 564 | 3300050515 | nmdc:mga0a205_66395_c1 | nmdc:mga0a205_66395_c1_2281_3057 | 258 |
| 565 | 3300050515 | nmdc:mga0a205_86642_c1 | nmdc:mga0a205_86642_c1_474_1253 | 258 |
| 566 | 3300050515 | nmdc:mga0a205_92134_c1 | nmdc:mga0a205_92134_c1_1543_2319 | 258 |
| 567 | 3300054114 | Ga0501084_0141413 | Ga0501084_0141413_1184_1963 | 258 |
| 568 | 3300060353 | Ga0501082_0548207 | Ga0501082_0548207_124_900 | 258 |
| 569 | 3300061734 | Ga0530510_0597357 | Ga0530510_0597357_18_794 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ijk-assembly1.cif.gz_D | crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 | 0.9561 | 6 | 256 |
| 7djs-assembly1.cif.gz_B | crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad | 0.955 | 6 | 255 |
| 4jro-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.952 | 1 | 257 |
| 6ixm-assembly1.cif.gz_B | crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad | 0.951 | 1 | 255 |
| 4nbv-assembly1.cif.gz_A | crystal structure of fabg from cupriavidus taiwanensis | 0.9506 | 1 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ixmB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.951 | 1 | 255 | 3.40.50.720 |
| 2rhcB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9499 | 6 | 255 | 3.40.50.720 |
| 2hq1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9481 | 1 | 254 | 3.40.50.720 |
| 3ak4D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9477 | 2 | 258 | 3.40.50.720 |
| 4ni5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9456 | 1 | 255 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T6Z693-F1-model_v4 | SDR family oxidoreductase | 0.961 | 1 | 258 |
GO:0016616
|
| AF-A0A382CEQ8-F1-model_v4 | Uncharacterized protein | 0.9594 | 8 | 255 |
GO:0016491
|
| AF-A0A355A4F3-F1-model_v4 | 3-ketoacyl-ACP reductase | 0.9583 | 2 | 255 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A7T6Z693-F1-model_v4 | SDR family oxidoreductase | 0.9574 | 1 | 258 |
GO:0016616
|
| AF-A0A3N5NQ50-F1-model_v4 | SDR family oxidoreductase | 0.9554 | 3 | 195 |
GO:0006633
GO:0016616 GO:0048038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar