F464722

General Info

Members Datasets Scaffolds Average Seq Length
569 224 569 251

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10474286|Ga0114129_104742862
Length 266
Sequence MPRETEGVMELQGQVAIVTGGGRGIGRATALELARLGADVVVAELDKAGAERXXXXVAALGRKALAIATDVTRRGDLAAMVERTKAELGRVDVLVNNAGIYRAASNLDVTEEHWDAIMTINAKAVFFASQAVLPVMIAQKRGAIVNLASMAGKIGSKTNLPYNASKAAVISMTKSLALAHAVDGIRVNCVCPGFVETDMWKMVARDQGALLGMSAEEFTRQRASQVPLGRMERAEDVAAVIGFLASPRAGYMTGQALSVDGGLVMH

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
160 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 98.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10002664 3300003911 Bacteria 3091
2 Ga0065707_10002362 3300005295 Bacteria 4687
3 Ga0065707_10154868 3300005295 Bacteria 1619
4 Ga0070690_100386359 3300005330 Bacteria 1024
5 Ga0070670_100010274 3300005331 Bacteria 7989
6 Ga0068869_100006037 3300005334 Bacteria 7663
7 Ga0068869_100021375 3300005334 Bacteria 4451
8 Ga0068869_100212349 3300005334 Bacteria 1530
9 Ga0070680_100000760 3300005336 Bacteria 22551
10 Ga0070680_100052537 3300005336 Bacteria 3326
11 Ga0070682_100000576 3300005337 Bacteria 22513
12 Ga0068868_100067540 3300005338 Bacteria 2846
13 Ga0070660_100015018 3300005339 Bacteria 5585
14 Ga0070691_10014801 3300005341 Bacteria 3581
15 Ga0070691_10160146 3300005341 Bacteria 1160
16 Ga0070661_100010023 3300005344 Bacteria 6576
17 Ga0070692_10066530 3300005345 Bacteria 1910
18 Ga0070692_10151914 3300005345 Bacteria 1319
19 Ga0070668_100370341 3300005347 Bacteria 1217
20 Ga0070669_100045049 3300005353 Bacteria 3214
21 Ga0070669_100075120 3300005353 Bacteria 2506
22 Ga0070669_100184261 3300005353 Bacteria 1635
23 Ga0070659_100001314 3300005366 Bacteria 18007
24 Ga0070703_10019267 3300005406 Bacteria 1978
25 Ga0070703_10033763 3300005406 Bacteria 1559
26 Ga0070709_10194395 3300005434 Bacteria 1433
27 Ga0070713_100093895 3300005436 Bacteria 2585
28 Ga0070710_10096970 3300005437 Bacteria 1748
29 Ga0070705_100013522 3300005440 Bacteria 4177
30 Ga0070705_100370725 3300005440 Bacteria 1050
31 Ga0070705_100433594 3300005440 Bacteria 982
32 Ga0070700_100033620 3300005441 Bacteria 3090
33 Ga0070700_100149350 3300005441 Bacteria 1597
34 Ga0070700_100157761 3300005441 Bacteria 1559
35 Ga0070694_100069442 3300005444 Bacteria 2424
36 Ga0070694_100136842 3300005444 Bacteria 1776
37 Ga0070694_100385712 3300005444 Bacteria 1094
38 Ga0070708_100010003 3300005445 Bacteria 7674
39 Ga0070708_100016993 3300005445 Bacteria 6055
40 Ga0070708_100030939 3300005445 Bacteria 4630
41 Ga0070708_100405866 3300005445 Bacteria 1285
42 Ga0070663_100022880 3300005455 Bacteria 4183
43 Ga0070662_100340349 3300005457 Bacteria 1227
44 Ga0070681_10330952 3300005458 Bacteria 1433
45 Ga0070681_10354790 3300005458 Bacteria 1377
46 Ga0068867_100023240 3300005459 Bacteria 4438
47 Ga0068867_100126813 3300005459 Bacteria 1979
48 Ga0070706_100015079 3300005467 Bacteria 7139
49 Ga0070706_100032255 3300005467 Bacteria 4832
50 Ga0070706_100037818 3300005467 Bacteria 4456
51 Ga0070706_100105679 3300005467 Bacteria 2619
52 Ga0070706_100119502 3300005467 Bacteria 2456
53 Ga0070706_100351685 3300005467 Bacteria 1373
54 Ga0070707_100004351 3300005468 Bacteria 13272
55 Ga0070707_100035375 3300005468 Unclassified 4764
56 Ga0070707_100066676 3300005468 Bacteria 3460
57 Ga0070707_100098328 3300005468 Bacteria 2834
58 Ga0070707_100359352 3300005468 Bacteria 1415
59 Ga0070707_100497676 3300005468 Bacteria 1180
60 Ga0070698_100021719 3300005471 Bacteria 6720
61 Ga0070698_100041112 3300005471 Bacteria 4748
62 Ga0070698_100084836 3300005471 Bacteria 3155
63 Ga0070698_100178249 3300005471 Unclassified 2064
64 Ga0070698_100278315 3300005471 Bacteria 1605
65 Ga0070698_100494405 3300005471 Bacteria 1161
66 Ga0070699_100001996 3300005518 Bacteria 18409
67 Ga0070699_100013157 3300005518 Bacteria 7135
68 Ga0070699_100013971 3300005518 Bacteria 6907
69 Ga0070699_100016965 3300005518 Bacteria 6251
70 Ga0070699_100080611 3300005518 Bacteria 2837
71 Ga0070699_100461149 3300005518 Bacteria 1152
72 Ga0070699_100644703 3300005518 Bacteria 967
73 Ga0070697_100000352 3300005536 Bacteria 36213
74 Ga0070697_100036933 3300005536 Bacteria 3946
75 Ga0070697_100060327 3300005536 Bacteria 3091
76 Ga0070697_100100908 3300005536 Bacteria 2398
77 Ga0070697_100104836 3300005536 Bacteria 2351
78 Ga0070697_100301253 3300005536 Bacteria 1378
79 Ga0068853_100010427 3300005539 Bacteria 7519
80 Ga0070695_100005280 3300005545 Bacteria 7607
81 Ga0070695_100052947 3300005545 Bacteria 2610
82 Ga0070695_100142521 3300005545 Bacteria 1663
83 Ga0070696_100000633 3300005546 Bacteria 22426
84 Ga0070696_100019756 3300005546 Bacteria 4565
85 Ga0070696_100055165 3300005546 Bacteria 2771
86 Ga0070696_100184857 3300005546 Bacteria 1548
87 Ga0070693_100001427 3300005547 Bacteria 10789
88 Ga0070704_100010857 3300005549 Bacteria 5556
89 Ga0070704_100787945 3300005549 Bacteria 848
90 Ga0068855_100002556 3300005563 Bacteria 22426
91 Ga0070664_100038039 3300005564 Bacteria 4048
92 Ga0068857_100015869 3300005577 Bacteria 6592
93 Ga0068857_100065521 3300005577 Bacteria 3231
94 Ga0068857_100079276 3300005577 Bacteria 2932
95 Ga0068854_100005247 3300005578 Bacteria 8174
96 Ga0068856_100006151 3300005614 Bacteria 11778
97 Ga0068859_100191402 3300005617 Bacteria 2130
98 Ga0068864_100083860 3300005618 Bacteria 2799
99 Ga0068864_100145596 3300005618 Bacteria 2141
100 Ga0068866_10251868 3300005718 Bacteria 1081
101 Ga0068861_100018437 3300005719 Bacteria 4972
102 Ga0068861_100629091 3300005719 Bacteria 989
103 Ga0068870_10002863 3300005840 Bacteria 7259
104 Ga0068870_10128167 3300005840 Bacteria 1470
105 Ga0068863_100048853 3300005841 Bacteria 4011
106 Ga0068858_100098485 3300005842 Bacteria 2726
107 Ga0068858_100098762 3300005842 Bacteria 2722
108 Ga0068858_100165090 3300005842 Bacteria 2086
109 Ga0068860_100153741 3300005843 Bacteria 2217
110 Ga0068860_100239173 3300005843 Bacteria 1766
111 Ga0068860_100526227 3300005843 Bacteria 1183
112 Ga0068862_100075931 3300005844 Bacteria 2908
113 Ga0068862_100193739 3300005844 Bacteria 1830
114 Ga0068862_100271736 3300005844 Bacteria 1550
115 Ga0068862_100304193 3300005844 Bacteria 1468
116 Ga0068862_100330435 3300005844 Bacteria 1409
117 Ga0081455_10000411 3300005937 Bacteria 56303
118 Ga0081455_10059776 3300005937 Bacteria 3216
119 Ga0081538_10006480 3300005981 Bacteria 10301
120 Ga0081538_10048880 3300005981 Bacteria 2573
121 Ga0081538_10092478 3300005981 Bacteria 1557
122 Ga0081538_10094691 3300005981 Bacteria 1528
123 Ga0081540_1018028 3300005983 Bacteria 4346
124 Ga0081539_10000083 3300005985 Bacteria 218881
125 Ga0070717_10346012 3300006028 Bacteria 1328
126 Ga0070712_100013947 3300006175 Bacteria 5148
127 Ga0075428_100000136 3300006844 Bacteria 64933
128 Ga0075428_100000176 3300006844 Bacteria 59684
129 Ga0075428_100006989 3300006844 Bacteria 12517
130 Ga0075428_100011008 3300006844 Bacteria 10059
131 Ga0075428_100033421 3300006844 Bacteria 5680
132 Ga0075428_100052536 3300006844 Bacteria 4466
133 Ga0075428_100110125 3300006844 Bacteria 3000
134 Ga0075428_100394630 3300006844 Bacteria 1483
135 Ga0075428_100404442 3300006844 Bacteria 1463
136 Ga0075430_100000813 3300006846 Bacteria 24298
137 Ga0075430_100003852 3300006846 Bacteria 12635
138 Ga0075430_100008443 3300006846 Bacteria 8704
139 Ga0075430_100013412 3300006846 Bacteria 6985
140 Ga0075430_100218626 3300006846 Bacteria 1581
141 Ga0075430_100405406 3300006846 Bacteria 1125
142 Ga0075431_100000061 3300006847 Bacteria 61386
143 Ga0075431_100002555 3300006847 Bacteria 17564
144 Ga0075431_100002933 3300006847 Bacteria 16517
145 Ga0075431_100003953 3300006847 Bacteria 14440
146 Ga0075431_100005544 3300006847 Bacteria 12458
147 Ga0075431_100005602 3300006847 Bacteria 12402
148 Ga0075431_100063427 3300006847 Bacteria 3813
149 Ga0075431_100565111 3300006847 Bacteria 1124
150 Ga0075431_100669665 3300006847 Bacteria 1017
151 Ga0075433_10003076 3300006852 Bacteria 12819
152 Ga0075433_10010743 3300006852 Bacteria 7364
153 Ga0075433_10010749 3300006852 Bacteria 7361
154 Ga0075433_10016394 3300006852 Bacteria 6105
155 Ga0075433_10027291 3300006852 Bacteria 4841
156 Ga0075433_10041664 3300006852 Bacteria 3979
157 Ga0075433_10067125 3300006852 Bacteria 3148
158 Ga0075433_10099954 3300006852 Bacteria 2568
159 Ga0075433_10102366 3300006852 Bacteria 2536
160 Ga0075433_10178939 3300006852 Bacteria 1887
161 Ga0075433_10271500 3300006852 Bacteria 1503
162 Ga0075433_10649871 3300006852 Bacteria 925
163 Ga0075434_100000404 3300006871 Bacteria 31777
164 Ga0075434_100013058 3300006871 Bacteria 7887
165 Ga0075434_100109151 3300006871 Bacteria 2777
166 Ga0075434_100117773 3300006871 Bacteria 2669
167 Ga0075434_100136042 3300006871 Bacteria 2476
168 Ga0075434_100202773 3300006871 Bacteria 2004
169 Ga0075429_100000739 3300006880 Bacteria 25629
170 Ga0075429_100028874 3300006880 Bacteria 4818
171 Ga0075429_100030126 3300006880 Bacteria 4714
172 Ga0075429_100108151 3300006880 Bacteria 2430
173 Ga0075429_100136700 3300006880 Bacteria 2145
174 Ga0075429_100209009 3300006880 Bacteria 1710
175 Ga0075429_100471773 3300006880 Bacteria 1099
176 Ga0075429_100480469 3300006880 Bacteria 1089
177 Ga0075429_100502349 3300006880 Bacteria 1063
178 Ga0068865_100430459 3300006881 Bacteria 1087
179 Ga0075436_100002609 3300006914 Bacteria 12389
180 Ga0075436_100017258 3300006914 Bacteria 4941
181 Ga0075436_100037820 3300006914 Bacteria 3332
182 Ga0075436_100476898 3300006914 Bacteria 911
183 Ga0097620_100191413 3300006931 Bacteria 2130
184 Ga0075435_100006024 3300007076 Bacteria 8538
185 Ga0075435_100009151 3300007076 Bacteria 7150
186 Ga0075435_100013417 3300007076 Bacteria 6095
187 Ga0075435_100027634 3300007076 Bacteria 4441
188 Ga0075435_100048090 3300007076 Bacteria 3426
189 Ga0075435_100066977 3300007076 Bacteria 2923
190 Ga0075435_100108626 3300007076 Bacteria 2305
191 Ga0075435_100276348 3300007076 Bacteria 1433
192 Ga0099794_10002483 3300007265 Bacteria 6806
193 Ga0099794_10109786 3300007265 Bacteria 1381
194 Ga0099795_10124545 3300007788 Bacteria 1034
195 Ga0111539_10000715 3300009094 Bacteria 43156
196 Ga0111539_10000988 3300009094 Bacteria 37262
197 Ga0111539_10011434 3300009094 Bacteria 11142
198 Ga0111539_10014429 3300009094 Bacteria 9861
199 Ga0111539_10150951 3300009094 Bacteria 2719
200 Ga0105245_10677664 3300009098 Bacteria 1063
201 Ga0105247_10320765 3300009101 Bacteria 1081
202 Ga0114129_10000847 3300009147 Bacteria 39608
203 Ga0114129_10003560 3300009147 Bacteria 21926
204 Ga0114129_10006715 3300009147 Bacteria 16338
205 Ga0114129_10009764 3300009147 Bacteria 13684
206 Ga0114129_10011521 3300009147 Bacteria 12592
207 Ga0114129_10019275 3300009147 Bacteria 9717
208 Ga0114129_10036621 3300009147 Bacteria 6927
209 Ga0114129_10038128 3300009147 Bacteria 6781
210 Ga0114129_10040737 3300009147 Bacteria 6547
211 Ga0114129_10042610 3300009147 Bacteria 6390
212 Ga0114129_10092345 3300009147 Bacteria 4194
213 Ga0114129_10142971 3300009147 Bacteria 3278
214 Ga0114129_10203024 3300009147 Bacteria 2683
215 Ga0114129_10268708 3300009147 Bacteria 2282
216 Ga0114129_10409453 3300009147 Bacteria 1786
217 Ga0114129_10474286 3300009147 Bacteria 1638
218 Ga0114129_10588943 3300009147 Bacteria 1442
219 Ga0114129_11159610 3300009147 Bacteria 964
220 Ga0114129_11219138 3300009147 Bacteria 936
221 Ga0105243_10021187 3300009148 Bacteria 4933
222 Ga0105243_10089083 3300009148 Bacteria 2536
223 Ga0105243_10193877 3300009148 Bacteria 1777
224 Ga0105243_10383788 3300009148 Bacteria 1300
225 Ga0105241_10003228 3300009174 Bacteria 12131
226 Ga0105241_10436654 3300009174 Bacteria 1155
227 Ga0105242_10013532 3300009176 Bacteria 6309
228 Ga0105249_10101021 3300009553 Bacteria 2712
229 Ga0105249_10180012 3300009553 Bacteria 2056
230 Ga0105249_10287600 3300009553 Bacteria 1644
231 Ga0105249_10327155 3300009553 Bacteria 1545
232 Ga0099796_10078649 3300010159 Bacteria 1205
233 Ga0105239_10121292 3300010375 Bacteria 2904
234 Ga0105246_10182810 3300011119 Bacteria 1616
235 Ga0157373_10003300 3300013100 Bacteria 12193
236 Ga0163162_10036621 3300013306 Bacteria 4892
237 Ga0163162_10190710 3300013306 Bacteria 2177
238 Ga0163162_10421869 3300013306 Bacteria 1466
239 Ga0163162_10853799 3300013306 Bacteria 1025
240 Ga0163162_11108454 3300013306 Bacteria 897
241 Ga0157372_10009405 3300013307 Bacteria 10396
242 Ga0157375_10789909 3300013308 Bacteria 1098
243 Ga0157380_10703356 3300014326 Bacteria 1016
244 Ga0157380_11087757 3300014326 Bacteria 838
245 Ga0157379_10053779 3300014968 Bacteria 3597
246 Ga0157379_10208994 3300014968 Bacteria 1766
247 Ga0182007_10013413 3300015262 Bacteria 3125
248 Ga0207653_10007017 3300025885 Bacteria 3516
249 Ga0207645_10018926 3300025907 Bacteria 4522
250 Ga0207645_10196909 3300025907 Bacteria 1325
251 Ga0207643_10003668 3300025908 Bacteria 8275
252 Ga0207643_10173079 3300025908 Bacteria 1304
253 Ga0207684_10000566 3300025910 Bacteria 45187
254 Ga0207684_10009022 3300025910 Bacteria 8839
255 Ga0207684_10013553 3300025910 Bacteria 7050
256 Ga0207684_10054361 3300025910 Bacteria 3397
257 Ga0207684_10074444 3300025910 Bacteria 2885
258 Ga0207684_10097849 3300025910 Bacteria 2505
259 Ga0207684_10121595 3300025910 Bacteria 2238
260 Ga0207684_10142825 3300025910 Bacteria 2058
261 Ga0207654_10124269 3300025911 Bacteria 1625
262 Ga0207654_10371744 3300025911 Bacteria 988
263 Ga0207707_10000056 3300025912 Bacteria 113344
264 Ga0207707_10254187 3300025912 Bacteria 1526
265 Ga0207693_10003246 3300025915 Bacteria 13955
266 Ga0207693_10035398 3300025915 Bacteria 3937
267 Ga0207660_10289789 3300025917 Bacteria 1301
268 Ga0207657_10000306 3300025919 Bacteria 51970
269 Ga0207649_10006470 3300025920 Bacteria 6362
270 Ga0207652_10002550 3300025921 Bacteria 15297
271 Ga0207652_10561556 3300025921 Bacteria 1025
272 Ga0207646_10000948 3300025922 Bacteria 37329
273 Ga0207646_10007532 3300025922 Bacteria 11044
274 Ga0207646_10012657 3300025922 Bacteria 8097
275 Ga0207646_10062196 3300025922 Bacteria 3333
276 Ga0207646_10110506 3300025922 Bacteria 2466
277 Ga0207646_10256011 3300025922 Bacteria 1582
278 Ga0207646_10269474 3300025922 Bacteria 1539
279 Ga0207646_10370563 3300025922 Bacteria 1294
280 Ga0207681_10014687 3300025923 Bacteria 4875
281 Ga0207681_10035929 3300025923 Bacteria 3266
282 Ga0207681_10369393 3300025923 Bacteria 1152
283 Ga0207687_10419317 3300025927 Bacteria 1104
284 Ga0207664_10223286 3300025929 Bacteria 1635
285 Ga0207690_10011140 3300025932 Bacteria 5366
286 Ga0207706_10235849 3300025933 Bacteria 1600
287 Ga0207709_10008877 3300025935 Bacteria 5548
288 Ga0207709_10328912 3300025935 Bacteria 1147
289 Ga0207704_10307805 3300025938 Bacteria 1217
290 Ga0207691_10015290 3300025940 Bacteria 7302
291 Ga0207691_10033639 3300025940 Bacteria 4773
292 Ga0207689_10017813 3300025942 Bacteria 6002
293 Ga0207689_10020104 3300025942 Bacteria 5622
294 Ga0207689_10024260 3300025942 Bacteria 5088
295 Ga0207661_10786064 3300025944 Bacteria 876
296 Ga0207679_10023975 3300025945 Bacteria 4179
297 Ga0207667_10004946 3300025949 Bacteria 16274
298 Ga0207651_10212295 3300025960 Bacteria 1559
299 Ga0207712_10105510 3300025961 Bacteria 2103
300 Ga0207712_10157312 3300025961 Bacteria 1762
301 Ga0207712_10459295 3300025961 Bacteria 1082
302 Ga0207668_10336284 3300025972 Bacteria 1258
303 Ga0207677_10164913 3300026023 Bacteria 1726
304 Ga0207703_10067126 3300026035 Bacteria 2952
305 Ga0207703_10075319 3300026035 Bacteria 2797
306 Ga0207639_10011217 3300026041 Bacteria 6216
307 Ga0207678_10037207 3300026067 Bacteria 4234
308 Ga0207708_10096551 3300026075 Bacteria 2284
309 Ga0207708_10098046 3300026075 Bacteria 2265
310 Ga0207708_10111939 3300026075 Bacteria 2120
311 Ga0207708_10334691 3300026075 Bacteria 1238
312 Ga0207702_10005604 3300026078 Bacteria 10958
313 Ga0207641_10030042 3300026088 Bacteria 4499
314 Ga0207641_10144558 3300026088 Bacteria 2149
315 Ga0207648_10003466 3300026089 Bacteria 16541
316 Ga0207648_10279191 3300026089 Bacteria 1493
317 Ga0207674_10038305 3300026116 Bacteria 4978
318 Ga0207674_10092257 3300026116 Bacteria 3018
319 Ga0207674_10104086 3300026116 Bacteria 2817
320 Ga0207675_100009557 3300026118 Bacteria 9068
321 Ga0207675_100032298 3300026118 Bacteria 4875
322 Ga0209971_1024648 3300027682 Bacteria 1436
323 Ga0209971_1032359 3300027682 Bacteria 1255
324 Ga0207428_10000631 3300027907 Bacteria 41443
325 Ga0207428_10029258 3300027907 Bacteria 4568
326 Ga0207428_10203504 3300027907 Bacteria 1489
327 Ga0207428_10203922 3300027907 Bacteria 1488
328 Ga0268265_10174361 3300028380 Bacteria 1841
329 Ga0268265_10178033 3300028380 Bacteria 1824
330 Ga0268265_10218322 3300028380 Bacteria 1666
331 Ga0268265_10609919 3300028380 Bacteria 1044
332 Ga0268264_10099197 3300028381 Bacteria 2527
333 Ga0268264_10130013 3300028381 Bacteria 2230
334 Ga0268264_10156617 3300028381 Unclassified 2048
335 Ga0307408_100032622 3300031548 Bacteria 3632
336 Ga0307408_100136295 3300031548 Bacteria 1921
337 Ga0307408_100177142 3300031548 Bacteria 1707
338 Ga0307408_100231905 3300031548 Bacteria 1512
339 Ga0307405_10413840 3300031731 Bacteria 1059
340 Ga0307410_10067961 3300031852 Bacteria 2460
341 Ga0307406_10242178 3300031901 Bacteria 1353
342 Ga0307407_10522664 3300031903 Bacteria 873
343 Ga0307409_100092962 3300031995 Bacteria 2477
344 Ga0307409_100185056 3300031995 Bacteria 1848
345 Ga0307416_100030872 3300032002 Bacteria 4027
346 Ga0307411_10137337 3300032005 Bacteria 1797
347 Ga0307415_100298298 3300032126 Bacteria 1334
348 Ga0373948_0006772 3300034817 Bacteria 1907
349 Ga0373958_0008796 3300034819 Bacteria 1646
350 Ga0373928_0064619 3300035084 Bacteria 892
351 Ga0373929_0056057 3300035085 Bacteria 912
352 Ga0373940_0017138 3300035088 Bacteria 1804
353 Ga0373940_0053525 3300035088 Bacteria 1139
354 Ga0373932_0058930 3300035112 Bacteria 1162
355 Ga0373939_0012710 3300035114 Bacteria 2152
356 Ga0373939_0034440 3300035114 Bacteria 1486
357 Ga0373941_0124474 3300035115 Bacteria 922
358 Ga0373955_0091241 3300035172 Bacteria 1736
359 Ga0373962_0003976 3300035242 Bacteria 3560
360 Ga0373931_0002462 3300035691 Bacteria 8202
361 Ga0373931_0014161 3300035691 Bacteria 3895
362 Ga0373931_0025011 3300035691 Bacteria 3031
363 Ga0373933_0212673 3300035724 Bacteria 1239
364 Ga0395899_0109495 3300037312 Bacteria 1987
365 Ga0395900_0069327 3300037418 Bacteria 3624
366 Ga0395898_0006319 3300037466 Bacteria 12657
367 Ga0395901_0018617 3300038443 Bacteria 7093
368 Ga0242420_005053 3300038996 Bacteria 2025
369 Ga0436360_1132788 3300039438 Bacteria 2237
370 Ga0436361_0287624 3300039447 Bacteria 2141
371 Ga0436361_0473175 3300039447 Bacteria 1620
372 Ga0436362_0719549 3300039453 Bacteria 2973
373 Ga0436362_1277602 3300039453 Bacteria 2225
374 Ga0439448_0002910 3300042005 Bacteria 4694
375 Ga0439446_0043444 3300042156 Bacteria 1328
376 Ga0439459_0001197 3300042438 Bacteria 3784
377 Ga0439460_0055316 3300042461 Bacteria 1199
378 Ga0451577_0003386 3300042876 Bacteria 17836
379 Ga0451577_0115739 3300042876 Bacteria 2401
380 Ga0451577_0381527 3300042876 Bacteria 1279
381 Ga0451577_0780446 3300042876 Bacteria 863
382 Ga0453684_0039914 3300044712 Bacteria 6384
383 Ga0451576_0008215 3300045051 Bacteria 12282
384 Ga0451576_0014614 3300045051 Bacteria 8725
385 Ga0451576_0173678 3300045051 Bacteria 2249
386 Ga0451576_0261071 3300045051 Bacteria 1810
387 Ga0451576_0276457 3300045051 Bacteria 1756
388 Ga0451576_0557773 3300045051 Bacteria 1203
389 Ga0495592_0238744 3300046454 Bacteria 1207
390 Ga0495580_0000719 3300046472 Bacteria 28283
391 Ga0495664_0147786 3300046477 Bacteria 1425
392 Ga0495584_0135346 3300046491 Bacteria 1251
393 Ga0495608_0071871 3300046511 Bacteria 2257
394 Ga0495628_0160573 3300046516 Bacteria 1708
395 Ga0495642_0071644 3300046528 Bacteria 1450
396 Ga0495640_0108072 3300046533 Bacteria 1820
397 Ga0495587_0151328 3300046536 Bacteria 1322
398 Ga0495667_0006813 3300046559 Bacteria 7758
399 Ga0495656_0210400 3300046615 Bacteria 969
400 Ga0495635_0476475 3300046663 Bacteria 823
401 Ga0495659_0044197 3300046664 Bacteria 1601
402 Ga0495657_0087703 3300046675 Bacteria 2002
403 Ga0495599_0093123 3300046678 Bacteria 1880
404 Ga0495669_0028433 3300046684 Bacteria 2449
405 Ga0495669_0084786 3300046684 Bacteria 1457
406 Ga0495674_0126303 3300047319 Bacteria 2158
407 Ga0495680_0130519 3300047322 Bacteria 1847
408 Ga0495675_0157974 3300047444 Bacteria 1397
409 Ga0495684_0160671 3300047471 Bacteria 1676
410 Ga0495602_0033380 3300048088 Bacteria 4828
411 Ga0496102_0170442 3300048905 Bacteria 2049
412 Ga0496103_0025766 3300048906 Bacteria 3557
413 Ga0496105_0402525 3300048908 Bacteria 1086
414 Ga0496106_0221179 3300048909 Bacteria 1510
415 Ga0496106_0226817 3300048909 Bacteria 1491
416 Ga0496112_0127246 3300048915 Bacteria 2518
417 Ga0501031_0150816 3300049568 Bacteria 1519
418 Ga0501036_0017276 3300049572 Bacteria 6030
419 Ga0501036_0187049 3300049572 Bacteria 1743
420 Ga0501036_0251842 3300049572 Bacteria 1480
421 Ga0501038_0326733 3300049574 Bacteria 1199
422 Ga0501040_0001722 3300049576 Bacteria 14034
423 Ga0501040_0015346 3300049576 Bacteria 5066
424 Ga0501040_0074384 3300049576 Bacteria 2348
425 Ga0501041_0144029 3300049577 Bacteria 1487
426 Ga0501041_0200304 3300049577 Bacteria 1251
427 Ga0501042_0159885 3300049578 Bacteria 1625
428 Ga0501042_0167283 3300049578 Bacteria 1586
429 Ga0501043_0285299 3300049579 Bacteria 1265
430 Ga0501043_0360030 3300049579 Bacteria 1104
431 Ga0501046_0236893 3300049580 Bacteria 1347
432 Ga0501048_0110168 3300049582 Bacteria 1944
433 Ga0501048_0471037 3300049582 Bacteria 900
434 Ga0501069_0006893 3300049585 Bacteria 5939
435 Ga0501071_0035691 3300049587 Bacteria 3543
436 Ga0501071_0082215 3300049587 Bacteria 2358
437 Ga0501072_0023067 3300049588 Bacteria 4832
438 Ga0501072_0046125 3300049588 Bacteria 3428
439 Ga0501072_0054393 3300049588 Bacteria 3153
440 Ga0501072_0155942 3300049588 Bacteria 1821
441 Ga0501072_0202838 3300049588 Bacteria 1581
442 Ga0501072_0369273 3300049588 Bacteria 1139
443 Ga0501072_0383404 3300049588 Bacteria 1115
444 Ga0501072_0423031 3300049588 Bacteria 1056
445 Ga0501073_0332027 3300049589 Bacteria 1050
446 Ga0501074_0196933 3300049590 Bacteria 1436
447 Ga0501074_0205915 3300049590 Bacteria 1402
448 Ga0501074_0319903 3300049590 Bacteria 1102
449 Ga0501075_0032000 3300049591 Bacteria 3907
450 Ga0501075_0050613 3300049591 Bacteria 3123
451 Ga0501076_0056360 3300049592 Bacteria 3119
452 Ga0501076_0201183 3300049592 Bacteria 1626
453 Ga0501076_0607984 3300049592 Bacteria 902
454 Ga0501077_0016474 3300049593 Bacteria 4657
455 Ga0501077_0031103 3300049593 Bacteria 3395
456 Ga0501077_0248959 3300049593 Bacteria 1130
457 Ga0501079_0006563 3300049741 Bacteria 8748
458 Ga0501079_0023810 3300049741 Bacteria 4698
459 Ga0501079_0320853 3300049741 Bacteria 1213
460 Ga0501079_0326395 3300049741 Bacteria 1202
461 Ga0501080_0060236 3300049742 Bacteria 3533
462 Ga0501080_0266499 3300049742 Bacteria 1560
463 Ga0501081_0001399 3300049743 Bacteria 14723
464 Ga0501081_0035410 3300049743 Bacteria 3398
465 Ga0501081_0187589 3300049743 Bacteria 1497
466 Ga0501081_0205737 3300049743 Bacteria 1428
467 Ga0501081_0260273 3300049743 Bacteria 1268
468 Ga0501081_0364450 3300049743 Bacteria 1066
469 Ga0501083_0291660 3300049744 Bacteria 1061
470 Ga0501045_0004907 3300049824 Bacteria 9265
471 Ga0501045_0125327 3300049824 Bacteria 1908
472 Ga0501045_0263284 3300049824 Bacteria 1284
473 nmdc:mga05p37_1115_c1 3300050507 Bacteria 30862
474 nmdc:mga05p37_144398_c1 3300050507 Bacteria 2915
475 nmdc:mga05p37_181644_c2 3300050507 Bacteria 1638
476 nmdc:mga05p37_205798_c1 3300050507 Bacteria 2381
477 nmdc:mga05p37_26113_c1 3300050507 Bacteria 7102
478 nmdc:mga05p37_2666_c1 3300050507 Bacteria 20793
479 nmdc:mga05p37_282394_c1 3300050507 Bacteria 1979
480 nmdc:mga05p37_32895_c1 3300050507 Bacteria 6347
481 nmdc:mga05p37_352555_c1 3300050507 Bacteria 1732
482 nmdc:mga05p37_421958_c1 3300050507 Bacteria 1552
483 nmdc:mga05p37_44761_c1 3300050507 Bacteria 5445
484 nmdc:mga05p37_49840_c1 3300050507 Bacteria 5150
485 nmdc:mga05p37_62605_c1 3300050507 Bacteria 4578
486 nmdc:mga05p37_66563_c1 3300050507 Bacteria 4432
487 nmdc:mga05p37_7018_c1 3300050507 Bacteria 13275
488 nmdc:mga05p37_82108_c1 3300050507 Bacteria 3971
489 nmdc:mga05p37_838348_c1 3300050507 Bacteria 1000
490 nmdc:mga05p37_8685_c1 3300050507 Bacteria 12004
491 nmdc:mga05p37_95941_c1 3300050507 Bacteria 3653
492 nmdc:mga09592_16452_c1 3300050508 Bacteria 6050
493 nmdc:mga09592_197142_c1 3300050508 Bacteria 1743
494 nmdc:mga09592_22344_c1 3300050508 Bacteria 5220
495 nmdc:mga09592_230753_c1 3300050508 Bacteria 1604
496 nmdc:mga09592_25659_c1 3300050508 Bacteria 4880
497 nmdc:mga09592_274842_c1 3300050508 Bacteria 1461
498 nmdc:mga09592_291318_c1 3300050508 Bacteria 1415
499 nmdc:mga09592_30550_c1 3300050508 Bacteria 4484
500 nmdc:mga09592_3336_c1 3300050508 Bacteria 12983
501 nmdc:mga09592_443704_c1 3300050508 Bacteria 1120
502 nmdc:mga09592_476514_c1 3300050508 Bacteria 1076
503 nmdc:mga09592_49101_c1 3300050508 Bacteria 3558
504 nmdc:mga09592_77272_c1 3300050508 Bacteria 2832
505 nmdc:mga09592_8095_c1 3300050508 Bacteria 8549
506 nmdc:mga0qj67_358651_c1 3300050509 Bacteria 1178
507 nmdc:mga0qj67_4472_c1 3300050509 Bacteria 10129
508 nmdc:mga0qj67_48553_c1 3300050509 Bacteria 3353
509 nmdc:mga0qj67_609_c1 3300050509 Bacteria 24498
510 nmdc:mga0qj67_69540_c1 3300050509 Bacteria 2808
511 nmdc:mga0qj67_71335_c2 3300050509 Bacteria 1833
512 nmdc:mga06r32_11477_c1 3300050510 Bacteria 7980
513 nmdc:mga06r32_176462_c1 3300050510 Bacteria 2121
514 nmdc:mga06r32_20839_c1 3300050510 Bacteria 6041
515 nmdc:mga06r32_270747_c1 3300050510 Bacteria 1686
516 nmdc:mga06r32_3086_c1 3300050510 Bacteria 14908
517 nmdc:mga06r32_319_c1 3300050510 Bacteria 40297
518 nmdc:mga06r32_33390_c1 3300050510 Bacteria 4847
519 nmdc:mga06r32_356225_c1 3300050510 Bacteria 1448
520 nmdc:mga06r32_472021_c1 3300050510 Bacteria 1233
521 nmdc:mga06r32_4823_c1 3300050510 Bacteria 12141
522 nmdc:mga06r32_49068_c1 3300050510 Bacteria 4037
523 nmdc:mga06r32_80429_c1 3300050510 Bacteria 3171
524 nmdc:mga06r32_86432_c1 3300050510 Bacteria 3058
525 nmdc:mga08y16_17679_c1 3300050511 Bacteria 7510
526 nmdc:mga08y16_246357_c1 3300050511 Bacteria 1847
527 nmdc:mga08y16_284684_c1 3300050511 Bacteria 1704
528 nmdc:mga08y16_404511_c1 3300050511 Bacteria 1397
529 nmdc:mga08y16_5741_c1 3300050511 Bacteria 13003
530 nmdc:mga0n895_115880_c1 3300050512 Bacteria 2698
531 nmdc:mga0n895_128409_c1 3300050512 Bacteria 2560
532 nmdc:mga0n895_3154_c1 3300050512 Bacteria 13165
533 nmdc:mga0n895_42081_c1 3300050512 Bacteria 4444
534 nmdc:mga0n895_865643_c1 3300050512 Bacteria 891
535 nmdc:mga0n895_9717_c1 3300050512 Bacteria 8436
536 nmdc:mga0n895_992_c1 3300050512 Bacteria 20574
537 nmdc:mga0rr50_12950_c1 3300050513 Bacteria 5410
538 nmdc:mga0rr50_164877_c1 3300050513 Bacteria 1801
539 nmdc:mga0rr50_27253_c1 3300050513 Bacteria 3998
540 nmdc:mga0rr50_469_c1 3300050513 Bacteria 21469
541 nmdc:mga0rr50_9425_c1 3300050513 Bacteria 6136
542 nmdc:mga08x19_170810_c1 3300050514 Bacteria 1481
543 nmdc:mga08x19_26629_c1 3300050514 Bacteria 3609
544 nmdc:mga08x19_842_c1 3300050514 Bacteria 19460
545 nmdc:mga0a205_103657_c1 3300050515 Bacteria 2743
546 nmdc:mga0a205_193_c1 3300050515 Bacteria 42226
547 nmdc:mga0a205_198_c1 3300050515 Bacteria 41752
548 nmdc:mga0a205_20187_c2 3300050515 Bacteria 2242
549 nmdc:mga0a205_2405_c1 3300050515 Bacteria 16511
550 nmdc:mga0a205_3331_c2 3300050515 Bacteria 10909
551 nmdc:mga0a205_33794_c1 3300050515 Bacteria 4904
552 nmdc:mga0a205_33852_c1 3300050515 Bacteria 4900
553 nmdc:mga0a205_411_c1 3300050515 Bacteria 32848
554 nmdc:mga0a205_415374_c1 3300050515 Bacteria 1208
555 nmdc:mga0a205_487895_c1 3300050515 Bacteria 1090
556 nmdc:mga0a205_66395_c1 3300050515 Bacteria 3486
557 nmdc:mga0a205_86642_c1 3300050515 Bacteria 3025
558 nmdc:mga0a205_92134_c1 3300050515 Bacteria 2929
559 Ga0501084_0003957 3300054114 Bacteria 12064
560 Ga0501084_0006688 3300054114 Bacteria 9478
561 Ga0501084_0141413 3300054114 Bacteria 2027
562 Ga0501082_0001594 3300060353 Bacteria 20004
563 Ga0501082_0031615 3300060353 Bacteria 4565
564 Ga0501082_0159377 3300060353 Bacteria 1961
565 Ga0501082_0548207 3300060353 Bacteria 1011
566 Ga0530510_0006155 3300061734 Bacteria 8335
567 Ga0530510_0597357 3300061734 Bacteria 839
568 Ga0530510_0600302 3300061734 Bacteria 837
569 Ga0530510_0638503 3300061734 Bacteria 810

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10287600 Ga0105249_102876002 213
2 3300006871 Ga0075434_100136042 Ga0075434_1001360421 214
3 3300007076 Ga0075435_100013417 Ga0075435_1000134174 214
4 3300009147 Ga0114129_11219138 Ga0114129_112191381 214
5 3300050507 nmdc:mga05p37_352555_c1 nmdc:mga05p37_352555_c1_893_1669 214
6 3300005536 Ga0070697_100000352 Ga0070697_10000035214 215
7 3300005468 Ga0070707_100035375 Ga0070707_1000353755 218
8 3300005471 Ga0070698_100178249 Ga0070698_1001782492 218
9 3300006880 Ga0075429_100502349 Ga0075429_1005023491 219
10 3300009147 Ga0114129_10019275 Ga0114129_100192757 219
11 3300050507 nmdc:mga05p37_32895_c1 nmdc:mga05p37_32895_c1_1169_1984 219
12 3300005445 Ga0070708_100010003 Ga0070708_1000100034 221
13 3300005546 Ga0070696_100184857 Ga0070696_1001848572 221
14 3300006846 Ga0075430_100003852 Ga0075430_10000385211 221
15 3300006847 Ga0075431_100005602 Ga0075431_1000056027 221
16 3300006880 Ga0075429_100108151 Ga0075429_1001081512 221
17 3300031548 Ga0307408_100231905 Ga0307408_1002319052 221
18 3300050509 nmdc:mga0qj67_69540_c1 nmdc:mga0qj67_69540_c1_435_1235 221
19 3300050510 nmdc:mga06r32_270747_c1 nmdc:mga06r32_270747_c1_52_828 221
20 3300007265 Ga0099794_10109786 Ga0099794_101097862 222
21 3300049572 Ga0501036_0251842 Ga0501036_0251842_527_1315 224
22 3300049578 Ga0501042_0159885 Ga0501042_0159885_159_947 224
23 3300049580 Ga0501046_0236893 Ga0501046_0236893_111_899 224
24 3300049582 Ga0501048_0110168 Ga0501048_0110168_717_1505 224
25 3300049587 Ga0501071_0082215 Ga0501071_0082215_755_1543 224
26 3300049588 Ga0501072_0054393 Ga0501072_0054393_1364_2152 224
27 3300049591 Ga0501075_0032000 Ga0501075_0032000_59_847 224
28 3300049592 Ga0501076_0201183 Ga0501076_0201183_54_830 224
29 3300049593 Ga0501077_0031103 Ga0501077_0031103_1712_2500 224
30 3300049741 Ga0501079_0023810 Ga0501079_0023810_3006_3794 224
31 3300049743 Ga0501081_0001399 Ga0501081_0001399_12932_13720 224
32 3300050507 nmdc:mga05p37_838348_c1 nmdc:mga05p37_838348_c1_62_838 224
33 3300054114 Ga0501084_0003957 Ga0501084_0003957_5672_6460 224
34 3300060353 Ga0501082_0031615 Ga0501082_0031615_613_1401 224
35 3300038996 Ga0242420_005053 Ga0242420_005053_1338_2015 225
36 3300006846 Ga0075430_100013412 Ga0075430_1000134126 226
37 3300006847 Ga0075431_100002555 Ga0075431_10000255511 226
38 3300006914 Ga0075436_100037820 Ga0075436_1000378202 226
39 3300009147 Ga0114129_10036621 Ga0114129_100366214 226
40 3300027682 Ga0209971_1032359 Ga0209971_10323592 226
41 3300050507 nmdc:mga05p37_49840_c1 nmdc:mga05p37_49840_c1_4089_4865 226
42 3300050508 nmdc:mga09592_3336_c1 nmdc:mga09592_3336_c1_8380_9156 226
43 3300050509 nmdc:mga0qj67_48553_c1 nmdc:mga0qj67_48553_c1_128_904 226
44 3300050510 nmdc:mga06r32_4823_c1 nmdc:mga06r32_4823_c1_9151_9927 226
45 3300050514 nmdc:mga08x19_26629_c1 nmdc:mga08x19_26629_c1_2174_2953 226
46 3300006844 Ga0075428_100110125 Ga0075428_1001101254 229
47 3300050511 nmdc:mga08y16_284684_c1 nmdc:mga08y16_284684_c1_780_1556 229
48 3300025910 Ga0207684_10121595 Ga0207684_101215954 231
49 3300034817 Ga0373948_0006772 Ga0373948_0006772_1172_1870 231
50 3300042876 Ga0451577_0115739 Ga0451577_0115739_1650_2348 231
51 3300049588 Ga0501072_0155942 Ga0501072_0155942_241_1017 231
52 3300049592 Ga0501076_0607984 Ga0501076_0607984_50_829 231
53 3300049743 Ga0501081_0364450 Ga0501081_0364450_74_850 231
54 3300049824 Ga0501045_0125327 Ga0501045_0125327_623_1399 231
55 3300060353 Ga0501082_0159377 Ga0501082_0159377_1246_1944 231
56 3300061734 Ga0530510_0638503 Ga0530510_0638503_77_775 231
57 3300046511 Ga0495608_0071871 Ga0495608_0071871_1176_1955 232
58 3300060353 Ga0501082_0001594 Ga0501082_0001594_5031_5810 232
59 3300061734 Ga0530510_0006155 Ga0530510_0006155_6094_6873 232
60 3300006852 Ga0075433_10271500 Ga0075433_102715001 233
61 3300007076 Ga0075435_100276348 Ga0075435_1002763482 233
62 3300031995 Ga0307409_100185056 Ga0307409_1001850562 234
63 3300046472 Ga0495580_0000719 Ga0495580_0000719_6621_7397 235
64 3300005445 Ga0070708_100030939 Ga0070708_1000309393 236
65 3300005467 Ga0070706_100032255 Ga0070706_1000322553 236
66 3300005468 Ga0070707_100497676 Ga0070707_1004976761 236
67 3300005471 Ga0070698_100084836 Ga0070698_1000848362 236
68 3300005518 Ga0070699_100013971 Ga0070699_1000139712 236
69 3300005546 Ga0070696_100019756 Ga0070696_1000197564 236
70 3300025910 Ga0207684_10097849 Ga0207684_100978493 236
71 3300025922 Ga0207646_10269474 Ga0207646_102694741 236
72 3300049568 Ga0501031_0150816 Ga0501031_0150816_65_847 236
73 3300049572 Ga0501036_0017276 Ga0501036_0017276_222_1001 236
74 3300049576 Ga0501040_0015346 Ga0501040_0015346_3216_3995 236
75 3300049577 Ga0501041_0200304 Ga0501041_0200304_225_1004 236
76 3300049579 Ga0501043_0285299 Ga0501043_0285299_209_988 236
77 3300049587 Ga0501071_0035691 Ga0501071_0035691_760_1539 236
78 3300049588 Ga0501072_0023067 Ga0501072_0023067_1850_2629 236
79 3300049588 Ga0501072_0423031 Ga0501072_0423031_65_841 236
80 3300049590 Ga0501074_0196933 Ga0501074_0196933_48_827 236
81 3300049593 Ga0501077_0016474 Ga0501077_0016474_225_1004 236
82 3300049741 Ga0501079_0006563 Ga0501079_0006563_6959_7738 236
83 3300049742 Ga0501080_0060236 Ga0501080_0060236_202_981 236
84 3300049743 Ga0501081_0205737 Ga0501081_0205737_413_1192 236
85 3300049744 Ga0501083_0291660 Ga0501083_0291660_68_847 236
86 3300049824 Ga0501045_0004907 Ga0501045_0004907_1301_2080 236
87 3300054114 Ga0501084_0006688 Ga0501084_0006688_2904_3683 236
88 3300005334 Ga0068869_100021375 Ga0068869_1000213756 237
89 3300005341 Ga0070691_10014801 Ga0070691_100148012 237
90 3300005345 Ga0070692_10151914 Ga0070692_101519142 237
91 3300005406 Ga0070703_10033763 Ga0070703_100337632 237
92 3300005440 Ga0070705_100013522 Ga0070705_1000135224 237
93 3300005441 Ga0070700_100033620 Ga0070700_1000336203 237
94 3300005445 Ga0070708_100405866 Ga0070708_1004058662 237
95 3300005518 Ga0070699_100016965 Ga0070699_1000169653 237
96 3300005545 Ga0070695_100005280 Ga0070695_1000052808 237
97 3300005549 Ga0070704_100010857 Ga0070704_1000108573 237
98 3300005577 Ga0068857_100065521 Ga0068857_1000655213 237
99 3300005840 Ga0068870_10128167 Ga0068870_101281671 237
100 3300005843 Ga0068860_100526227 Ga0068860_1005262272 237
101 3300005844 Ga0068862_100304193 Ga0068862_1003041932 237
102 3300009148 Ga0105243_10021187 Ga0105243_100211873 237
103 3300009176 Ga0105242_10013532 Ga0105242_100135326 237
104 3300009553 Ga0105249_10327155 Ga0105249_103271552 237
105 3300014326 Ga0157380_11087757 Ga0157380_110877571 237
106 3300025885 Ga0207653_10007017 Ga0207653_100070171 237
107 3300025935 Ga0207709_10008877 Ga0207709_100088773 237
108 3300025942 Ga0207689_10020104 Ga0207689_100201047 237
109 3300025961 Ga0207712_10459295 Ga0207712_104592952 237
110 3300026116 Ga0207674_10038305 Ga0207674_100383052 237
111 3300005471 Ga0070698_100494405 Ga0070698_1004944052 238
112 3300005718 Ga0068866_10251868 Ga0068866_102518682 238
113 3300005844 Ga0068862_100330435 Ga0068862_1003304352 238
114 3300006847 Ga0075431_100063427 Ga0075431_1000634273 238
115 3300006880 Ga0075429_100471773 Ga0075429_1004717732 238
116 3300007076 Ga0075435_100048090 Ga0075435_1000480904 238
117 3300009094 Ga0111539_10000988 Ga0111539_1000098814 238
118 3300009147 Ga0114129_10409453 Ga0114129_104094532 238
119 3300025908 Ga0207643_10173079 Ga0207643_101730792 238
120 3300025911 Ga0207654_10371744 Ga0207654_103717441 238
121 3300025917 Ga0207660_10289789 Ga0207660_102897892 238
122 3300028380 Ga0268265_10609919 Ga0268265_106099192 238
123 3300032126 Ga0307415_100298298 Ga0307415_1002982981 238
124 3300035088 Ga0373940_0017138 Ga0373940_0017138_1012_1788 238
125 3300035691 Ga0373931_0025011 Ga0373931_0025011_543_1319 238
126 3300045051 Ga0451576_0173678 Ga0451576_0173678_308_1084 238
127 3300045051 Ga0451576_0557773 Ga0451576_0557773_121_897 238
128 3300048908 Ga0496105_0402525 Ga0496105_0402525_163_939 238
129 3300050507 nmdc:mga05p37_282394_c1 nmdc:mga05p37_282394_c1_410_1189 238
130 3300050508 nmdc:mga09592_443704_c1 nmdc:mga09592_443704_c1_208_987 238
131 3300050510 nmdc:mga06r32_33390_c1 nmdc:mga06r32_33390_c1_250_1029 238
132 3300050512 nmdc:mga0n895_865643_c1 nmdc:mga0n895_865643_c1_32_811 238
133 3300050513 nmdc:mga0rr50_9425_c1 nmdc:mga0rr50_9425_c1_1822_2601 238
134 3300050515 nmdc:mga0a205_33794_c1 nmdc:mga0a205_33794_c1_3453_4229 238
135 3300006846 Ga0075430_100405406 Ga0075430_1004054062 239
136 3300006847 Ga0075431_100669665 Ga0075431_1006696651 239
137 3300035172 Ga0373955_0091241 Ga0373955_0091241_211_990 239
138 3300035724 Ga0373933_0212673 Ga0373933_0212673_311_1090 239
139 3300046454 Ga0495592_0238744 Ga0495592_0238744_393_1172 239
140 3300046477 Ga0495664_0147786 Ga0495664_0147786_325_1104 239
141 3300046516 Ga0495628_0160573 Ga0495628_0160573_708_1487 239
142 3300046533 Ga0495640_0108072 Ga0495640_0108072_894_1673 239
143 3300046536 Ga0495587_0151328 Ga0495587_0151328_95_874 239
144 3300046559 Ga0495667_0006813 Ga0495667_0006813_311_1090 239
145 3300046663 Ga0495635_0476475 Ga0495635_0476475_25_804 239
146 3300046675 Ga0495657_0087703 Ga0495657_0087703_1132_1911 239
147 3300046678 Ga0495599_0093123 Ga0495599_0093123_798_1577 239
148 3300047319 Ga0495674_0126303 Ga0495674_0126303_1102_1881 239
149 3300047322 Ga0495680_0130519 Ga0495680_0130519_755_1534 239
150 3300047444 Ga0495675_0157974 Ga0495675_0157974_286_1065 239
151 3300047471 Ga0495684_0160671 Ga0495684_0160671_870_1649 239
152 3300048088 Ga0495602_0033380 Ga0495602_0033380_3863_4642 239
153 3300050508 nmdc:mga09592_230753_c1 nmdc:mga09592_230753_c1_547_1323 239
154 3300050510 nmdc:mga06r32_356225_c1 nmdc:mga06r32_356225_c1_126_902 239
155 3300061734 Ga0530510_0600302 Ga0530510_0600302_25_801 239
156 3300028381 Ga0268264_10156617 Ga0268264_101566173 240
157 3300031548 Ga0307408_100032622 Ga0307408_1000326224 240
158 3300031901 Ga0307406_10242178 Ga0307406_102421782 240
159 3300049741 Ga0501079_0326395 Ga0501079_0326395_122_901 240
160 3300013306 Ga0163162_11108454 Ga0163162_111084542 241
161 3300014326 Ga0157380_10703356 Ga0157380_107033561 241
162 3300045051 Ga0451576_0276457 Ga0451576_0276457_262_1038 241
163 3300046491 Ga0495584_0135346 Ga0495584_0135346_79_855 241
164 3300046684 Ga0495669_0084786 Ga0495669_0084786_358_1134 241
165 3300005445 Ga0070708_100016993 Ga0070708_1000169936 242
166 3300005467 Ga0070706_100037818 Ga0070706_1000378184 242
167 3300005843 Ga0068860_100239173 Ga0068860_1002391732 242
168 3300006844 Ga0075428_100394630 Ga0075428_1003946302 242
169 3300025910 Ga0207684_10054361 Ga0207684_100543613 242
170 3300025910 Ga0207684_10074444 Ga0207684_100744443 242
171 3300025922 Ga0207646_10256011 Ga0207646_102560112 242
172 3300028381 Ga0268264_10130013 Ga0268264_101300133 242
173 3300050512 nmdc:mga0n895_115880_c1 nmdc:mga0n895_115880_c1_1076_1852 243
174 3300005468 Ga0070707_100359352 Ga0070707_1003593521 244
175 3300049743 Ga0501081_0035410 Ga0501081_0035410_318_1109 245
176 3300046684 Ga0495669_0028433 Ga0495669_0028433_934_1713 246
177 3300005434 Ga0070709_10194395 Ga0070709_101943952 248
178 3300005539 Ga0068853_100010427 Ga0068853_1000104275 250
179 3300026041 Ga0207639_10011217 Ga0207639_100112175 250
180 3300042438 Ga0439459_0001197 Ga0439459_0001197_280_1056 250
181 3300046615 Ga0495656_0210400 Ga0495656_0210400_32_808 250
182 3300005341 Ga0070691_10160146 Ga0070691_101601461 251
183 3300005536 Ga0070697_100036933 Ga0070697_1000369333 251
184 3300031731 Ga0307405_10413840 Ga0307405_104138402 252
185 3300032005 Ga0307411_10137337 Ga0307411_101373372 252
186 3300049582 Ga0501048_0471037 Ga0501048_0471037_11_793 255
187 3300026088 Ga0207641_10144558 Ga0207641_101445581 257
188 3300050515 nmdc:mga0a205_103657_c1 nmdc:mga0a205_103657_c1_1495_2271 257
189 3300003911 JGI25405J52794_10002664 JGI25405J52794_100026641 258
190 3300005295 Ga0065707_10002362 Ga0065707_100023623 258
191 3300005295 Ga0065707_10154868 Ga0065707_101548681 258
192 3300005330 Ga0070690_100386359 Ga0070690_1003863591 258
193 3300005331 Ga0070670_100010274 Ga0070670_1000102742 258
194 3300005334 Ga0068869_100006037 Ga0068869_1000060375 258
195 3300005334 Ga0068869_100212349 Ga0068869_1002123491 258
196 3300005336 Ga0070680_100000760 Ga0070680_10000076015 258
197 3300005336 Ga0070680_100052537 Ga0070680_1000525372 258
198 3300005337 Ga0070682_100000576 Ga0070682_10000057615 258
199 3300005338 Ga0068868_100067540 Ga0068868_1000675401 258
200 3300005339 Ga0070660_100015018 Ga0070660_1000150185 258
201 3300005344 Ga0070661_100010023 Ga0070661_1000100232 258
202 3300005345 Ga0070692_10066530 Ga0070692_100665302 258
203 3300005347 Ga0070668_100370341 Ga0070668_1003703412 258
204 3300005353 Ga0070669_100045049 Ga0070669_1000450494 258
205 3300005353 Ga0070669_100075120 Ga0070669_1000751202 258
206 3300005353 Ga0070669_100184261 Ga0070669_1001842612 258
207 3300005366 Ga0070659_100001314 Ga0070659_10000131413 258
208 3300005406 Ga0070703_10019267 Ga0070703_100192671 258
209 3300005436 Ga0070713_100093895 Ga0070713_1000938953 258
210 3300005437 Ga0070710_10096970 Ga0070710_100969702 258
211 3300005440 Ga0070705_100370725 Ga0070705_1003707251 258
212 3300005440 Ga0070705_100433594 Ga0070705_1004335941 258
213 3300005441 Ga0070700_100149350 Ga0070700_1001493501 258
214 3300005441 Ga0070700_100157761 Ga0070700_1001577612 258
215 3300005444 Ga0070694_100069442 Ga0070694_1000694422 258
216 3300005444 Ga0070694_100136842 Ga0070694_1001368423 258
217 3300005444 Ga0070694_100385712 Ga0070694_1003857121 258
218 3300005455 Ga0070663_100022880 Ga0070663_1000228802 258
219 3300005457 Ga0070662_100340349 Ga0070662_1003403492 258
220 3300005458 Ga0070681_10330952 Ga0070681_103309521 258
221 3300005458 Ga0070681_10354790 Ga0070681_103547902 258
222 3300005459 Ga0068867_100023240 Ga0068867_1000232402 258
223 3300005459 Ga0068867_100126813 Ga0068867_1001268132 258
224 3300005467 Ga0070706_100015079 Ga0070706_1000150796 258
225 3300005467 Ga0070706_100105679 Ga0070706_1001056793 258
226 3300005467 Ga0070706_100119502 Ga0070706_1001195023 258
227 3300005467 Ga0070706_100351685 Ga0070706_1003516852 258
228 3300005468 Ga0070707_100004351 Ga0070707_10000435110 258
229 3300005468 Ga0070707_100066676 Ga0070707_1000666762 258
230 3300005468 Ga0070707_100098328 Ga0070707_1000983282 258
231 3300005471 Ga0070698_100021719 Ga0070698_1000217198 258
232 3300005471 Ga0070698_100041112 Ga0070698_1000411122 258
233 3300005471 Ga0070698_100278315 Ga0070698_1002783152 258
234 3300005518 Ga0070699_100001996 Ga0070699_1000019963 258
235 3300005518 Ga0070699_100013157 Ga0070699_10001315713 258
236 3300005518 Ga0070699_100080611 Ga0070699_1000806114 258
237 3300005518 Ga0070699_100461149 Ga0070699_1004611492 258
238 3300005518 Ga0070699_100644703 Ga0070699_1006447031 258
239 3300005536 Ga0070697_100060327 Ga0070697_1000603273 258
240 3300005536 Ga0070697_100100908 Ga0070697_1001009083 258
241 3300005536 Ga0070697_100104836 Ga0070697_1001048363 258
242 3300005536 Ga0070697_100301253 Ga0070697_1003012531 258
243 3300005545 Ga0070695_100052947 Ga0070695_1000529473 258
244 3300005545 Ga0070695_100142521 Ga0070695_1001425211 258
245 3300005546 Ga0070696_100000633 Ga0070696_10000063315 258
246 3300005546 Ga0070696_100055165 Ga0070696_1000551653 258
247 3300005547 Ga0070693_100001427 Ga0070693_1000014275 258
248 3300005549 Ga0070704_100787945 Ga0070704_1007879451 258
249 3300005563 Ga0068855_100002556 Ga0068855_10000255615 258
250 3300005564 Ga0070664_100038039 Ga0070664_1000380391 258
251 3300005577 Ga0068857_100015869 Ga0068857_1000158696 258
252 3300005577 Ga0068857_100079276 Ga0068857_1000792761 258
253 3300005578 Ga0068854_100005247 Ga0068854_1000052475 258
254 3300005614 Ga0068856_100006151 Ga0068856_1000061516 258
255 3300005617 Ga0068859_100191402 Ga0068859_1001914022 258
256 3300005618 Ga0068864_100083860 Ga0068864_1000838602 258
257 3300005618 Ga0068864_100145596 Ga0068864_1001455963 258
258 3300005719 Ga0068861_100018437 Ga0068861_1000184374 258
259 3300005719 Ga0068861_100629091 Ga0068861_1006290911 258
260 3300005840 Ga0068870_10002863 Ga0068870_100028634 258
261 3300005841 Ga0068863_100048853 Ga0068863_1000488533 258
262 3300005842 Ga0068858_100098485 Ga0068858_1000984851 258
263 3300005842 Ga0068858_100098762 Ga0068858_1000987622 258
264 3300005842 Ga0068858_100165090 Ga0068858_1001650902 258
265 3300005843 Ga0068860_100153741 Ga0068860_1001537412 258
266 3300005844 Ga0068862_100075931 Ga0068862_1000759312 258
267 3300005844 Ga0068862_100193739 Ga0068862_1001937392 258
268 3300005844 Ga0068862_100271736 Ga0068862_1002717362 258
269 3300005937 Ga0081455_10000411 Ga0081455_1000041154 258
270 3300005937 Ga0081455_10059776 Ga0081455_100597762 258
271 3300005981 Ga0081538_10006480 Ga0081538_100064803 258
272 3300005981 Ga0081538_10048880 Ga0081538_100488802 258
273 3300005981 Ga0081538_10092478 Ga0081538_100924782 258
274 3300005981 Ga0081538_10094691 Ga0081538_100946911 258
275 3300005983 Ga0081540_1018028 Ga0081540_10180285 258
276 3300005985 Ga0081539_10000083 Ga0081539_10000083100 258
277 3300006028 Ga0070717_10346012 Ga0070717_103460121 258
278 3300006175 Ga0070712_100013947 Ga0070712_1000139473 258
279 3300006844 Ga0075428_100000136 Ga0075428_10000013669 258
280 3300006844 Ga0075428_100000176 Ga0075428_10000017658 258
281 3300006844 Ga0075428_100006989 Ga0075428_1000069898 258
282 3300006844 Ga0075428_100011008 Ga0075428_1000110086 258
283 3300006844 Ga0075428_100033421 Ga0075428_1000334213 258
284 3300006844 Ga0075428_100052536 Ga0075428_1000525362 258
285 3300006844 Ga0075428_100404442 Ga0075428_1004044422 258
286 3300006846 Ga0075430_100000813 Ga0075430_1000008132 258
287 3300006846 Ga0075430_100008443 Ga0075430_1000084439 258
288 3300006846 Ga0075430_100218626 Ga0075430_1002186262 258
289 3300006847 Ga0075431_100000061 Ga0075431_10000006120 258
290 3300006847 Ga0075431_100002933 Ga0075431_1000029335 258
291 3300006847 Ga0075431_100003953 Ga0075431_1000039537 258
292 3300006847 Ga0075431_100005544 Ga0075431_1000055449 258
293 3300006847 Ga0075431_100565111 Ga0075431_1005651112 258
294 3300006852 Ga0075433_10003076 Ga0075433_100030765 258
295 3300006852 Ga0075433_10010743 Ga0075433_100107432 258
296 3300006852 Ga0075433_10010749 Ga0075433_100107497 258
297 3300006852 Ga0075433_10016394 Ga0075433_100163947 258
298 3300006852 Ga0075433_10027291 Ga0075433_100272912 258
299 3300006852 Ga0075433_10041664 Ga0075433_100416641 258
300 3300006852 Ga0075433_10067125 Ga0075433_100671253 258
301 3300006852 Ga0075433_10099954 Ga0075433_100999542 258
302 3300006852 Ga0075433_10102366 Ga0075433_101023662 258
303 3300006852 Ga0075433_10178939 Ga0075433_101789393 258
304 3300006852 Ga0075433_10649871 Ga0075433_106498711 258
305 3300006871 Ga0075434_100000404 Ga0075434_10000040430 258
306 3300006871 Ga0075434_100013058 Ga0075434_1000130585 258
307 3300006871 Ga0075434_100109151 Ga0075434_1001091512 258
308 3300006871 Ga0075434_100117773 Ga0075434_1001177732 258
309 3300006871 Ga0075434_100202773 Ga0075434_1002027732 258
310 3300006880 Ga0075429_100000739 Ga0075429_10000073925 258
311 3300006880 Ga0075429_100028874 Ga0075429_1000288742 258
312 3300006880 Ga0075429_100030126 Ga0075429_1000301263 258
313 3300006880 Ga0075429_100136700 Ga0075429_1001367003 258
314 3300006880 Ga0075429_100209009 Ga0075429_1002090092 258
315 3300006880 Ga0075429_100480469 Ga0075429_1004804692 258
316 3300006881 Ga0068865_100430459 Ga0068865_1004304592 258
317 3300006914 Ga0075436_100002609 Ga0075436_10000260912 258
318 3300006914 Ga0075436_100017258 Ga0075436_1000172585 258
319 3300006914 Ga0075436_100476898 Ga0075436_1004768981 258
320 3300006931 Ga0097620_100191413 Ga0097620_1001914131 258
321 3300007076 Ga0075435_100006024 Ga0075435_1000060245 258
322 3300007076 Ga0075435_100009151 Ga0075435_1000091513 258
323 3300007076 Ga0075435_100027634 Ga0075435_1000276343 258
324 3300007076 Ga0075435_100066977 Ga0075435_1000669772 258
325 3300007076 Ga0075435_100108626 Ga0075435_1001086262 258
326 3300007265 Ga0099794_10002483 Ga0099794_100024835 258
327 3300007788 Ga0099795_10124545 Ga0099795_101245451 258
328 3300009094 Ga0111539_10000715 Ga0111539_1000071532 258
329 3300009094 Ga0111539_10011434 Ga0111539_100114345 258
330 3300009094 Ga0111539_10014429 Ga0111539_100144298 258
331 3300009094 Ga0111539_10150951 Ga0111539_101509512 258
332 3300009098 Ga0105245_10677664 Ga0105245_106776641 258
333 3300009101 Ga0105247_10320765 Ga0105247_103207652 258
334 3300009147 Ga0114129_10000847 Ga0114129_100008475 258
335 3300009147 Ga0114129_10003560 Ga0114129_100035607 258
336 3300009147 Ga0114129_10006715 Ga0114129_100067152 258
337 3300009147 Ga0114129_10009764 Ga0114129_1000976414 258
338 3300009147 Ga0114129_10011521 Ga0114129_1001152112 258
339 3300009147 Ga0114129_10038128 Ga0114129_100381288 258
340 3300009147 Ga0114129_10040737 Ga0114129_100407374 258
341 3300009147 Ga0114129_10042610 Ga0114129_100426105 258
342 3300009147 Ga0114129_10092345 Ga0114129_100923452 258
343 3300009147 Ga0114129_10142971 Ga0114129_101429712 258
344 3300009147 Ga0114129_10203024 Ga0114129_102030242 258
345 3300009147 Ga0114129_10268708 Ga0114129_102687082 258
346 3300009147 Ga0114129_10474286 Ga0114129_104742862 258
347 3300009147 Ga0114129_10588943 Ga0114129_105889431 258
348 3300009147 Ga0114129_11159610 Ga0114129_111596102 258
349 3300009148 Ga0105243_10089083 Ga0105243_100890832 258
350 3300009148 Ga0105243_10193877 Ga0105243_101938772 258
351 3300009148 Ga0105243_10383788 Ga0105243_103837882 258
352 3300009174 Ga0105241_10003228 Ga0105241_100032282 258
353 3300009174 Ga0105241_10436654 Ga0105241_104366541 258
354 3300009553 Ga0105249_10101021 Ga0105249_101010213 258
355 3300009553 Ga0105249_10180012 Ga0105249_101800123 258
356 3300010159 Ga0099796_10078649 Ga0099796_100786491 258
357 3300010375 Ga0105239_10121292 Ga0105239_101212922 258
358 3300011119 Ga0105246_10182810 Ga0105246_101828102 258
359 3300013100 Ga0157373_10003300 Ga0157373_100033007 258
360 3300013306 Ga0163162_10036621 Ga0163162_100366213 258
361 3300013306 Ga0163162_10190710 Ga0163162_101907102 258
362 3300013306 Ga0163162_10421869 Ga0163162_104218692 258
363 3300013306 Ga0163162_10853799 Ga0163162_108537992 258
364 3300013307 Ga0157372_10009405 Ga0157372_100094057 258
365 3300013308 Ga0157375_10789909 Ga0157375_107899092 258
366 3300014968 Ga0157379_10053779 Ga0157379_100537792 258
367 3300014968 Ga0157379_10208994 Ga0157379_102089941 258
368 3300015262 Ga0182007_10013413 Ga0182007_100134131 258
369 3300025907 Ga0207645_10018926 Ga0207645_100189263 258
370 3300025907 Ga0207645_10196909 Ga0207645_101969092 258
371 3300025908 Ga0207643_10003668 Ga0207643_100036683 258
372 3300025910 Ga0207684_10000566 Ga0207684_1000056614 258
373 3300025910 Ga0207684_10009022 Ga0207684_100090227 258
374 3300025910 Ga0207684_10013553 Ga0207684_100135537 258
375 3300025910 Ga0207684_10142825 Ga0207684_101428252 258
376 3300025911 Ga0207654_10124269 Ga0207654_101242691 258
377 3300025912 Ga0207707_10000056 Ga0207707_100000567 258
378 3300025912 Ga0207707_10254187 Ga0207707_102541872 258
379 3300025915 Ga0207693_10003246 Ga0207693_100032469 258
380 3300025915 Ga0207693_10035398 Ga0207693_100353984 258
381 3300025919 Ga0207657_10000306 Ga0207657_100003066 258
382 3300025920 Ga0207649_10006470 Ga0207649_100064705 258
383 3300025921 Ga0207652_10002550 Ga0207652_1000255010 258
384 3300025921 Ga0207652_10561556 Ga0207652_105615561 258
385 3300025922 Ga0207646_10000948 Ga0207646_1000094821 258
386 3300025922 Ga0207646_10007532 Ga0207646_100075321 258
387 3300025922 Ga0207646_10012657 Ga0207646_100126572 258
388 3300025922 Ga0207646_10062196 Ga0207646_100621962 258
389 3300025922 Ga0207646_10110506 Ga0207646_101105062 258
390 3300025922 Ga0207646_10370563 Ga0207646_103705632 258
391 3300025923 Ga0207681_10014687 Ga0207681_100146874 258
392 3300025923 Ga0207681_10035929 Ga0207681_100359292 258
393 3300025923 Ga0207681_10369393 Ga0207681_103693932 258
394 3300025927 Ga0207687_10419317 Ga0207687_104193172 258
395 3300025929 Ga0207664_10223286 Ga0207664_102232862 258
396 3300025932 Ga0207690_10011140 Ga0207690_100111404 258
397 3300025933 Ga0207706_10235849 Ga0207706_102358492 258
398 3300025935 Ga0207709_10328912 Ga0207709_103289122 258
399 3300025938 Ga0207704_10307805 Ga0207704_103078051 258
400 3300025940 Ga0207691_10015290 Ga0207691_100152905 258
401 3300025940 Ga0207691_10033639 Ga0207691_100336395 258
402 3300025942 Ga0207689_10017813 Ga0207689_100178136 258
403 3300025942 Ga0207689_10024260 Ga0207689_100242601 258
404 3300025944 Ga0207661_10786064 Ga0207661_107860641 258
405 3300025945 Ga0207679_10023975 Ga0207679_100239752 258
406 3300025949 Ga0207667_10004946 Ga0207667_1000494610 258
407 3300025960 Ga0207651_10212295 Ga0207651_102122952 258
408 3300025961 Ga0207712_10105510 Ga0207712_101055101 258
409 3300025961 Ga0207712_10157312 Ga0207712_101573121 258
410 3300025972 Ga0207668_10336284 Ga0207668_103362842 258
411 3300026023 Ga0207677_10164913 Ga0207677_101649132 258
412 3300026035 Ga0207703_10067126 Ga0207703_100671263 258
413 3300026035 Ga0207703_10075319 Ga0207703_100753192 258
414 3300026067 Ga0207678_10037207 Ga0207678_100372074 258
415 3300026075 Ga0207708_10096551 Ga0207708_100965512 258
416 3300026075 Ga0207708_10098046 Ga0207708_100980462 258
417 3300026075 Ga0207708_10111939 Ga0207708_101119392 258
418 3300026075 Ga0207708_10334691 Ga0207708_103346912 258
419 3300026078 Ga0207702_10005604 Ga0207702_100056045 258
420 3300026088 Ga0207641_10030042 Ga0207641_100300424 258
421 3300026089 Ga0207648_10003466 Ga0207648_100034665 258
422 3300026089 Ga0207648_10279191 Ga0207648_102791912 258
423 3300026116 Ga0207674_10092257 Ga0207674_100922571 258
424 3300026116 Ga0207674_10104086 Ga0207674_101040861 258
425 3300026118 Ga0207675_100009557 Ga0207675_1000095576 258
426 3300026118 Ga0207675_100032298 Ga0207675_1000322985 258
427 3300027682 Ga0209971_1024648 Ga0209971_10246482 258
428 3300027907 Ga0207428_10000631 Ga0207428_1000063112 258
429 3300027907 Ga0207428_10029258 Ga0207428_100292583 258
430 3300027907 Ga0207428_10203504 Ga0207428_102035042 258
431 3300027907 Ga0207428_10203922 Ga0207428_102039222 258
432 3300028380 Ga0268265_10174361 Ga0268265_101743612 258
433 3300028380 Ga0268265_10178033 Ga0268265_101780331 258
434 3300028380 Ga0268265_10218322 Ga0268265_102183222 258
435 3300028381 Ga0268264_10099197 Ga0268264_100991973 258
436 3300031548 Ga0307408_100136295 Ga0307408_1001362952 258
437 3300031548 Ga0307408_100177142 Ga0307408_1001771422 258
438 3300031852 Ga0307410_10067961 Ga0307410_100679612 258
439 3300031903 Ga0307407_10522664 Ga0307407_105226641 258
440 3300031995 Ga0307409_100092962 Ga0307409_1000929623 258
441 3300032002 Ga0307416_100030872 Ga0307416_1000308722 258
442 3300034819 Ga0373958_0008796 Ga0373958_0008796_189_965 258
443 3300035084 Ga0373928_0064619 Ga0373928_0064619_87_866 258
444 3300035085 Ga0373929_0056057 Ga0373929_0056057_31_807 258
445 3300035088 Ga0373940_0053525 Ga0373940_0053525_324_1100 258
446 3300035112 Ga0373932_0058930 Ga0373932_0058930_294_1070 258
447 3300035114 Ga0373939_0012710 Ga0373939_0012710_949_1725 258
448 3300035114 Ga0373939_0034440 Ga0373939_0034440_217_993 258
449 3300035115 Ga0373941_0124474 Ga0373941_0124474_37_813 258
450 3300035242 Ga0373962_0003976 Ga0373962_0003976_671_1447 258
451 3300035691 Ga0373931_0002462 Ga0373931_0002462_3398_4177 258
452 3300035691 Ga0373931_0014161 Ga0373931_0014161_1410_2186 258
453 3300037312 Ga0395899_0109495 Ga0395899_0109495_78_857 258
454 3300037418 Ga0395900_0069327 Ga0395900_0069327_1826_2605 258
455 3300037466 Ga0395898_0006319 Ga0395898_0006319_3150_3929 258
456 3300038443 Ga0395901_0018617 Ga0395901_0018617_5843_6622 258
457 3300039438 Ga0436360_1132788 Ga0436360_1132788_529_1308 258
458 3300039447 Ga0436361_0287624 Ga0436361_0287624_488_1267 258
459 3300039447 Ga0436361_0473175 Ga0436361_0473175_514_1293 258
460 3300039453 Ga0436362_0719549 Ga0436362_0719549_393_1172 258
461 3300039453 Ga0436362_1277602 Ga0436362_1277602_644_1423 258
462 3300042005 Ga0439448_0002910 Ga0439448_0002910_824_1600 258
463 3300042156 Ga0439446_0043444 Ga0439446_0043444_529_1305 258
464 3300042461 Ga0439460_0055316 Ga0439460_0055316_114_893 258
465 3300042876 Ga0451577_0003386 Ga0451577_0003386_5762_6544 258
466 3300042876 Ga0451577_0381527 Ga0451577_0381527_22_801 258
467 3300042876 Ga0451577_0780446 Ga0451577_0780446_58_834 258
468 3300044712 Ga0453684_0039914 Ga0453684_0039914_3184_3966 258
469 3300045051 Ga0451576_0008215 Ga0451576_0008215_6660_7442 258
470 3300045051 Ga0451576_0014614 Ga0451576_0014614_3049_3825 258
471 3300045051 Ga0451576_0261071 Ga0451576_0261071_650_1426 258
472 3300046528 Ga0495642_0071644 Ga0495642_0071644_445_1224 258
473 3300046664 Ga0495659_0044197 Ga0495659_0044197_564_1343 258
474 3300048905 Ga0496102_0170442 Ga0496102_0170442_1174_1953 258
475 3300048906 Ga0496103_0025766 Ga0496103_0025766_1893_2672 258
476 3300048909 Ga0496106_0221179 Ga0496106_0221179_25_804 258
477 3300048909 Ga0496106_0226817 Ga0496106_0226817_615_1394 258
478 3300048915 Ga0496112_0127246 Ga0496112_0127246_1318_2094 258
479 3300049572 Ga0501036_0187049 Ga0501036_0187049_899_1675 258
480 3300049574 Ga0501038_0326733 Ga0501038_0326733_136_912 258
481 3300049576 Ga0501040_0001722 Ga0501040_0001722_11591_12367 258
482 3300049576 Ga0501040_0074384 Ga0501040_0074384_827_1603 258
483 3300049577 Ga0501041_0144029 Ga0501041_0144029_364_1143 258
484 3300049578 Ga0501042_0167283 Ga0501042_0167283_89_865 258
485 3300049579 Ga0501043_0360030 Ga0501043_0360030_221_997 258
486 3300049585 Ga0501069_0006893 Ga0501069_0006893_5032_5808 258
487 3300049588 Ga0501072_0046125 Ga0501072_0046125_935_1714 258
488 3300049588 Ga0501072_0202838 Ga0501072_0202838_65_844 258
489 3300049588 Ga0501072_0369273 Ga0501072_0369273_193_969 258
490 3300049588 Ga0501072_0383404 Ga0501072_0383404_219_995 258
491 3300049589 Ga0501073_0332027 Ga0501073_0332027_143_919 258
492 3300049590 Ga0501074_0205915 Ga0501074_0205915_279_1055 258
493 3300049590 Ga0501074_0319903 Ga0501074_0319903_104_883 258
494 3300049591 Ga0501075_0050613 Ga0501075_0050613_1545_2324 258
495 3300049592 Ga0501076_0056360 Ga0501076_0056360_1226_2005 258
496 3300049593 Ga0501077_0248959 Ga0501077_0248959_270_1046 258
497 3300049741 Ga0501079_0320853 Ga0501079_0320853_394_1173 258
498 3300049742 Ga0501080_0266499 Ga0501080_0266499_149_925 258
499 3300049743 Ga0501081_0187589 Ga0501081_0187589_650_1429 258
500 3300049743 Ga0501081_0260273 Ga0501081_0260273_220_996 258
501 3300049824 Ga0501045_0263284 Ga0501045_0263284_276_1052 258
502 3300050507 nmdc:mga05p37_1115_c1 nmdc:mga05p37_1115_c1_25808_26605 258
503 3300050507 nmdc:mga05p37_144398_c1 nmdc:mga05p37_144398_c1_1641_2417 258
504 3300050507 nmdc:mga05p37_181644_c2 nmdc:mga05p37_181644_c2_412_1188 258
505 3300050507 nmdc:mga05p37_205798_c1 nmdc:mga05p37_205798_c1_1162_1941 258
506 3300050507 nmdc:mga05p37_26113_c1 nmdc:mga05p37_26113_c1_3746_4522 258
507 3300050507 nmdc:mga05p37_2666_c1 nmdc:mga05p37_2666_c1_6870_7667 258
508 3300050507 nmdc:mga05p37_421958_c1 nmdc:mga05p37_421958_c1_285_1061 258
509 3300050507 nmdc:mga05p37_44761_c1 nmdc:mga05p37_44761_c1_1208_1984 258
510 3300050507 nmdc:mga05p37_62605_c1 nmdc:mga05p37_62605_c1_1837_2613 258
511 3300050507 nmdc:mga05p37_66563_c1 nmdc:mga05p37_66563_c1_708_1484 258
512 3300050507 nmdc:mga05p37_7018_c1 nmdc:mga05p37_7018_c1_7712_8509 258
513 3300050507 nmdc:mga05p37_82108_c1 nmdc:mga05p37_82108_c1_1826_2608 258
514 3300050507 nmdc:mga05p37_8685_c1 nmdc:mga05p37_8685_c1_23_802 258
515 3300050507 nmdc:mga05p37_95941_c1 nmdc:mga05p37_95941_c1_2786_3565 258
516 3300050508 nmdc:mga09592_16452_c1 nmdc:mga09592_16452_c1_1585_2382 258
517 3300050508 nmdc:mga09592_197142_c1 nmdc:mga09592_197142_c1_216_998 258
518 3300050508 nmdc:mga09592_22344_c1 nmdc:mga09592_22344_c1_3537_4334 258
519 3300050508 nmdc:mga09592_25659_c1 nmdc:mga09592_25659_c1_3112_3888 258
520 3300050508 nmdc:mga09592_274842_c1 nmdc:mga09592_274842_c1_358_1140 258
521 3300050508 nmdc:mga09592_291318_c1 nmdc:mga09592_291318_c1_93_875 258
522 3300050508 nmdc:mga09592_30550_c1 nmdc:mga09592_30550_c1_71_850 258
523 3300050508 nmdc:mga09592_476514_c1 nmdc:mga09592_476514_c1_60_836 258
524 3300050508 nmdc:mga09592_49101_c1 nmdc:mga09592_49101_c1_1208_2005 258
525 3300050508 nmdc:mga09592_77272_c1 nmdc:mga09592_77272_c1_204_980 258
526 3300050508 nmdc:mga09592_8095_c1 nmdc:mga09592_8095_c1_5836_6612 258
527 3300050509 nmdc:mga0qj67_358651_c1 nmdc:mga0qj67_358651_c1_78_875 258
528 3300050509 nmdc:mga0qj67_4472_c1 nmdc:mga0qj67_4472_c1_5721_6503 258
529 3300050509 nmdc:mga0qj67_609_c1 nmdc:mga0qj67_609_c1_13357_14136 258
530 3300050509 nmdc:mga0qj67_71335_c2 nmdc:mga0qj67_71335_c2_379_1176 258
531 3300050510 nmdc:mga06r32_11477_c1 nmdc:mga06r32_11477_c1_6868_7644 258
532 3300050510 nmdc:mga06r32_176462_c1 nmdc:mga06r32_176462_c1_1226_2023 258
533 3300050510 nmdc:mga06r32_20839_c1 nmdc:mga06r32_20839_c1_1790_2572 258
534 3300050510 nmdc:mga06r32_3086_c1 nmdc:mga06r32_3086_c1_895_1692 258
535 3300050510 nmdc:mga06r32_319_c1 nmdc:mga06r32_319_c1_19973_20749 258
536 3300050510 nmdc:mga06r32_472021_c1 nmdc:mga06r32_472021_c1_98_874 258
537 3300050510 nmdc:mga06r32_49068_c1 nmdc:mga06r32_49068_c1_212_1009 258
538 3300050510 nmdc:mga06r32_80429_c1 nmdc:mga06r32_80429_c1_1917_2693 258
539 3300050510 nmdc:mga06r32_86432_c1 nmdc:mga06r32_86432_c1_1932_2708 258
540 3300050511 nmdc:mga08y16_17679_c1 nmdc:mga08y16_17679_c1_2572_3354 258
541 3300050511 nmdc:mga08y16_246357_c1 nmdc:mga08y16_246357_c1_545_1327 258
542 3300050511 nmdc:mga08y16_404511_c1 nmdc:mga08y16_404511_c1_498_1274 258
543 3300050511 nmdc:mga08y16_5741_c1 nmdc:mga08y16_5741_c1_10649_11431 258
544 3300050512 nmdc:mga0n895_128409_c1 nmdc:mga0n895_128409_c1_272_1048 258
545 3300050512 nmdc:mga0n895_3154_c1 nmdc:mga0n895_3154_c1_318_1115 258
546 3300050512 nmdc:mga0n895_42081_c1 nmdc:mga0n895_42081_c1_516_1295 258
547 3300050512 nmdc:mga0n895_9717_c1 nmdc:mga0n895_9717_c1_5387_6169 258
548 3300050512 nmdc:mga0n895_992_c1 nmdc:mga0n895_992_c1_18486_19262 258
549 3300050513 nmdc:mga0rr50_12950_c1 nmdc:mga0rr50_12950_c1_3551_4327 258
550 3300050513 nmdc:mga0rr50_164877_c1 nmdc:mga0rr50_164877_c1_796_1578 258
551 3300050513 nmdc:mga0rr50_27253_c1 nmdc:mga0rr50_27253_c1_1002_1778 258
552 3300050513 nmdc:mga0rr50_469_c1 nmdc:mga0rr50_469_c1_9370_10167 258
553 3300050514 nmdc:mga08x19_170810_c1 nmdc:mga08x19_170810_c1_273_1052 258
554 3300050514 nmdc:mga08x19_842_c1 nmdc:mga08x19_842_c1_7347_8144 258
555 3300050515 nmdc:mga0a205_193_c1 nmdc:mga0a205_193_c1_13399_14196 258
556 3300050515 nmdc:mga0a205_198_c1 nmdc:mga0a205_198_c1_39733_40509 258
557 3300050515 nmdc:mga0a205_20187_c2 nmdc:mga0a205_20187_c2_234_1010 258
558 3300050515 nmdc:mga0a205_2405_c1 nmdc:mga0a205_2405_c1_6397_7179 258
559 3300050515 nmdc:mga0a205_3331_c2 nmdc:mga0a205_3331_c2_4498_5280 258
560 3300050515 nmdc:mga0a205_33852_c1 nmdc:mga0a205_33852_c1_204_980 258
561 3300050515 nmdc:mga0a205_411_c1 nmdc:mga0a205_411_c1_19254_20030 258
562 3300050515 nmdc:mga0a205_415374_c1 nmdc:mga0a205_415374_c1_231_1007 258
563 3300050515 nmdc:mga0a205_487895_c1 nmdc:mga0a205_487895_c1_35_814 258
564 3300050515 nmdc:mga0a205_66395_c1 nmdc:mga0a205_66395_c1_2281_3057 258
565 3300050515 nmdc:mga0a205_86642_c1 nmdc:mga0a205_86642_c1_474_1253 258
566 3300050515 nmdc:mga0a205_92134_c1 nmdc:mga0a205_92134_c1_1543_2319 258
567 3300054114 Ga0501084_0141413 Ga0501084_0141413_1184_1963 258
568 3300060353 Ga0501082_0548207 Ga0501082_0548207_124_900 258
569 3300061734 Ga0530510_0597357 Ga0530510_0597357_18_794 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

14

208

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

20

264

0.93

PF08659

KR

KR domain

14

190

0.85

PF23441

15

266

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ijk-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9561 6 256
7djs-assembly1.cif.gz_B crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.955 6 255
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.952 1 257
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.951 1 255
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9506 1 257
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.951 1 255 3.40.50.720
2rhcB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 6 255 3.40.50.720
2hq1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 1 254 3.40.50.720
3ak4D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9477 2 258 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9456 1 255 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7T6Z693-F1-model_v4 SDR family oxidoreductase 0.961 1 258 GO:0016616
AF-A0A382CEQ8-F1-model_v4 Uncharacterized protein 0.9594 8 255 GO:0016491
AF-A0A355A4F3-F1-model_v4 3-ketoacyl-ACP reductase 0.9583 2 255 GO:0006633
GO:0016616
GO:0048038
AF-A0A7T6Z693-F1-model_v4 SDR family oxidoreductase 0.9574 1 258 GO:0016616
AF-A0A3N5NQ50-F1-model_v4 SDR family oxidoreductase 0.9554 3 195 GO:0006633
GO:0016616
GO:0048038

Feature Viewer

pLDDT pTM Quality
91.14 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map