F464678

General Info

Members Datasets Scaffolds Average Seq Length
568 299 514 421

Family's Representative Sequence

Representative Sequence 3300053138|Ga0500564_066812|Ga0500564_066812_232_1506
Length 424
Sequence LDQAVNVYRQNSRVLLASLVGTAVEFYDFYIYATAAALVFGPLFFPVESSSAQLMFSYASFGIAFVARPLGATVFGHFGDRIGRKSTLVASLLLMGGATVLIGFLPTYQTAGWVAPLLLCVLRFTQGLGLGGEWGGAALLAVENAPPGYRARFGMFPQLGAPVGFIAANGLFLVLSSTLSDADFLAWGWRIPFVLSAVLVGLGLWVRTKLAETPAFEAIHDTAPASIPLVELFRTSMRQTLAGTFAVIVCFAIYYLTTAFALGYGTKTLGYASRAFLSVQLVAILFMAFGIVVSGYAADRWSSRAVLMGGSAAAIVIGLIMGPMFQSGSLAVIGVFLSLALLTMGFVYGPLAELLPQLFAPRVRYTGASIAFNVGGIIGGGAAPAVAQGLVDAGGVLFVGVYISGAAILTLIGLLSLCGKSEPY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
7 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
8 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
9 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
10 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
11 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
12 2643221583 Caulobacter sp. Root655 Isolate Unclassified
13 2643221584 Caulobacter sp. Root656 Isolate Unclassified
14 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
15 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
16 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
17 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
18 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
19 2643221640 Caulobacter sp. Root342 Isolate Unclassified
20 2643221642 Caulobacter sp. Root343 Isolate Unclassified
21 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
22 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
23 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
24 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
25 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
26 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
27 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
28 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
29 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
30 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
31 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
32 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
33 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
34 2818991435 Caulobacter henricii 536 Isolate Unclassified
35 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
36 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
37 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
38 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
39 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
40 2849560528 Caulobacter zeae 410 Isolate Unclassified
41 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
42 2851153111 Caulobacter radicis 736 Isolate Unclassified
43 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
44 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
45 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
46 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
47 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
48 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
49 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
50 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
51 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
52 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
53 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
54 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
55 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
56 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
57 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
58 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
59 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
60 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
61 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
62 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
63 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
64 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
67 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
68 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
69 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
70 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
77 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
210 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
259 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
260 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
261 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
262 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
268 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
277 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
278 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
279 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
284 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
285 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
286 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
292 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
296 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
297 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
298 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
299 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.49
Metatranscriptomes 0
Isolates 9.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.35
Bulb 0
Endosphere 13.91
Nodule 0
Rhizoplane 1.94
Rhizosphere 72.36
Stem 0
Stem Tuber 0
Unclassified 11.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3318283 2162886007 Bacteria 39515
2 JGI24736J21556_1000048 3300001904 Bacteria 19548
3 JGI24741J21665_1000216 3300001915 Bacteria 17150
4 JGI24740J21852_10000307 3300001979 Bacteria 20805
5 JGI24737J22298_10000706 3300001990 Bacteria 11740
6 JGI24737J22298_10001492 3300001990 Bacteria 8347
7 JGI24735J21928_10002562 3300002067 Bacteria 6291
8 JGI24748J21848_1000082 3300002074 Bacteria 28386
9 JGI24738J21930_10001041 3300002075 Bacteria 7898
10 JGI24034J26672_10000019 3300002239 Bacteria 125073
11 JGI24742J22300_10002289 3300002244 Bacteria 3061
12 JGI24751J29686_10000315 3300002459 Bacteria 18125
13 JGI25153J46596_10000006 3300003215 Bacteria 447760
14 JGI25153J46596_10029381 3300003215 Bacteria 1888
15 Ga0055542_1000020 3300003762 Bacteria 335745
16 Ga0055529_1000016 3300003763 Bacteria 364775
17 Ga0055537_1002067 3300003773 Bacteria 7067
18 Ga0055536_1001598 3300003781 Bacteria 13540
19 Ga0055536_1007267 3300003781 Bacteria 4987
20 Ga0055530_10000035 3300003791 Bacteria 117598
21 Ga0055531_10008012 3300003794 Bacteria 5648
22 Ga0055531_10012505 3300003794 Bacteria 3986
23 Ga0065165_1006378 3300005262 Bacteria 6209
24 Ga0065165_1008585 3300005262 Bacteria 4749
25 Ga0065704_10070200 3300005289 Bacteria 89591
26 Ga0065704_10089783 3300005289 Bacteria 2833
27 Ga0070658_10003281 3300005327 Bacteria 13354
28 Ga0070658_10095390 3300005327 Bacteria 2455
29 Ga0070683_100113533 3300005329 Bacteria 2557
30 Ga0070670_100000003 3300005331 Bacteria 529510
31 Ga0070670_100000021 3300005331 Bacteria 202776
32 Ga0070670_100000044 3300005331 Bacteria 140263
33 Ga0070670_100001683 3300005331 Bacteria 17959
34 Ga0070670_100003793 3300005331 Bacteria 12586
35 Ga0070670_100045069 3300005331 Bacteria 3791
36 Ga0070666_10000002 3300005335 Bacteria 478684
37 Ga0070666_10000166 3300005335 Bacteria 45239
38 Ga0070666_10023250 3300005335 Bacteria 4034
39 Ga0068868_100112510 3300005338 Bacteria 2213
40 Ga0070660_100027324 3300005339 Bacteria 4258
41 Ga0070661_100000644 3300005344 Bacteria 25789
42 Ga0070668_100000098 3300005347 Bacteria 53574
43 Ga0070668_100000113 3300005347 Bacteria 50427
44 Ga0070668_100002538 3300005347 Bacteria 13439
45 Ga0070668_100002555 3300005347 Bacteria 13384
46 Ga0070668_100010932 3300005347 Bacteria 6752
47 Ga0070668_100095062 3300005347 Bacteria 2354
48 Ga0070669_100000020 3300005353 Bacteria 181297
49 Ga0070669_100000042 3300005353 Bacteria 123396
50 Ga0070669_100000244 3300005353 Bacteria 45046
51 Ga0070669_100007840 3300005353 Bacteria 7630
52 Ga0070671_100000404 3300005355 Bacteria 29767
53 Ga0070671_100000929 3300005355 Bacteria 21432
54 Ga0070671_100006328 3300005355 Bacteria 9446
55 Ga0070671_100013020 3300005355 Bacteria 6704
56 Ga0070673_100071860 3300005364 Bacteria 2781
57 Ga0070688_100011368 3300005365 Bacteria 4945
58 Ga0070667_100000009 3300005367 Bacteria 281488
59 Ga0070667_100000036 3300005367 Bacteria 172536
60 Ga0070667_100000062 3300005367 Bacteria 143729
61 Ga0070667_100000221 3300005367 Bacteria 65664
62 Ga0070667_100000356 3300005367 Bacteria 50241
63 Ga0070667_100021529 3300005367 Bacteria 5352
64 Ga0070667_100044054 3300005367 Bacteria 3746
65 Ga0070667_100098143 3300005367 Bacteria 2528
66 Ga0070667_100151426 3300005367 Bacteria 2038
67 Ga0070705_100003906 3300005440 Bacteria 7288
68 Ga0070663_100052391 3300005455 Bacteria 2910
69 Ga0070678_100000101 3300005456 Bacteria 33068
70 Ga0070685_10000023 3300005466 Bacteria 102548
71 Ga0068853_100005150 3300005539 Bacteria 10215
72 Ga0070686_100000003 3300005544 Bacteria 308397
73 Ga0070665_100000036 3300005548 Bacteria 314603
74 Ga0070665_100000038 3300005548 Bacteria 309230
75 Ga0070665_100000419 3300005548 Bacteria 62030
76 Ga0070665_100000492 3300005548 Bacteria 56588
77 Ga0070665_100000762 3300005548 Bacteria 42638
78 Ga0070665_100001407 3300005548 Bacteria 28292
79 Ga0070665_100002025 3300005548 Bacteria 22786
80 Ga0070665_100024940 3300005548 Bacteria 6027
81 Ga0068855_100030158 3300005563 Bacteria 6487
82 Ga0068855_100138774 3300005563 Bacteria 2773
83 Ga0068857_100015613 3300005577 Bacteria 6636
84 Ga0068854_100007655 3300005578 Bacteria 6907
85 Ga0068856_100038164 3300005614 Bacteria 4715
86 Ga0068852_100000169 3300005616 Bacteria 43882
87 Ga0068852_100078002 3300005616 Bacteria 2930
88 Ga0068859_100000311 3300005617 Bacteria 48667
89 Ga0068859_100001527 3300005617 Bacteria 23614
90 Ga0068859_100004356 3300005617 Bacteria 14444
91 Ga0068859_100008257 3300005617 Bacteria 10556
92 Ga0068859_100067650 3300005617 Bacteria 3607
93 Ga0068864_100000004 3300005618 Bacteria 489341
94 Ga0068864_100000005 3300005618 Bacteria 400840
95 Ga0068864_100000061 3300005618 Bacteria 123373
96 Ga0068864_100005514 3300005618 Bacteria 10368
97 Ga0068864_100017527 3300005618 Bacteria 5971
98 Ga0068861_100008377 3300005719 Bacteria 7114
99 Ga0068851_10016224 3300005834 Bacteria 3561
100 Ga0068851_10017809 3300005834 Bacteria 3418
101 Ga0068863_100000002 3300005841 Bacteria 489510
102 Ga0068863_100000054 3300005841 Bacteria 124495
103 Ga0068863_100004485 3300005841 Bacteria 13769
104 Ga0068863_100011740 3300005841 Bacteria 8472
105 Ga0068863_100028418 3300005841 Bacteria 5340
106 Ga0068863_100036644 3300005841 Bacteria 4672
107 Ga0068863_100146532 3300005841 Bacteria 2258
108 Ga0068858_100001033 3300005842 Bacteria 28756
109 Ga0068858_100001148 3300005842 Bacteria 27405
110 Ga0068858_100003504 3300005842 Bacteria 15561
111 Ga0068858_100014835 3300005842 Bacteria 7331
112 Ga0068858_100054077 3300005842 Bacteria 3713
113 Ga0068860_100000001 3300005843 Bacteria 703043
114 Ga0068860_100000063 3300005843 Bacteria 189519
115 Ga0068860_100000122 3300005843 Bacteria 125178
116 Ga0068860_100000193 3300005843 Bacteria 97253
117 Ga0068860_100002286 3300005843 Bacteria 20138
118 Ga0068860_100006882 3300005843 Bacteria 11402
119 Ga0068860_100010260 3300005843 Bacteria 9273
120 Ga0068860_100057027 3300005843 Bacteria 3712
121 Ga0068860_100063884 3300005843 Bacteria 3496
122 Ga0068862_100000001 3300005844 Bacteria 523031
123 Ga0068862_100000002 3300005844 Bacteria 489341
124 Ga0068862_100000020 3300005844 Bacteria 219516
125 Ga0068862_100000023 3300005844 Bacteria 203389
126 Ga0068862_100000420 3300005844 Bacteria 45999
127 Ga0068862_100001272 3300005844 Bacteria 23685
128 Ga0068862_100002787 3300005844 Bacteria 15321
129 Ga0068862_100147243 3300005844 Bacteria 2094
130 Ga0081455_10000027 3300005937 Bacteria 156832
131 Ga0075368_10007292 3300006042 Bacteria 3897
132 Ga0075364_10008791 3300006051 Bacteria 6045
133 Ga0075432_10022107 3300006058 Bacteria 2174
134 Ga0075367_10003233 3300006178 Bacteria 7705
135 Ga0075369_10083212 3300006186 Bacteria 1421
136 Ga0075366_10038636 3300006195 Bacteria 2820
137 Ga0075366_10092786 3300006195 Bacteria 1809
138 Ga0068871_100114820 3300006358 Bacteria 2269
139 Ga0097620_100000311 3300006931 Bacteria 48667
140 Ga0097620_100001527 3300006931 Bacteria 23614
141 Ga0097620_100004357 3300006931 Bacteria 14444
142 Ga0097620_100008257 3300006931 Bacteria 10556
143 Ga0097620_100067652 3300006931 Bacteria 3607
144 Ga0105251_10002579 3300009011 Bacteria 14058
145 Ga0105240_10015210 3300009093 Bacteria 10469
146 Ga0105240_10039849 3300009093 Bacteria 6012
147 Ga0105247_10000859 3300009101 Bacteria 23009
148 Ga0105247_10004303 3300009101 Bacteria 9105
149 Ga0105247_10061605 3300009101 Bacteria 2326
150 Ga0105243_10000038 3300009148 Bacteria 174351
151 Ga0105241_10002143 3300009174 Bacteria 14888
152 Ga0105248_10000010 3300009177 Bacteria 344314
153 Ga0105248_10005714 3300009177 Bacteria 13661
154 Ga0105248_10013549 3300009177 Bacteria 8976
155 Ga0105248_10040857 3300009177 Bacteria 5200
156 Ga0105248_10095997 3300009177 Bacteria 3338
157 Ga0105248_10108790 3300009177 Bacteria 3126
158 Ga0105238_10080867 3300009551 Bacteria 3238
159 Ga0105238_10262991 3300009551 Bacteria 1705
160 Ga0105249_10000004 3300009553 Bacteria 368014
161 Ga0105249_10000114 3300009553 Bacteria 108599
162 Ga0105249_10000122 3300009553 Bacteria 105623
163 Ga0105249_10000478 3300009553 Bacteria 37253
164 Ga0105249_10003308 3300009553 Bacteria 13962
165 Ga0105239_10053291 3300010375 Bacteria 4437
166 Ga0157373_10000210 3300013100 Bacteria 47969
167 Ga0157373_10021661 3300013100 Bacteria 4664
168 Ga0157373_10137604 3300013100 Bacteria 1717
169 Ga0157371_10000316 3300013102 Bacteria 62749
170 Ga0157370_10069253 3300013104 Bacteria 3332
171 Ga0157369_10017614 3300013105 Bacteria 8029
172 Ga0157369_10384525 3300013105 Bacteria 1456
173 Ga0163162_10015529 3300013306 Bacteria 7442
174 Ga0163162_10052627 3300013306 Bacteria 4089
175 Ga0163162_10103906 3300013306 Bacteria 2935
176 Ga0163163_10030131 3300014325 Bacteria 5224
177 Ga0163163_10140305 3300014325 Bacteria 2459
178 Ga0157380_10000041 3300014326 Bacteria 75943
179 Ga0157380_10001736 3300014326 Bacteria 14376
180 Ga0157380_10010348 3300014326 Bacteria 6709
181 Ga0157379_10004017 3300014968 Bacteria 12536
182 Ga0157379_10010753 3300014968 Bacteria 7976
183 Ga0157379_10020436 3300014968 Bacteria 5855
184 Ga0163161_10000067 3300017792 Bacteria 106359
185 Ga0163161_10029647 3300017792 Bacteria 3890
186 Ga0163161_10043187 3300017792 Bacteria 3246
187 Ga0213872_10002264 3300021361 Bacteria 11475
188 Ga0213872_10034629 3300021361 Bacteria 2311
189 Ga0213876_10005136 3300021384 Bacteria 7220
190 Ga0209563_100019 3300025230 Bacteria 697828
191 Ga0209026_1001075 3300025250 Bacteria 13193
192 Ga0209148_1000017 3300025254 Bacteria 787064
193 Ga0209565_1000628 3300025263 Bacteria 23231
194 Ga0209455_1000005 3300025272 Bacteria 1416756
195 Ga0209673_1001063 3300025273 Bacteria 31382
196 Ga0209675_1000076 3300025291 Bacteria 159428
197 Ga0209676_1000070 3300025292 Bacteria 312074
198 Ga0209676_1000085 3300025292 Bacteria 273425
199 Ga0209676_1003034 3300025292 Bacteria 10875
200 Ga0209025_1016624 3300025294 Bacteria 4320
201 Ga0209758_1000001 3300025297 Bacteria 1981790
202 Ga0209758_1002235 3300025297 Bacteria 20121
203 Ga0209050_1000042 3300025298 Bacteria 402842
204 Ga0209257_1000329 3300025304 Bacteria 99531
205 Ga0209257_1001455 3300025304 Bacteria 27980
206 Ga0209257_1002892 3300025304 Bacteria 15945
207 Ga0207697_10000004 3300025315 Bacteria 90016
208 Ga0207656_10003513 3300025321 Bacteria 5393
209 Ga0207713_1002324 3300025735 Bacteria 13964
210 Ga0207680_10000004 3300025903 Bacteria 827324
211 Ga0207680_10000110 3300025903 Bacteria 37399
212 Ga0207680_10019443 3300025903 Bacteria 3633
213 Ga0207680_10028966 3300025903 Bacteria 3105
214 Ga0207647_10001779 3300025904 Bacteria 16529
215 Ga0207647_10003751 3300025904 Bacteria 11357
216 Ga0207647_10016024 3300025904 Bacteria 5124
217 Ga0207647_10030025 3300025904 Bacteria 3511
218 Ga0207647_10071941 3300025904 Bacteria 2086
219 Ga0207705_10000009 3300025909 Bacteria 576128
220 Ga0207705_10010190 3300025909 Bacteria 6837
221 Ga0207654_10003425 3300025911 Bacteria 8019
222 Ga0207695_10013656 3300025913 Bacteria 9669
223 Ga0207695_10041188 3300025913 Bacteria 4944
224 Ga0207695_10062566 3300025913 Bacteria 3841
225 Ga0207671_10005405 3300025914 Bacteria 11765
226 Ga0207657_10005069 3300025919 Bacteria 13816
227 Ga0207657_10020836 3300025919 Bacteria 6186
228 Ga0207649_10019750 3300025920 Bacteria 3856
229 Ga0207649_10067565 3300025920 Bacteria 2270
230 Ga0207681_10000002 3300025923 Bacteria 985597
231 Ga0207681_10000005 3300025923 Bacteria 555724
232 Ga0207681_10000079 3300025923 Bacteria 87683
233 Ga0207681_10005559 3300025923 Bacteria 7744
234 Ga0207681_10021972 3300025923 Bacteria 4063
235 Ga0207681_10068342 3300025923 Bacteria 2467
236 Ga0207681_10167939 3300025923 Bacteria 1660
237 Ga0207694_10003059 3300025924 Bacteria 13412
238 Ga0207650_10000004 3300025925 Bacteria 743372
239 Ga0207650_10000065 3300025925 Bacteria 140452
240 Ga0207650_10000298 3300025925 Bacteria 49421
241 Ga0207650_10000969 3300025925 Bacteria 21577
242 Ga0207650_10005149 3300025925 Bacteria 8924
243 Ga0207650_10118966 3300025925 Bacteria 2054
244 Ga0207644_10000149 3300025931 Bacteria 50342
245 Ga0207644_10000345 3300025931 Bacteria 30103
246 Ga0207644_10002953 3300025931 Bacteria 10954
247 Ga0207706_10100718 3300025933 Bacteria 2541
248 Ga0207706_10142120 3300025933 Bacteria 2111
249 Ga0207706_10258941 3300025933 Bacteria 1519
250 Ga0207709_10000031 3300025935 Bacteria 329046
251 Ga0207669_10000077 3300025937 Bacteria 49918
252 Ga0207711_10000038 3300025941 Bacteria 163520
253 Ga0207711_10000836 3300025941 Bacteria 29755
254 Ga0207711_10007717 3300025941 Bacteria 8989
255 Ga0207711_10051065 3300025941 Bacteria 3541
256 Ga0207711_10059836 3300025941 Bacteria 3280
257 Ga0207711_10134720 3300025941 Bacteria 2218
258 Ga0207667_10000004 3300025949 Bacteria 737718
259 Ga0207667_10006236 3300025949 Bacteria 14472
260 Ga0207667_10029219 3300025949 Bacteria 5980
261 Ga0207667_10096116 3300025949 Bacteria 3057
262 Ga0207651_10119274 3300025960 Bacteria 1997
263 Ga0207712_10000001 3300025961 Bacteria 750309
264 Ga0207712_10000008 3300025961 Bacteria 527957
265 Ga0207712_10000393 3300025961 Bacteria 38056
266 Ga0207712_10000625 3300025961 Bacteria 27973
267 Ga0207712_10005752 3300025961 Bacteria 7815
268 Ga0207668_10000153 3300025972 Bacteria 47612
269 Ga0207668_10000769 3300025972 Bacteria 19619
270 Ga0207668_10001414 3300025972 Bacteria 14117
271 Ga0207668_10003439 3300025972 Bacteria 9289
272 Ga0207668_10010888 3300025972 Bacteria 5512
273 Ga0207668_10014254 3300025972 Bacteria 4917
274 Ga0207668_10032571 3300025972 Bacteria 3445
275 Ga0207640_10000698 3300025981 Bacteria 19549
276 Ga0207640_10003407 3300025981 Bacteria 8566
277 Ga0207640_10004262 3300025981 Bacteria 7740
278 Ga0207658_10000009 3300025986 Bacteria 264118
279 Ga0207658_10000039 3300025986 Bacteria 143707
280 Ga0207658_10000168 3300025986 Bacteria 70040
281 Ga0207658_10000256 3300025986 Bacteria 55417
282 Ga0207658_10000444 3300025986 Bacteria 38999
283 Ga0207658_10006969 3300025986 Bacteria 7693
284 Ga0207658_10013120 3300025986 Bacteria 5659
285 Ga0207677_10082751 3300026023 Bacteria 2308
286 Ga0207703_10001385 3300026035 Bacteria 22148
287 Ga0207703_10001417 3300026035 Bacteria 21851
288 Ga0207703_10001823 3300026035 Bacteria 19006
289 Ga0207703_10005529 3300026035 Bacteria 10148
290 Ga0207703_10030451 3300026035 Bacteria 4266
291 Ga0207703_10124531 3300026035 Bacteria 2217
292 Ga0207639_10013717 3300026041 Bacteria 5681
293 Ga0207702_10006385 3300026078 Bacteria 10177
294 Ga0207702_10012025 3300026078 Bacteria 7195
295 Ga0207702_10016141 3300026078 Bacteria 6182
296 Ga0207641_10000002 3300026088 Bacteria 981004
297 Ga0207641_10000095 3300026088 Bacteria 124498
298 Ga0207641_10001116 3300026088 Bacteria 27005
299 Ga0207641_10004512 3300026088 Bacteria 12036
300 Ga0207641_10006919 3300026088 Bacteria 9489
301 Ga0207641_10007099 3300026088 Bacteria 9356
302 Ga0207641_10008838 3300026088 Bacteria 8319
303 Ga0207641_10015439 3300026088 Bacteria 6257
304 Ga0207641_10020024 3300026088 Bacteria 5493
305 Ga0207641_10217857 3300026088 Bacteria 1768
306 Ga0207641_10236953 3300026088 Bacteria 1698
307 Ga0207648_10033531 3300026089 Bacteria 4529
308 Ga0207676_10000005 3300026095 Bacteria 698744
309 Ga0207676_10000006 3300026095 Bacteria 681936
310 Ga0207676_10000062 3300026095 Bacteria 112045
311 Ga0207676_10002959 3300026095 Bacteria 12113
312 Ga0207674_10034929 3300026116 Bacteria 5251
313 Ga0207675_100000661 3300026118 Bacteria 33944
314 Ga0207675_100004055 3300026118 Bacteria 14186
315 Ga0207675_100099893 3300026118 Bacteria 2733
316 Ga0207683_10000523 3300026121 Bacteria 35542
317 Ga0207698_10000482 3300026142 Bacteria 23217
318 Ga0207698_10023759 3300026142 Bacteria 4288
319 Ga0268266_10000002 3300028379 Bacteria 3059047
320 Ga0268266_10000042 3300028379 Bacteria 316826
321 Ga0268266_10000634 3300028379 Bacteria 47779
322 Ga0268266_10001138 3300028379 Bacteria 33094
323 Ga0268266_10001434 3300028379 Bacteria 28392
324 Ga0268266_10001678 3300028379 Bacteria 25491
325 Ga0268266_10002353 3300028379 Bacteria 20452
326 Ga0268266_10055942 3300028379 Bacteria 3393
327 Ga0268266_10073828 3300028379 Bacteria 2961
328 Ga0268265_10000001 3300028380 Bacteria 1230727
329 Ga0268265_10000003 3300028380 Bacteria 949201
330 Ga0268265_10000035 3300028380 Bacteria 207267
331 Ga0268265_10000190 3300028380 Bacteria 72600
332 Ga0268265_10000260 3300028380 Bacteria 60001
333 Ga0268265_10000409 3300028380 Bacteria 46033
334 Ga0268265_10001007 3300028380 Bacteria 25467
335 Ga0268265_10023706 3300028380 Bacteria 4330
336 Ga0268265_10094869 3300028380 Bacteria 2394
337 Ga0268264_10000001 3300028381 Bacteria 1221000
338 Ga0268264_10000006 3300028381 Bacteria 827324
339 Ga0268264_10000010 3300028381 Bacteria 596543
340 Ga0268264_10000083 3300028381 Bacteria 245366
341 Ga0268264_10000172 3300028381 Bacteria 140393
342 Ga0268264_10003203 3300028381 Bacteria 14171
343 Ga0268264_10011087 3300028381 Bacteria 7445
344 Ga0268264_10035947 3300028381 Bacteria 4079
345 Ga0307515_10066306 3300028794 Bacteria 5004
346 Ga0307513_10077958 3300031456 Bacteria 3429
347 Ga0307405_10033142 3300031731 Bacteria 3060
348 Ga0307406_10142251 3300031901 Bacteria 1700
349 Ga0307412_10015962 3300031911 Bacteria 4462
350 Ga0307412_10059282 3300031911 Bacteria 2564
351 Ga0307414_10002863 3300032004 Bacteria 9112
352 Ga0307414_10005332 3300032004 Bacteria 7075
353 Ga0307414_10005462 3300032004 Bacteria 7002
354 Ga0307414_10037084 3300032004 Bacteria 3261
355 Ga0307411_10054450 3300032005 Bacteria 2627
356 Ga0316584_0105957 3300036712 Bacteria 2104
357 Ga0237819_00919 3300038705 Bacteria 9076
358 Ga0436365_0779181 3300039437 Bacteria 13451
359 Ga0436361_0144995 3300039447 Bacteria 2477
360 Ga0436361_0610415 3300039447 Bacteria 9442
361 Ga0436361_0995739 3300039447 Bacteria 6403
362 Ga0439465_0041707 3300041413 Bacteria 1486
363 Ga0495638_0000685 3300046460 Bacteria 36856
364 Ga0495638_0079853 3300046460 Bacteria 1988
365 Ga0495650_0000024 3300046471 Bacteria 496674
366 Ga0495650_0000370 3300046471 Bacteria 78408
367 Ga0495650_0006458 3300046471 Bacteria 7297
368 Ga0495585_0020918 3300046492 Bacteria 3759
369 Ga0495596_0004553 3300046500 Bacteria 6739
370 Ga0495583_0001056 3300046506 Bacteria 30863
371 Ga0495606_0001853 3300046507 Bacteria 26586
372 Ga0495610_0000375 3300046512 Bacteria 46324
373 Ga0495610_0016059 3300046512 Bacteria 4327
374 Ga0495620_0027891 3300046515 Bacteria 2635
375 Ga0495643_0000703 3300046522 Bacteria 38441
376 Ga0495643_0001914 3300046522 Bacteria 17554
377 Ga0495643_0011755 3300046522 Bacteria 5311
378 Ga0495648_0000303 3300046524 Bacteria 54717
379 Ga0495648_0024883 3300046524 Bacteria 4065
380 Ga0495663_0013871 3300046525 Bacteria 2254
381 Ga0495654_0007542 3300046530 Bacteria 6068
382 Ga0495609_0032905 3300046538 Bacteria 2354
383 Ga0495597_0003430 3300046542 Bacteria 9259
384 Ga0495633_0006905 3300046558 Bacteria 6643
385 Ga0495633_0067009 3300046558 Bacteria 1676
386 Ga0495668_0000001 3300046616 Bacteria 1013420
387 Ga0495668_0000007 3300046616 Bacteria 552902
388 Ga0495668_0005898 3300046616 Bacteria 8152
389 Ga0495668_0063499 3300046616 Bacteria 2034
390 Ga0495668_0124838 3300046616 Bacteria 1408
391 Ga0495625_0000237 3300046660 Bacteria 86257
392 Ga0495625_0000546 3300046660 Bacteria 55126
393 Ga0495625_0004982 3300046660 Bacteria 12335
394 Ga0495661_0092519 3300046665 Bacteria 1718
395 Ga0495669_0000003 3300046684 Bacteria 267741
396 Ga0495669_0031488 3300046684 Bacteria 2330
397 Ga0495670_0028310 3300046691 Bacteria 2778
398 Ga0495649_0017819 3300046694 Bacteria 4004
399 Ga0495600_0007247 3300046809 Bacteria 6771
400 Ga0495672_0002232 3300047320 Bacteria 18018
401 Ga0495683_0002008 3300047323 Bacteria 12646
402 Ga0495687_002902 3300047443 Bacteria 13068
403 Ga0495681_0024023 3300047470 Bacteria 3222
404 Ga0495686_0000074 3300047472 Bacteria 208094
405 Ga0495686_0000120 3300047472 Bacteria 164638
406 Ga0495686_0015439 3300047472 Bacteria 5213
407 Ga0495593_0023012 3300047673 Bacteria 3467
408 Ga0496102_0000980 3300048905 Bacteria 26844
409 Ga0496102_0026435 3300048905 Bacteria 5176
410 Ga0496103_0000187 3300048906 Bacteria 62767
411 Ga0496103_0001064 3300048906 Bacteria 19155
412 Ga0496105_0000112 3300048908 Bacteria 55700
413 Ga0496105_0041286 3300048908 Bacteria 3802
414 Ga0496107_0086641 3300048910 Bacteria 2286
415 Ga0496111_0172227 3300048914 Bacteria 1608
416 Ga0496114_0007010 3300048917 Bacteria 8888
417 Ga0496115_0000159 3300048918 Bacteria 63368
418 Ga0496115_0005130 3300048918 Bacteria 9529
419 Ga0496116_0002038 3300048919 Bacteria 21668
420 Ga0496116_0003047 3300048919 Bacteria 16943
421 Ga0496116_0050460 3300048919 Bacteria 2772
422 Ga0496117_0000182 3300048920 Bacteria 128076
423 Ga0496117_0003241 3300048920 Bacteria 19161
424 Ga0496117_0006187 3300048920 Bacteria 12213
425 Ga0496117_0011067 3300048920 Bacteria 8120
426 Ga0496117_0023113 3300048920 Bacteria 4967
427 Ga0496118_0000125 3300048921 Bacteria 136422
428 Ga0496118_0000310 3300048921 Bacteria 84607
429 Ga0496118_0000327 3300048921 Bacteria 82033
430 Ga0496118_0003630 3300048921 Bacteria 19161
431 Ga0496118_0041306 3300048921 Bacteria 3653
432 Ga0496118_0074813 3300048921 Bacteria 2419
433 Ga0496119_0012603 3300048922 Bacteria 6846
434 Ga0496120_0046156 3300048923 Bacteria 2519
435 Ga0496121_0000053 3300048924 Bacteria 312611
436 Ga0496121_0000686 3300048924 Bacteria 63083
437 Ga0496121_0020824 3300048924 Bacteria 6462
438 Ga0496122_0059360 3300048925 Bacteria 2824
439 Ga0496123_0018057 3300048926 Bacteria 5640
440 Ga0496124_0000082 3300048927 Bacteria 208248
441 Ga0496124_0003482 3300048927 Bacteria 19161
442 Ga0496125_0001298 3300048928 Bacteria 37080
443 Ga0496125_0077870 3300048928 Bacteria 2552
444 Ga0496126_0000221 3300048929 Bacteria 124193
445 Ga0501290_002257 3300049513 Bacteria 2502
446 Ga0501032_0000970 3300049569 Bacteria 23236
447 Ga0501033_0007940 3300049570 Bacteria 8220
448 Ga0501034_0002130 3300049571 Bacteria 24593
449 Ga0501034_0013289 3300049571 Bacteria 8483
450 Ga0501036_0005271 3300049572 Bacteria 10459
451 Ga0501037_0009600 3300049573 Bacteria 7102
452 Ga0501039_0012885 3300049575 Bacteria 6395
453 Ga0501043_0018751 3300049579 Bacteria 5429
454 Ga0501047_0003781 3300049581 Bacteria 14248
455 Ga0501068_0000231 3300049584 Bacteria 27187
456 Ga0501070_0050882 3300049586 Bacteria 3438
457 Ga0501073_0000007 3300049589 Bacteria 227229
458 Ga0501077_0000003 3300049593 Bacteria 143061
459 Ga0501223_000167 3300049663 Bacteria 17078
460 Ga0501224_000022 3300049664 Bacteria 64882
461 Ga0501249_000456 3300049679 Bacteria 10190
462 Ga0501257_000037 3300049686 Bacteria 37573
463 Ga0501225_0000235 3300049705 Bacteria 17243
464 Ga0501080_0000942 3300049742 Bacteria 23759
465 Ga0501280_000910 3300049776 Bacteria 6270
466 Ga0501035_0002170 3300049822 Bacteria 19482
467 Ga0501044_0043600 3300049823 Bacteria 4659
468 Ga0501204_003758 3300049850 Bacteria 1612
469 Ga0501226_000146 3300049853 Bacteria 13414
470 nmdc:mga00v17_114449_c1 3300050491 Bacteria 1713
471 nmdc:mga00v17_672_c1 3300050491 Bacteria 18838
472 nmdc:mga0k408_11381_c1 3300050493 Bacteria 4844
473 Ga0500635_0000115 3300053080 Bacteria 47775
474 Ga0500643_000779 3300053087 Bacteria 20714
475 Ga0500643_001992 3300053087 Bacteria 11045
476 Ga0500643_020496 3300053087 Bacteria 2160
477 Ga0500651_0050857 3300053093 Bacteria 2599
478 Ga0500566_0065991 3300053094 Bacteria 2040
479 Ga0500641_0017438 3300053096 Bacteria 2685
480 Ga0500556_0001043 3300053104 Bacteria 14364
481 Ga0500562_000547 3300053108 Bacteria 9100
482 Ga0500572_000868 3300053111 Bacteria 9383
483 Ga0500592_000941 3300053116 Bacteria 4738
484 Ga0500594_0005257 3300053118 Bacteria 2868
485 Ga0500595_000933 3300053119 Bacteria 16556
486 Ga0500595_003335 3300053119 Bacteria 7548
487 Ga0500608_000376 3300053122 Bacteria 17229
488 Ga0500614_005106 3300053123 Bacteria 2758
489 Ga0500614_016401 3300053123 Bacteria 1662
490 Ga0500642_0001273 3300053130 Bacteria 7206
491 Ga0500655_000164 3300053133 Bacteria 16318
492 Ga0500564_000523 3300053138 Bacteria 11427
493 Ga0500564_066812 3300053138 Bacteria 1626
494 Ga0500568_0004001 3300053139 Bacteria 8001
495 Ga0500590_007673 3300053148 Bacteria 5351
496 Ga0500604_0000003 3300053151 Bacteria 148800
497 Ga0500604_0008388 3300053151 Bacteria 2742
498 Ga0500604_0028656 3300053151 Bacteria 1618
499 Ga0500616_0000087 3300053153 Bacteria 192225
500 Ga0500616_0025110 3300053153 Bacteria 3306
501 Ga0500622_0077556 3300053156 Bacteria 1669
502 Ga0500624_000298 3300053157 Bacteria 17017
503 Ga0500627_0000004 3300053158 Bacteria 174208
504 Ga0500627_0000768 3300053158 Bacteria 8544
505 Ga0500636_0004315 3300053177 Bacteria 8045
506 Ga0500636_0004640 3300053177 Bacteria 7800
507 Ga0500636_0019744 3300053177 Bacteria 3985
508 Ga0500636_0092005 3300053177 Bacteria 1736
509 Ga0500570_000419 3300053724 Bacteria 16197
510 Ga0500625_000043 3300053729 Bacteria 30930
511 Ga0500625_027834 3300053729 Bacteria 2681
512 Ga0500645_002519 3300053730 Bacteria 8098
513 Ga0500645_002703 3300053730 Bacteria 7702
514 Ga0500596_001619 3300053735 Bacteria 4571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003215 JGI25153J46596_10029381 JGI25153J46596_100293811 385
2 3300003773 Ga0055537_1002067 Ga0055537_10020676 385
3 3300025263 Ga0209565_1000628 Ga0209565_10006281 385
4 3300025273 Ga0209673_1001063 Ga0209673_10010633 385
5 3300025297 Ga0209758_1002235 Ga0209758_100223510 385
6 3300048918 Ga0496115_0005130 Ga0496115_0005130_7313_8617 385
7 3300053730 Ga0500645_002703 Ga0500645_002703_4470_5744 386
8 3300014326 Ga0157380_10010348 Ga0157380_100103488 389
9 3300046471 Ga0495650_0006458 Ga0495650_0006458_2449_3768 392
10 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006241 393
11 3300005338 Ga0068868_100112510 Ga0068868_1001125103 393
12 3300005364 Ga0070673_100071860 Ga0070673_1000718602 393
13 3300005456 Ga0070678_100000101 Ga0070678_1000001018 393
14 3300006358 Ga0068871_100114820 Ga0068871_1001148201 393
15 3300009148 Ga0105243_10000038 Ga0105243_10000038167 393
16 3300017792 Ga0163161_10029647 Ga0163161_100296473 393
17 3300025297 Ga0209758_1000001 Ga0209758_10000011584 393
18 3300025904 Ga0207647_10003751 Ga0207647_100037514 393
19 3300025933 Ga0207706_10100718 Ga0207706_101007182 393
20 3300025935 Ga0207709_10000031 Ga0207709_10000031114 393
21 3300025937 Ga0207669_10000077 Ga0207669_100000776 393
22 3300025960 Ga0207651_10119274 Ga0207651_101192742 393
23 3300026023 Ga0207677_10082751 Ga0207677_100827512 393
24 3300026089 Ga0207648_10033531 Ga0207648_100335311 393
25 3300026121 Ga0207683_10000523 Ga0207683_1000052332 393
26 3300046507 Ga0495606_0001853 Ga0495606_0001853_8160_9407 393
27 3300046522 Ga0495643_0000703 Ga0495643_0000703_17482_18729 393
28 3300046522 Ga0495643_0011755 Ga0495643_0011755_2550_3797 393
29 3300046524 Ga0495648_0000303 Ga0495648_0000303_19658_20905 393
30 3300046694 Ga0495649_0017819 Ga0495649_0017819_1171_2418 393
31 3300047323 Ga0495683_0002008 Ga0495683_0002008_113_1360 393
32 3300047470 Ga0495681_0024023 Ga0495681_0024023_1404_2651 393
33 3300048905 Ga0496102_0000980 Ga0496102_0000980_20336_21583 393
34 3300048906 Ga0496103_0000187 Ga0496103_0000187_35463_36710 393
35 3300048908 Ga0496105_0000112 Ga0496105_0000112_16223_17470 393
36 3300048914 Ga0496111_0172227 Ga0496111_0172227_137_1384 393
37 3300048917 Ga0496114_0007010 Ga0496114_0007010_1924_3171 393
38 3300048918 Ga0496115_0000159 Ga0496115_0000159_35817_37064 393
39 3300048919 Ga0496116_0002038 Ga0496116_0002038_8368_9615 393
40 3300048920 Ga0496117_0000182 Ga0496117_0000182_91188_92435 393
41 3300048921 Ga0496118_0000125 Ga0496118_0000125_35602_36849 393
42 3300048923 Ga0496120_0046156 Ga0496120_0046156_1155_2402 393
43 3300048924 Ga0496121_0000686 Ga0496121_0000686_35563_36810 393
44 3300048926 Ga0496123_0018057 Ga0496123_0018057_4290_5537 393
45 3300048927 Ga0496124_0000082 Ga0496124_0000082_99559_100806 393
46 3300048928 Ga0496125_0001298 Ga0496125_0001298_35607_36854 393
47 3300048929 Ga0496126_0000221 Ga0496126_0000221_87349_88596 393
48 3300053130 Ga0500642_0001273 Ga0500642_0001273_945_2192 393
49 3300003762 Ga0055542_1000020 Ga0055542_1000020186 394
50 3300003763 Ga0055529_1000016 Ga0055529_1000016160 394
51 3300025254 Ga0209148_1000017 Ga0209148_1000017587 394
52 3300025272 Ga0209455_1000005 Ga0209455_1000005587 394
53 3300046500 Ga0495596_0004553 Ga0495596_0004553_3584_4831 394
54 3300046522 Ga0495643_0001914 Ga0495643_0001914_3806_5053 394
55 3300046616 Ga0495668_0000007 Ga0495668_0000007_176278_177525 394
56 3300046506 Ga0495583_0001056 Ga0495583_0001056_23812_25059 395
57 3300046660 Ga0495625_0000546 Ga0495625_0000546_30487_31734 395
58 3300046665 Ga0495661_0092519 Ga0495661_0092519_411_1658 395
59 3300046809 Ga0495600_0007247 Ga0495600_0007247_688_1935 395
60 3300047443 Ga0495687_002902 Ga0495687_002902_11559_12806 395
61 3300053119 Ga0500595_000933 Ga0500595_000933_8244_9491 395
62 3300053177 Ga0500636_0004640 Ga0500636_0004640_1238_2485 395
63 3300053735 Ga0500596_001619 Ga0500596_001619_2346_3593 395
64 3300046471 Ga0495650_0000370 Ga0495650_0000370_8115_9362 396
65 3300046558 Ga0495633_0006905 Ga0495633_0006905_1002_2249 396
66 3300005339 Ga0070660_100027324 Ga0070660_1000273243 397
67 3300025919 Ga0207657_10020836 Ga0207657_100208364 397
68 3300046460 Ga0495638_0000685 Ga0495638_0000685_10214_11500 397
69 3300001915 JGI24741J21665_1000216 JGI24741J21665_10002163 398
70 3300001979 JGI24740J21852_10000307 JGI24740J21852_1000030715 398
71 3300001990 JGI24737J22298_10000706 JGI24737J22298_100007063 398
72 3300005329 Ga0070683_100113533 Ga0070683_1001135333 398
73 3300005344 Ga0070661_100000644 Ga0070661_10000064410 398
74 3300005455 Ga0070663_100052391 Ga0070663_1000523913 398
75 3300009174 Ga0105241_10002143 Ga0105241_1000214311 398
76 3300013100 Ga0157373_10137604 Ga0157373_101376041 398
77 3300013102 Ga0157371_10000316 Ga0157371_1000031649 398
78 3300025321 Ga0207656_10003513 Ga0207656_100035131 398
79 3300025904 Ga0207647_10030025 Ga0207647_100300253 398
80 3300025920 Ga0207649_10019750 Ga0207649_100197504 398
81 3300025949 Ga0207667_10000004 Ga0207667_10000004400 398
82 3300025981 Ga0207640_10004262 Ga0207640_100042625 398
83 3300026041 Ga0207639_10013717 Ga0207639_100137173 398
84 3300026078 Ga0207702_10012025 Ga0207702_100120253 398
85 3300026142 Ga0207698_10023759 Ga0207698_100237593 398
86 3300046492 Ga0495585_0020918 Ga0495585_0020918_780_2027 400
87 3300046558 Ga0495633_0067009 Ga0495633_0067009_329_1576 400
88 3300046691 Ga0495670_0028310 Ga0495670_0028310_576_1823 400
89 3300047472 Ga0495686_0000120 Ga0495686_0000120_97677_98924 400
90 3300049513 Ga0501290_002257 Ga0501290_002257_567_1841 400
91 3300049686 Ga0501257_000037 Ga0501257_000037_22645_23919 400
92 3300049776 Ga0501280_000910 Ga0501280_000910_961_2235 400
93 3300053104 Ga0500556_0001043 Ga0500556_0001043_6931_8205 400
94 3300053157 Ga0500624_000298 Ga0500624_000298_12261_13571 400
95 3300053177 Ga0500636_0004315 Ga0500636_0004315_3264_4574 400
96 3300005327 Ga0070658_10095390 Ga0070658_100953902 402
97 3300005347 Ga0070668_100000113 Ga0070668_10000011329 404
98 3300005355 Ga0070671_100000404 Ga0070671_10000040428 404
99 3300005841 Ga0068863_100036644 Ga0068863_1000366444 404
100 3300005844 Ga0068862_100000420 Ga0068862_10000042032 404
101 3300025931 Ga0207644_10000149 Ga0207644_1000014927 404
102 3300025972 Ga0207668_10000153 Ga0207668_1000015319 404
103 3300026088 Ga0207641_10008838 Ga0207641_100088383 404
104 3300026118 Ga0207675_100099893 Ga0207675_1000998931 404
105 3300028380 Ga0268265_10000409 Ga0268265_1000040927 404
106 3300005618 Ga0068864_100005514 Ga0068864_1000055146 405
107 3300053730 Ga0500645_002519 Ga0500645_002519_30_1262 405
108 3300005262 Ga0065165_1008585 Ga0065165_10085852 406
109 3300005331 Ga0070670_100003793 Ga0070670_1000037936 406
110 3300005347 Ga0070668_100002555 Ga0070668_10000255510 406
111 3300005367 Ga0070667_100000009 Ga0070667_100000009248 406
112 3300005367 Ga0070667_100098143 Ga0070667_1000981433 406
113 3300005841 Ga0068863_100011740 Ga0068863_1000117408 406
114 3300005842 Ga0068858_100001033 Ga0068858_10000103319 406
115 3300005843 Ga0068860_100000193 Ga0068860_10000019386 406
116 3300009177 Ga0105248_10108790 Ga0105248_101087903 406
117 3300025920 Ga0207649_10067565 Ga0207649_100675651 406
118 3300025941 Ga0207711_10051065 Ga0207711_100510652 406
119 3300025972 Ga0207668_10001414 Ga0207668_100014145 406
120 3300047472 Ga0495686_0015439 Ga0495686_0015439_3389_4669 406
121 3300048920 Ga0496117_0023113 Ga0496117_0023113_2676_3953 406
122 3300048921 Ga0496118_0000310 Ga0496118_0000310_2750_4027 406
123 3300002074 JGI24748J21848_1000082 JGI24748J21848_100008217 407
124 3300002239 JGI24034J26672_10000019 JGI24034J26672_1000001982 407
125 3300002244 JGI24742J22300_10002289 JGI24742J22300_100022894 407
126 3300005844 Ga0068862_100000020 Ga0068862_10000002019 407
127 3300014968 Ga0157379_10010753 Ga0157379_100107534 407
128 3300025923 Ga0207681_10167939 Ga0207681_101679391 407
129 3300025925 Ga0207650_10005149 Ga0207650_100051498 407
130 3300025986 Ga0207658_10000009 Ga0207658_1000000918 407
131 3300026035 Ga0207703_10001823 Ga0207703_1000182313 407
132 3300026088 Ga0207641_10001116 Ga0207641_100011163 407
133 3300026088 Ga0207641_10006919 Ga0207641_100069194 407
134 3300026118 Ga0207675_100000661 Ga0207675_1000006618 407
135 3300028380 Ga0268265_10000190 Ga0268265_1000019051 407
136 3300028381 Ga0268264_10000001 Ga0268264_1000000118 407
137 3300005844 Ga0068862_100002787 Ga0068862_1000027873 409
138 3300009101 Ga0105247_10061605 Ga0105247_100616053 409
139 3300048921 Ga0496118_0074813 Ga0496118_0074813_1064_2326 409
140 3300009551 Ga0105238_10080867 Ga0105238_100808672 411
141 3300013105 Ga0157369_10384525 Ga0157369_103845251 411
142 3300006058 Ga0075432_10022107 Ga0075432_100221072 412
143 3300021361 Ga0213872_10002264 Ga0213872_100022647 412
144 3300039447 Ga0436361_0610415 Ga0436361_0610415_4014_5273 412
145 3300001904 JGI24736J21556_1000048 JGI24736J21556_10000486 413
146 3300001990 JGI24737J22298_10001492 JGI24737J22298_100014925 413
147 3300002067 JGI24735J21928_10002562 JGI24735J21928_100025621 413
148 3300002075 JGI24738J21930_10001041 JGI24738J21930_100010416 413
149 3300005331 Ga0070670_100045069 Ga0070670_1000450692 413
150 3300005335 Ga0070666_10000002 Ga0070666_10000002328 413
151 3300005347 Ga0070668_100095062 Ga0070668_1000950624 413
152 3300005353 Ga0070669_100000244 Ga0070669_10000024429 413
153 3300005355 Ga0070671_100006328 Ga0070671_1000063282 413
154 3300005365 Ga0070688_100011368 Ga0070688_1000113683 413
155 3300005367 Ga0070667_100021529 Ga0070667_1000215293 413
156 3300005466 Ga0070685_10000023 Ga0070685_10000023105 413
157 3300005539 Ga0068853_100005150 Ga0068853_1000051506 413
158 3300005544 Ga0070686_100000003 Ga0070686_10000000340 413
159 3300005548 Ga0070665_100000036 Ga0070665_1000000368 413
160 3300005577 Ga0068857_100015613 Ga0068857_1000156137 413
161 3300005617 Ga0068859_100008257 Ga0068859_10000825710 413
162 3300005618 Ga0068864_100017527 Ga0068864_1000175276 413
163 3300005834 Ga0068851_10016224 Ga0068851_100162243 413
164 3300005843 Ga0068860_100000001 Ga0068860_100000001331 413
165 3300005937 Ga0081455_10000027 Ga0081455_1000002755 413
166 3300006931 Ga0097620_100008257 Ga0097620_1000082577 413
167 3300009553 Ga0105249_10000114 Ga0105249_1000011479 413
168 3300013100 Ga0157373_10021661 Ga0157373_100216615 413
169 3300013104 Ga0157370_10069253 Ga0157370_100692533 413
170 3300013105 Ga0157369_10017614 Ga0157369_100176147 413
171 3300013306 Ga0163162_10015529 Ga0163162_100155298 413
172 3300014325 Ga0163163_10140305 Ga0163163_101403052 413
173 3300014326 Ga0157380_10001736 Ga0157380_100017368 413
174 3300017792 Ga0163161_10000067 Ga0163161_1000006721 413
175 3300025903 Ga0207680_10000004 Ga0207680_10000004533 413
176 3300025904 Ga0207647_10001779 Ga0207647_1000177910 413
177 3300025911 Ga0207654_10003425 Ga0207654_100034256 413
178 3300025913 Ga0207695_10013656 Ga0207695_100136569 413
179 3300025914 Ga0207671_10005405 Ga0207671_100054059 413
180 3300025919 Ga0207657_10005069 Ga0207657_1000506910 413
181 3300025923 Ga0207681_10000079 Ga0207681_1000007962 413
182 3300025924 Ga0207694_10003059 Ga0207694_100030596 413
183 3300025925 Ga0207650_10118966 Ga0207650_101189663 413
184 3300025933 Ga0207706_10142120 Ga0207706_101421202 413
185 3300025949 Ga0207667_10006236 Ga0207667_100062369 413
186 3300025961 Ga0207712_10000001 Ga0207712_10000001407 413
187 3300026035 Ga0207703_10001417 Ga0207703_1000141715 413
188 3300026078 Ga0207702_10006385 Ga0207702_1000638510 413
189 3300026095 Ga0207676_10002959 Ga0207676_100029592 413
190 3300028379 Ga0268266_10000042 Ga0268266_10000042330 413
191 3300028381 Ga0268264_10000006 Ga0268264_10000006533 413
192 3300031731 Ga0307405_10033142 Ga0307405_100331423 413
193 3300036712 Ga0316584_0105957 Ga0316584_0105957_58_1347 413
194 3300041413 Ga0439465_0041707 Ga0439465_0041707_166_1464 413
195 3300046525 Ga0495663_0013871 Ga0495663_0013871_232_1482 413
196 3300046530 Ga0495654_0007542 Ga0495654_0007542_3325_4575 413
197 3300046616 Ga0495668_0005898 Ga0495668_0005898_2555_3805 413
198 3300046616 Ga0495668_0124838 Ga0495668_0124838_135_1385 413
199 3300048905 Ga0496102_0026435 Ga0496102_0026435_2760_4022 413
200 3300048908 Ga0496105_0041286 Ga0496105_0041286_390_1652 413
201 3300048910 Ga0496107_0086641 Ga0496107_0086641_720_1982 413
202 3300048920 Ga0496117_0006187 Ga0496117_0006187_5053_6315 413
203 3300049571 Ga0501034_0002130 Ga0501034_0002130_1505_2761 413
204 3300053087 Ga0500643_000779 Ga0500643_000779_14445_15716 413
205 3300053087 Ga0500643_001992 Ga0500643_001992_7081_8325 413
206 3300053116 Ga0500592_000941 Ga0500592_000941_1634_2884 413
207 3300053151 Ga0500604_0008388 Ga0500604_0008388_1153_2403 413
208 3300053151 Ga0500604_0028656 Ga0500604_0028656_286_1536 413
209 3300053158 Ga0500627_0000768 Ga0500627_0000768_5634_6884 413
210 iso_pu_bacteria 2510917020 2511121825 413
211 iso_pu_bacteria 2829745981 2829747061 413
212 iso_pu_bacteria 2861691609 2861696590 413
213 3300005327 Ga0070658_10003281 Ga0070658_100032817 414
214 3300025230 Ga0209563_100019 Ga0209563_100019436 414
215 3300025909 Ga0207705_10010190 Ga0207705_100101901 414
216 3300005548 Ga0070665_100000492 Ga0070665_10000049212 415
217 3300021361 Ga0213872_10034629 Ga0213872_100346292 415
218 3300025933 Ga0207706_10258941 Ga0207706_102589411 415
219 3300028379 Ga0268266_10000002 Ga0268266_100000022272 415
220 3300038705 Ga0237819_00919 Ga0237819_00919_1659_2927 415
221 3300039447 Ga0436361_0144995 Ga0436361_0144995_1068_2378 415
222 3300046684 Ga0495669_0000003 Ga0495669_0000003_184025_185356 415
223 3300053108 Ga0500562_000547 Ga0500562_000547_4975_6243 415
224 iso_pu_bacteria 2582581279 2585147910 415
225 iso_pu_bacteria 2585428106 2587918326 415
226 iso_pu_bacteria 2643221598 2643999766 415
227 iso_pu_bacteria 2643221614 2644088193 415
228 iso_pu_bacteria 2643221640 2644227782 415
229 iso_pu_bacteria 2643221642 2644233957 415
230 iso_pu_bacteria 2643221661 2644343431 415
231 iso_pu_bacteria 2643221666 2644369092 415
232 iso_pu_bacteria 2791355048 2792458761 415
233 iso_pu_bacteria 2843744320 2843746990 415
234 iso_pu_bacteria 2849560528 2849565494 415
235 iso_pu_bacteria 2849573788 2849574529 415
236 iso_pu_bacteria 2851153111 2851154884 415
237 iso_pu_bacteria 2857504554 2857505467 415
238 iso_pu_bacteria 2884960567 2884962267 415
239 iso_pu_bacteria 2898329390 2898333136 415
240 3300005289 Ga0065704_10089783 Ga0065704_100897834 416
241 3300005331 Ga0070670_100000021 Ga0070670_10000002194 416
242 3300005331 Ga0070670_100001683 Ga0070670_10000168314 416
243 3300005335 Ga0070666_10000166 Ga0070666_100001662 416
244 3300005353 Ga0070669_100000042 Ga0070669_10000004232 416
245 3300005367 Ga0070667_100000221 Ga0070667_10000022131 416
246 3300005440 Ga0070705_100003906 Ga0070705_1000039064 416
247 3300005616 Ga0068852_100078002 Ga0068852_1000780022 416
248 3300005617 Ga0068859_100000311 Ga0068859_10000031143 416
249 3300005617 Ga0068859_100067650 Ga0068859_1000676504 416
250 3300005618 Ga0068864_100000004 Ga0068864_100000004262 416
251 3300005834 Ga0068851_10017809 Ga0068851_100178094 416
252 3300005841 Ga0068863_100000002 Ga0068863_100000002263 416
253 3300005842 Ga0068858_100001148 Ga0068858_1000011482 416
254 3300005843 Ga0068860_100006882 Ga0068860_1000068824 416
255 3300005844 Ga0068862_100000002 Ga0068862_100000002239 416
256 3300006931 Ga0097620_100000311 Ga0097620_1000003119 416
257 3300006931 Ga0097620_100067652 Ga0097620_1000676524 416
258 3300009101 Ga0105247_10000859 Ga0105247_100008598 416
259 3300009177 Ga0105248_10000010 Ga0105248_1000001081 416
260 3300009553 Ga0105249_10000122 Ga0105249_1000012267 416
261 3300009553 Ga0105249_10003308 Ga0105249_100033084 416
262 3300014325 Ga0163163_10030131 Ga0163163_100301317 416
263 3300014968 Ga0157379_10020436 Ga0157379_100204364 416
264 3300025315 Ga0207697_10000004 Ga0207697_1000000437 416
265 3300025903 Ga0207680_10000110 Ga0207680_100001109 416
266 3300025923 Ga0207681_10000002 Ga0207681_10000002351 416
267 3300025925 Ga0207650_10000298 Ga0207650_1000029850 416
268 3300025925 Ga0207650_10000969 Ga0207650_1000096924 416
269 3300025941 Ga0207711_10000038 Ga0207711_1000003880 416
270 3300025961 Ga0207712_10000393 Ga0207712_100003938 416
271 3300025961 Ga0207712_10005752 Ga0207712_100057524 416
272 3300025972 Ga0207668_10000769 Ga0207668_1000076913 416
273 3300025986 Ga0207658_10000256 Ga0207658_1000025635 416
274 3300025986 Ga0207658_10006969 Ga0207658_100069694 416
275 3300026035 Ga0207703_10005529 Ga0207703_100055295 416
276 3300026088 Ga0207641_10000002 Ga0207641_10000002743 416
277 3300026095 Ga0207676_10000005 Ga0207676_1000000564 416
278 3300028379 Ga0268266_10073828 Ga0268266_100738283 416
279 3300028380 Ga0268265_10000003 Ga0268265_10000003246 416
280 3300028380 Ga0268265_10000260 Ga0268265_1000026036 416
281 3300028381 Ga0268264_10000010 Ga0268264_10000010565 416
282 3300028794 Ga0307515_10066306 Ga0307515_100663062 416
283 3300046460 Ga0495638_0079853 Ga0495638_0079853_154_1422 416
284 3300046471 Ga0495650_0000024 Ga0495650_0000024_376630_377931 416
285 3300046512 Ga0495610_0000375 Ga0495610_0000375_44879_46147 416
286 3300046512 Ga0495610_0016059 Ga0495610_0016059_2112_3413 416
287 3300046524 Ga0495648_0024883 Ga0495648_0024883_76_1377 416
288 3300046660 Ga0495625_0004982 Ga0495625_0004982_8914_10182 416
289 3300047320 Ga0495672_0002232 Ga0495672_0002232_11585_12880 416
290 3300048920 Ga0496117_0011067 Ga0496117_0011067_4727_6001 416
291 3300048921 Ga0496118_0000327 Ga0496118_0000327_32541_33815 416
292 3300053096 Ga0500641_0017438 Ga0500641_0017438_621_1898 416
293 3300053118 Ga0500594_0005257 Ga0500594_0005257_1074_2363 416
294 3300053153 Ga0500616_0025110 Ga0500616_0025110_1061_2338 416
295 iso_pu_bacteria 2582581280 2585152929 416
296 iso_pu_bacteria 2582581293 2585195112 416
297 iso_pu_bacteria 2643221545 2643747094 416
298 iso_pu_bacteria 2643221584 2643929087 416
299 iso_pu_bacteria 2643221691 2644507708 416
300 iso_pu_bacteria 2739367664 2739649443 416
301 iso_pu_bacteria 2739367865 2740027916 416
302 iso_pu_bacteria 2818991435 2819536418 416
303 iso_pu_bacteria 2818991454 2819644673 416
304 iso_pu_bacteria 2928531327 2928533074 416
305 3300005331 Ga0070670_100000044 Ga0070670_10000004432 417
306 3300005347 Ga0070668_100000098 Ga0070668_10000009819 417
307 3300005347 Ga0070668_100002538 Ga0070668_10000253810 417
308 3300005353 Ga0070669_100007840 Ga0070669_1000078405 417
309 3300005355 Ga0070671_100000929 Ga0070671_10000092910 417
310 3300005367 Ga0070667_100000356 Ga0070667_1000003562 417
311 3300005367 Ga0070667_100044054 Ga0070667_1000440543 417
312 3300005548 Ga0070665_100000762 Ga0070665_10000076221 417
313 3300005548 Ga0070665_100001407 Ga0070665_1000014074 417
314 3300005548 Ga0070665_100002025 Ga0070665_10000202515 417
315 3300005618 Ga0068864_100000061 Ga0068864_10000006189 417
316 3300005841 Ga0068863_100028418 Ga0068863_1000284185 417
317 3300005842 Ga0068858_100003504 Ga0068858_10000350415 417
318 3300005842 Ga0068858_100054077 Ga0068858_1000540774 417
319 3300005843 Ga0068860_100000122 Ga0068860_10000012290 417
320 3300005843 Ga0068860_100002286 Ga0068860_10000228615 417
321 3300005843 Ga0068860_100063884 Ga0068860_1000638844 417
322 3300005844 Ga0068862_100000023 Ga0068862_1000000236 417
323 3300005844 Ga0068862_100001272 Ga0068862_1000012726 417
324 3300005844 Ga0068862_100147243 Ga0068862_1001472433 417
325 3300006042 Ga0075368_10007292 Ga0075368_100072923 417
326 3300006051 Ga0075364_10008791 Ga0075364_100087915 417
327 3300006178 Ga0075367_10003233 Ga0075367_100032332 417
328 3300006186 Ga0075369_10083212 Ga0075369_100832121 417
329 3300009011 Ga0105251_10002579 Ga0105251_1000257911 417
330 3300009101 Ga0105247_10004303 Ga0105247_100043032 417
331 3300009553 Ga0105249_10000004 Ga0105249_10000004358 417
332 3300009553 Ga0105249_10000478 Ga0105249_1000047812 417
333 3300013100 Ga0157373_10000210 Ga0157373_100002103 417
334 3300013306 Ga0163162_10103906 Ga0163162_101039063 417
335 3300021384 Ga0213876_10005136 Ga0213876_100051363 417
336 3300025735 Ga0207713_1002324 Ga0207713_100232412 417
337 3300025923 Ga0207681_10005559 Ga0207681_100055597 417
338 3300025925 Ga0207650_10000065 Ga0207650_1000006533 417
339 3300025931 Ga0207644_10002953 Ga0207644_1000295313 417
340 3300025941 Ga0207711_10007717 Ga0207711_100077172 417
341 3300025961 Ga0207712_10000008 Ga0207712_10000008489 417
342 3300025961 Ga0207712_10000625 Ga0207712_1000062526 417
343 3300025972 Ga0207668_10010888 Ga0207668_100108882 417
344 3300025972 Ga0207668_10032571 Ga0207668_100325713 417
345 3300025986 Ga0207658_10000168 Ga0207658_1000016833 417
346 3300025986 Ga0207658_10013120 Ga0207658_100131204 417
347 3300026035 Ga0207703_10030451 Ga0207703_100304514 417
348 3300026035 Ga0207703_10124531 Ga0207703_101245312 417
349 3300026088 Ga0207641_10004512 Ga0207641_100045123 417
350 3300026088 Ga0207641_10007099 Ga0207641_100070995 417
351 3300026088 Ga0207641_10020024 Ga0207641_100200246 417
352 3300026088 Ga0207641_10236953 Ga0207641_102369533 417
353 3300026095 Ga0207676_10000062 Ga0207676_10000062107 417
354 3300028379 Ga0268266_10001138 Ga0268266_1000113811 417
355 3300028379 Ga0268266_10001434 Ga0268266_100014344 417
356 3300028379 Ga0268266_10001678 Ga0268266_1000167817 417
357 3300028380 Ga0268265_10000035 Ga0268265_100000356 417
358 3300028380 Ga0268265_10001007 Ga0268265_1000100716 417
359 3300028380 Ga0268265_10023706 Ga0268265_100237064 417
360 3300028381 Ga0268264_10000172 Ga0268264_10000172104 417
361 3300028381 Ga0268264_10003203 Ga0268264_1000320314 417
362 3300028381 Ga0268264_10035947 Ga0268264_100359476 417
363 3300031456 Ga0307513_10077958 Ga0307513_100779583 417
364 3300039437 Ga0436365_0779181 Ga0436365_0779181_3853_5112 417
365 3300046515 Ga0495620_0027891 Ga0495620_0027891_417_1697 417
366 3300046538 Ga0495609_0032905 Ga0495609_0032905_300_1580 417
367 3300046542 Ga0495597_0003430 Ga0495597_0003430_1573_2853 417
368 3300047673 Ga0495593_0023012 Ga0495593_0023012_319_1599 417
369 3300048921 Ga0496118_0041306 Ga0496118_0041306_1151_2404 417
370 3300048924 Ga0496121_0020824 Ga0496121_0020824_4149_5405 417
371 3300048925 Ga0496122_0059360 Ga0496122_0059360_494_1747 417
372 3300050491 nmdc:mga00v17_672_c1 nmdc:mga00v17_672_c1_13856_15151 417
373 3300050493 nmdc:mga0k408_11381_c1 nmdc:mga0k408_11381_c1_420_1697 417
374 3300053080 Ga0500635_0000115 Ga0500635_0000115_36329_37609 417
375 3300053093 Ga0500651_0050857 Ga0500651_0050857_724_2004 417
376 3300053094 Ga0500566_0065991 Ga0500566_0065991_620_1900 417
377 3300053111 Ga0500572_000868 Ga0500572_000868_4060_5334 417
378 3300053119 Ga0500595_003335 Ga0500595_003335_3867_5147 417
379 3300053123 Ga0500614_005106 Ga0500614_005106_1062_2342 417
380 3300053177 Ga0500636_0019744 Ga0500636_0019744_2245_3525 417
381 3300053729 Ga0500625_027834 Ga0500625_027834_992_2272 417
382 iso_pu_bacteria 2643221560 2643823550 417
383 iso_pu_bacteria 2643221563 2643835957 417
384 iso_pu_bacteria 2643221608 2644056882 417
385 iso_pu_bacteria 2738541301 2738847951 417
386 iso_pu_bacteria 2738541304 2738863680 417
387 iso_pu_bacteria 2738543022 2739296198 417
388 iso_pu_bacteria 2738543033 2739357876 417
389 iso_pu_bacteria 2928100450 2928102661 417
390 iso_pu_bacteria 2928959182 2928959252 417
391 3300003794 Ga0055531_10012505 Ga0055531_100125054 418
392 3300025250 Ga0209026_1001075 Ga0209026_10010759 418
393 3300025304 Ga0209257_1000329 Ga0209257_100032926 418
394 3300049569 Ga0501032_0000970 Ga0501032_0000970_496_1767 418
395 3300053138 Ga0500564_066812 Ga0500564_066812_232_1506 418
396 3300053151 Ga0500604_0000003 Ga0500604_0000003_56454_57716 418
397 3300053153 Ga0500616_0000087 Ga0500616_0000087_138125_139387 418
398 iso_pu_bacteria 2830075706 2830076541 418
399 iso_pu_bacteria 2990265787 2990267341 418
400 iso_pu_bacteria 2993693658 2993695424 418
401 iso_pu_bacteria 3000865235 3000865722 418
402 iso_pu_bacteria 8057101203 8057103473 418
403 3300005335 Ga0070666_10023250 Ga0070666_100232502 419
404 3300005367 Ga0070667_100000036 Ga0070667_1000000368 419
405 3300005841 Ga0068863_100146532 Ga0068863_1001465322 419
406 3300005843 Ga0068860_100000063 Ga0068860_100000063161 419
407 3300006195 Ga0075366_10038636 Ga0075366_100386363 419
408 3300009093 Ga0105240_10039849 Ga0105240_100398493 419
409 3300025903 Ga0207680_10028966 Ga0207680_100289663 419
410 3300025913 Ga0207695_10041188 Ga0207695_100411883 419
411 3300025986 Ga0207658_10000444 Ga0207658_1000044413 419
412 3300026088 Ga0207641_10217857 Ga0207641_102178572 419
413 3300028381 Ga0268264_10000083 Ga0268264_10000083212 419
414 3300049573 Ga0501037_0009600 Ga0501037_0009600_1919_3190 419
415 3300049581 Ga0501047_0003781 Ga0501047_0003781_3056_4333 419
416 3300049584 Ga0501068_0000231 Ga0501068_0000231_5060_6331 419
417 3300049586 Ga0501070_0050882 Ga0501070_0050882_1923_3191 419
418 3300049589 Ga0501073_0000007 Ga0501073_0000007_7351_8622 419
419 3300049593 Ga0501077_0000003 Ga0501077_0000003_117344_118615 419
420 3300049742 Ga0501080_0000942 Ga0501080_0000942_19064_20335 419
421 3300050491 nmdc:mga00v17_114449_c1 nmdc:mga00v17_114449_c1_101_1381 419
422 3300053122 Ga0500608_000376 Ga0500608_000376_9625_10902 419
423 3300053123 Ga0500614_016401 Ga0500614_016401_186_1463 419
424 3300053138 Ga0500564_000523 Ga0500564_000523_8120_9397 419
425 3300053729 Ga0500625_000043 Ga0500625_000043_21360_22637 419
426 iso_pu_bacteria 2643221583 2643924396 419
427 iso_pu_bacteria 2643221605 2644038663 419
428 iso_pu_bacteria 2842698319 2842702344 419
429 iso_pu_bacteria 2852653556 2852655281 419
430 iso_pu_bacteria 2852680915 2852681076 419
431 3300005548 Ga0070665_100000038 Ga0070665_10000003843 420
432 3300005563 Ga0068855_100138774 Ga0068855_1001387742 420
433 3300009177 Ga0105248_10040857 Ga0105248_100408573 420
434 3300009177 Ga0105248_10095997 Ga0105248_100959972 420
435 3300010375 Ga0105239_10053291 Ga0105239_100532914 420
436 3300013306 Ga0163162_10052627 Ga0163162_100526273 420
437 3300025923 Ga0207681_10021972 Ga0207681_100219722 420
438 3300025941 Ga0207711_10059836 Ga0207711_100598362 420
439 3300025949 Ga0207667_10096116 Ga0207667_100961163 420
440 3300026116 Ga0207674_10034929 Ga0207674_100349292 420
441 3300028379 Ga0268266_10000634 Ga0268266_1000063419 420
442 3300031911 Ga0307412_10015962 Ga0307412_100159623 420
443 3300046616 Ga0495668_0063499 Ga0495668_0063499_391_1674 420
444 3300046684 Ga0495669_0031488 Ga0495669_0031488_636_1970 420
445 3300047472 Ga0495686_0000074 Ga0495686_0000074_101131_102411 420
446 3300048919 Ga0496116_0050460 Ga0496116_0050460_692_2005 420
447 3300048924 Ga0496121_0000053 Ga0496121_0000053_265775_267088 420
448 3300048928 Ga0496125_0077870 Ga0496125_0077870_222_1505 420
449 3300049570 Ga0501033_0007940 Ga0501033_0007940_5831_7099 420
450 3300049571 Ga0501034_0013289 Ga0501034_0013289_6026_7294 420
451 3300049572 Ga0501036_0005271 Ga0501036_0005271_4954_6222 420
452 3300049575 Ga0501039_0012885 Ga0501039_0012885_2856_4124 420
453 3300049579 Ga0501043_0018751 Ga0501043_0018751_126_1394 420
454 3300049822 Ga0501035_0002170 Ga0501035_0002170_15942_17210 420
455 3300049823 Ga0501044_0043600 Ga0501044_0043600_2145_3413 420
456 3300053087 Ga0500643_020496 Ga0500643_020496_446_1729 420
457 3300053133 Ga0500655_000164 Ga0500655_000164_2426_3760 420
458 3300053148 Ga0500590_007673 Ga0500590_007673_1897_3231 420
459 3300053156 Ga0500622_0077556 Ga0500622_0077556_165_1499 420
460 3300053177 Ga0500636_0092005 Ga0500636_0092005_57_1391 420
461 3300053724 Ga0500570_000419 Ga0500570_000419_10629_11963 420
462 iso_pu_bacteria 2582581305 2585262390 420
463 3300002459 JGI24751J29686_10000315 JGI24751J29686_1000031516 421
464 3300003781 Ga0055536_1007267 Ga0055536_10072676 421
465 3300003791 Ga0055530_10000035 Ga0055530_1000003563 421
466 3300003794 Ga0055531_10008012 Ga0055531_100080123 421
467 3300005262 Ga0065165_1006378 Ga0065165_10063787 421
468 3300005331 Ga0070670_100000003 Ga0070670_100000003261 421
469 3300005353 Ga0070669_100000020 Ga0070669_1000000203 421
470 3300005617 Ga0068859_100004356 Ga0068859_1000043562 421
471 3300005618 Ga0068864_100000005 Ga0068864_100000005127 421
472 3300005719 Ga0068861_100008377 Ga0068861_1000083774 421
473 3300005844 Ga0068862_100000001 Ga0068862_100000001331 421
474 3300006195 Ga0075366_10092786 Ga0075366_100927862 421
475 3300006931 Ga0097620_100004357 Ga0097620_1000043572 421
476 3300009177 Ga0105248_10013549 Ga0105248_100135494 421
477 3300014326 Ga0157380_10000041 Ga0157380_1000004110 421
478 3300017792 Ga0163161_10043187 Ga0163161_100431872 421
479 3300025291 Ga0209675_1000076 Ga0209675_100007699 421
480 3300025292 Ga0209676_1000085 Ga0209676_1000085105 421
481 3300025292 Ga0209676_1003034 Ga0209676_10030342 421
482 3300025294 Ga0209025_1016624 Ga0209025_10166245 421
483 3300025298 Ga0209050_1000042 Ga0209050_1000042144 421
484 3300025304 Ga0209257_1001455 Ga0209257_100145520 421
485 3300025304 Ga0209257_1002892 Ga0209257_10028925 421
486 3300025923 Ga0207681_10000005 Ga0207681_10000005471 421
487 3300025925 Ga0207650_10000004 Ga0207650_10000004258 421
488 3300025941 Ga0207711_10000836 Ga0207711_1000083623 421
489 3300026095 Ga0207676_10000006 Ga0207676_10000006453 421
490 3300026118 Ga0207675_100004055 Ga0207675_10000405511 421
491 3300028380 Ga0268265_10000001 Ga0268265_10000001703 421
492 3300031901 Ga0307406_10142251 Ga0307406_101422512 421
493 3300031911 Ga0307412_10059282 Ga0307412_100592822 421
494 3300032004 Ga0307414_10005462 Ga0307414_100054625 421
495 3300032004 Ga0307414_10037084 Ga0307414_100370843 421
496 3300032005 Ga0307411_10054450 Ga0307411_100544502 421
497 3300048906 Ga0496103_0001064 Ga0496103_0001064_11641_12933 421
498 3300048919 Ga0496116_0003047 Ga0496116_0003047_9494_10786 421
499 3300048920 Ga0496117_0003241 Ga0496117_0003241_11662_12954 421
500 3300048921 Ga0496118_0003630 Ga0496118_0003630_6208_7500 421
501 3300048922 Ga0496119_0012603 Ga0496119_0012603_358_1650 421
502 3300048927 Ga0496124_0003482 Ga0496124_0003482_11662_12954 421
503 3300049663 Ga0501223_000167 Ga0501223_000167_943_2238 421
504 3300049664 Ga0501224_000022 Ga0501224_000022_62641_63936 421
505 3300049705 Ga0501225_0000235 Ga0501225_0000235_928_2223 421
506 3300049853 Ga0501226_000146 Ga0501226_000146_4706_6001 421
507 3300003781 Ga0055536_1001598 Ga0055536_10015987 422
508 3300005347 Ga0070668_100010932 Ga0070668_1000109325 422
509 3300005367 Ga0070667_100000062 Ga0070667_10000006297 422
510 3300005548 Ga0070665_100000419 Ga0070665_10000041947 422
511 3300005841 Ga0068863_100000054 Ga0068863_10000005484 422
512 3300005843 Ga0068860_100010260 Ga0068860_1000102605 422
513 3300025292 Ga0209676_1000070 Ga0209676_1000070253 422
514 3300025903 Ga0207680_10019443 Ga0207680_100194435 422
515 3300025923 Ga0207681_10068342 Ga0207681_100683423 422
516 3300025972 Ga0207668_10003439 Ga0207668_100034399 422
517 3300025986 Ga0207658_10000039 Ga0207658_1000003934 422
518 3300026088 Ga0207641_10000095 Ga0207641_1000009536 422
519 3300028379 Ga0268266_10002353 Ga0268266_1000235312 422
520 3300028381 Ga0268264_10011087 Ga0268264_100110877 422
521 3300032004 Ga0307414_10002863 Ga0307414_100028632 422
522 3300032004 Ga0307414_10005332 Ga0307414_100053324 422
523 3300046616 Ga0495668_0000001 Ga0495668_0000001_586392_587669 422
524 3300046660 Ga0495625_0000237 Ga0495625_0000237_83726_85000 422
525 3300049679 Ga0501249_000456 Ga0501249_000456_2439_3722 422
526 3300049850 Ga0501204_003758 Ga0501204_003758_308_1591 422
527 3300053158 Ga0500627_0000004 Ga0500627_0000004_81246_82715 422
528 iso_pu_bacteria 2643221541 2643729178 422
529 iso_pu_bacteria 2643221606 2644045190 422
530 iso_pu_bacteria 2643221671 2644391363 422
531 3300005355 Ga0070671_100013020 Ga0070671_1000130202 423
532 3300005367 Ga0070667_100151426 Ga0070667_1001514261 423
533 3300005548 Ga0070665_100024940 Ga0070665_1000249405 423
534 3300005563 Ga0068855_100030158 Ga0068855_1000301584 423
535 3300005578 Ga0068854_100007655 Ga0068854_1000076552 423
536 3300005614 Ga0068856_100038164 Ga0068856_1000381643 423
537 3300005616 Ga0068852_100000169 Ga0068852_10000016920 423
538 3300005617 Ga0068859_100001527 Ga0068859_10000152721 423
539 3300005841 Ga0068863_100004485 Ga0068863_10000448513 423
540 3300005842 Ga0068858_100014835 Ga0068858_1000148351 423
541 3300005843 Ga0068860_100057027 Ga0068860_1000570273 423
542 3300006931 Ga0097620_100001527 Ga0097620_10000152721 423
543 3300009093 Ga0105240_10015210 Ga0105240_100152104 423
544 3300009177 Ga0105248_10005714 Ga0105248_100057145 423
545 3300009551 Ga0105238_10262991 Ga0105238_102629911 423
546 3300014968 Ga0157379_10004017 Ga0157379_1000401710 423
547 3300025904 Ga0207647_10016024 Ga0207647_100160242 423
548 3300025904 Ga0207647_10071941 Ga0207647_100719412 423
549 3300025909 Ga0207705_10000009 Ga0207705_10000009492 423
550 3300025913 Ga0207695_10062566 Ga0207695_100625662 423
551 3300025931 Ga0207644_10000345 Ga0207644_1000034512 423
552 3300025941 Ga0207711_10134720 Ga0207711_101347202 423
553 3300025949 Ga0207667_10029219 Ga0207667_100292194 423
554 3300025972 Ga0207668_10014254 Ga0207668_100142542 423
555 3300025981 Ga0207640_10000698 Ga0207640_100006982 423
556 3300026035 Ga0207703_10001385 Ga0207703_100013852 423
557 3300026078 Ga0207702_10016141 Ga0207702_100161414 423
558 3300026088 Ga0207641_10015439 Ga0207641_100154395 423
559 3300026142 Ga0207698_10000482 Ga0207698_1000048210 423
560 3300028379 Ga0268266_10055942 Ga0268266_100559422 423
561 3300028380 Ga0268265_10094869 Ga0268265_100948692 423
562 3300053139 Ga0500568_0004001 Ga0500568_0004001_5736_7016 423
563 2162886007 SwRhRL2b_contig_3318283 SwRhRL2b_0442.00000820 424
564 3300005289 Ga0065704_10070200 Ga0065704_1007020078 424
565 3300025981 Ga0207640_10003407 Ga0207640_100034078 424
566 3300039447 Ga0436361_0995739 Ga0436361_0995739_3809_5113 424
567 iso_pu_bacteria 2738541281 2738743258 424
568 iso_pu_bacteria 2738543032 2739352875 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

14

231

0.93

PF07690

MFS_1

Major Facilitator Superfamily

18

384

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sc3-assembly1.cif.gz_A human oct1 bound to fenoterol in inward-open conformation 0.8182 48 416
7sp5-assembly1.cif.gz_A crystal structure of a eukaryotic phosphate transporter 0.8047 7 420
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.8033 53 416
8sc4-assembly1.cif.gz_A human oct1 bound to metformin in inward-open conformation 0.7962 45 409
7sp5-assembly1.cif.gz_A crystal structure of a eukaryotic phosphate transporter 0.7856 7 420
ID Description Score Start End Superfamily
af_O05301_232_420_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9577 235 415 1.20.1250.20
af_P37643_245_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9411 232 420 1.20.1250.20
af_P76350_21_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9174 9 227 1.20.1250.20
af_O05301_232_420_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9138 235 415 1.20.1250.20
af_P37643_245_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9088 232 420 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0H2XNC4-F1-model_v4 General substrate transporter 0.9668 7 419 GO:0005886
GO:0022857
AF-A0A8A8F4C9-F1-model_v4 deleted 0.9655 7 419
AF-N0AZU8-F1-model_v4 General substrate transporter 0.9644 7 420 GO:0005886
GO:0022857
AF-A0A2N7WXG9-F1-model_v4 Inner membrane metabolite transport protein YhjE (MFS transporter) 0.9643 7 424 GO:0005886
GO:0022857
AF-A0A4R1PEJ3-F1-model_v4 deleted 0.9641 7 415

Feature Viewer

pLDDT pTM Quality
89.58 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map